Our database now contains whois records of 640 Million (640,171,828) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [640 Million Domains] $10,000 Details

Keyword: MAGGIE

Reverse Whois » KEYWORD [maggie ]  { 22,163 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1maggie.tvDropCatch.com 991 LLC18 Mar 201621 Mar 201718 Mar 2018
2maggie.usBlue Razor Domains, LLC19 Aug 20141 Sep 202518 Aug 2025
3maggie.picsPorkbun, LLC7 Nov 202312 Dec 20247 Nov 2025
4maggie.xyzDynadot, LLC31 Mar 202011 Apr 202531 Mar 2034
5maggie.votingRegistryGate GmbH23 Jul 2014-23 Jul 2015
6maggie.rocksGo Australia Domains, LLC6 Aug 201411 Aug 20256 Aug 2026
7maggie.hiphopUniregistrar Corp23 Sep 201423 Sep 201423 Sep 2015
8maggie.nycTucows Domains Inc.18 Nov 201621 Nov 202417 Nov 2025
9maggie.coffeeTucows Domains Inc.20 Jan 201524 Jan 202520 Jan 2026
10maggie.wangAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…15 Jan 202315 Jan 202315 Jan 2031
11maggie.codesGandi SAS15 Jan 2015-15 Jan 2027
12maggie.emailDynadot, LLC28 Dec 20242 Jan 202528 Dec 2025
13maggie.vacationsGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2016
14maggie.websiteGoDaddy.com, LLC31 Jan 20157 Apr 201531 Jan 2018
15maggie.redXiamen ChinaSource Internet Service Co., Ltd.18 Oct 201921 Oct 201918 Oct 2020
16maggie.walesTucows Domains Inc.1 Mar 201530 Jan 20251 Mar 2026
17maggie.ren-1 Jun 20161 Jun 20161 Jun 2017
18maggie.todayGoDaddy.com, LLC14 Oct 202419 Oct 202414 Oct 2025
19maggie.linkUniregistrar Corp27 Nov 201727 Nov 201727 Nov 2018
20maggie.designNamesilo, LLC31 Aug 202028 Feb 202531 Aug 2025
21maggie.spaceKey-Systems, LLC24 Jun 201526 Jun 201524 Jun 2016
22maggie.siteGoDaddy.com, LLC15 Jul 201526 Aug 202415 Jul 2024
23maggie.top-28 May 20249 Jun 202528 May 2025
24maggie.bandGoDaddy.com, LLC25 Aug 20157 Sep 202525 Aug 2026
25maggie.onlineGo France Domains, LLC26 Aug 201516 Apr 202526 Aug 2025
26maggie.mobiWild West Domains, LLC13 Jul 202318 Jul 202513 Jul 2026
27maggie.beerCrazy Domains FZ-LLC30 Sep 2015-30 Sep 2016
28maggie.feedbackReserved for non-billable transactions where Regis…15 Oct 201530 Nov 202415 Oct 2025
29maggie.houseGandi SAS31 Oct 2015-31 Oct 2025
30maggie.com-26 May 199726 May 202525 May 2026
31maggie.soccerTucows Domains Inc.10 Dec 201514 Oct 202410 Dec 2025
32maggie.life-24 Apr 202524 Apr 202524 Apr 2026
33maggie.giftUniregistrar Corp27 Nov 201727 Nov 201727 Nov 2019
34maggie.netPDR Ltd. d/b/a PublicDomainRegistry.com13 Feb 20013 Jun 202513 Feb 2026
35maggie.orgNetwork Solutions, LLC24 Dec 199925 Oct 202024 Dec 2025
36maggie.pet1&1 Internet AG6 Mar 201926 Oct 20216 Mar 2027
37maggie.careGoDaddy.com, LLC9 Mar 202020 Apr 20259 Mar 2025
38maggie.proTucows Domains Inc.25 Feb 201624 Feb 202525 Feb 2026
39maggie.realtorName Share, Inc.26 Jan 202227 Dec 202326 Jan 2025
40maggie.xin-15 Mar 201615 Mar 201615 Mar 2017
41maggie.techNameCheap, Inc.28 Apr 201628 Apr 201628 Apr 2017
42maggie.oneDynadot, LLC16 Jul 202416 Jul 202516 Jul 2025
43maggie.xn--rhqv96gChengdu West Dimension Digital Technology Co., Ltd…1 Jun 20161 Jun 201631 May 2017
44maggie.guruAutomattic Inc.27 Jan 20251 Feb 202527 Jan 2026
45maggie.landTucows Domains Inc.8 Mar 201412 Mar 20258 Mar 2026
46maggie.xn--6qq986b3xlAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…21 May 201721 May 201721 May 2018
47maggie.photosName.com, Inc.21 Jun 20144 Jun 201721 Jun 2018
48maggie.ninjaAutomattic Inc.26 Jan 202531 Jan 202526 Jan 2026
49maggie.photographyGoogle, Inc.8 Oct 20228 Oct 20248 Oct 2025
50maggie.churchNetwork Solutions, LLC11 Oct 202211 Oct 202211 Oct 2023
51maggie.sexyUniregistrar Corp15 Apr 201411 May 201615 Apr 2017
52maggie.lolPorkbun, LLC11 Jul 202410 Jul 202511 Jul 2026
53maggie.photoName.com, Inc.21 Jun 20144 Jun 201721 Jun 2018
54maggie.bizDynadot, LLC26 Nov 202411 Jan 202526 Nov 2025
55maggie.marketingPorkbun, LLC21 Oct 201826 Oct 201821 Oct 2020
56maggie.studioGoDaddy.com, LLC11 Feb 20227 Jul 202411 Feb 2026
57maggie.pubAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…29 Aug 20169 Oct 201729 Aug 2019
58maggie.asiaDNSPod, Inc.18 Apr 202423 Apr 202418 Apr 2034
59maggie.yogaNetwork Solutions, LLC23 Sep 201623 Sep 201623 Sep 2017
60maggie.coolGoogle, Inc.17 Jul 20207 Jul 202517 Jul 2026
61maggie.infoNetwork Solutions, LLC29 Jul 202231 Jul 202529 Jul 2026
62maggie.technologyeNom, Inc.12 Oct 201621 Nov 201912 Oct 2020
63maggie.worldGoDaddy.com, LLC28 Jun 202413 Jul 202528 Jun 2026
64maggie.ltdAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…13 Oct 20168 Feb 201813 Oct 2020
65maggie.cityNamesilo, LLC21 Dec 202324 Jan 202521 Dec 2024
66maggie.telInternet Domain Services BS Corp3 Feb 200925 Apr 202522 Mar 2026
67maggie.skiReserved for billable transactions where Registry …2 Sep 201517 Oct 20232 Sep 2024
68maggie.li----
69maggie.it-15 Jun 201017 Jul 20251 Jul 2026
70maggie.scienceAlpnames Limited2 Mar 20172 Mar 20171 Mar 2018
71maggie.dogNameCheap, Inc.21 Jun 202122 May 202521 Jun 2026
72maggie.galleryGoDaddy.com, LLC9 Jul 201716 Apr 20229 Jul 2022
73maggie.gameUniregistrar Corp31 Jul 201731 Jul 201731 Jul 2018
74maggie.chat-22 Mar 202517 Jul 202522 Mar 2026
75maggie.exposedTucows Domains Inc.30 Aug 20173 Sep 201830 Aug 2019
76maggie.groupDynadot, LLC28 Dec 202421 Jun 202528 Dec 2025
77maggie.digitalHostinger, UAB1 Dec 20246 Dec 20241 Dec 2025
78maggie.co.uk-9 Jul 200224 Oct 20169 Jul 2018
79maggie.internationalGoDaddy.com, LLC23 Feb 201823 Feb 201823 Feb 2019
80maggie.wikiNameCheap, Inc.18 Apr 202523 Apr 202518 Apr 2026
81maggie.solutionsGoDaddy.com, LLC11 Jun 201814 Jun 202011 Jun 2022
82maggie.companyGoDaddy.com, LLC11 Jun 201816 Jun 201811 Jun 2020
83maggie.fyiDynadot, LLC18 Nov 202423 Nov 202418 Nov 2025
84maggie.mediaGoDaddy.com, LLC6 Jan 201918 Mar 20246 Jan 2024
85maggie.devGoogle, Inc.25 Feb 201926 Jun 202525 Feb 2026
86maggie.showPDR Ltd. d/b/a PublicDomainRegistry.com2 Jul 201911 Sep 20242 Jul 2024
87maggie.services1&1 Internet AG7 Nov 201922 Dec 20247 Nov 2025
88maggie.worksNameCheap, Inc.23 Mar 202021 Feb 202523 Mar 2026
89maggie.tennisCSL Computer Service Langenbach GmbH d/b/a joker.c…4 Jan 201712 Dec 20224 Jan 2026
90maggie.blueNameCheap, Inc.28 May 20203 Oct 202428 May 2028
91maggie.graphicsGoDaddy.com, LLC13 Jun 202013 Jun 202013 Jun 2021
92maggie.styleGoDaddy.com, LLC21 Jun 20201 Sep 202321 Jun 2023
93maggie.goldHostinger, UAB16 Jul 202416 Jul 202516 Jul 2026
94maggie.coachName.com, Inc.21 Sep 202021 Sep 202021 Sep 2021
95maggie.cloudHostinger, UAB19 Jul 202519 Jul 202519 Jul 2026
96maggie.realtyEpik Inc.30 Sep 202015 Nov 202130 Sep 2022
97maggie.homesGoogle, Inc.4 Nov 20204 Nov 20204 Nov 2021
98maggie.clubGoDaddy.com, LLC21 Jan 20214 Mar 202521 Jan 2025
99maggie.voteGoDaddy.com, LLC28 Mar 202112 May 202528 Mar 2026
100maggie.wineNameCheap, Inc.21 Apr 202121 Apr 202321 Apr 2024
101maggie.artGoDaddy.com, LLC25 Apr 20236 Jun 202525 Apr 2025
102maggie.hostDomain.com, LLC8 Sep 202129 Aug 20248 Sep 2025
103maggie.moeDynadot, LLC18 Nov 202423 Nov 202418 Nov 2025
104maggie.kitchenNameCheap, Inc.23 Dec 202123 Dec 202123 Dec 2022
105maggie.inNameCheap, Inc.15 Nov 201829 May 202515 Nov 2025
106maggie.runXin Net Technology Corporation-15 Oct 202415 Oct 2026
107maggie.bioGoogle, Inc.9 Jun 20213 Jun 20259 Jun 2026
108maggie.bestPorkbun, LLC10 Jan 202022 Jan 202510 Jan 2026
109maggie.app-21 May 20185 Jul 202521 May 2026
110maggie.blogReserved for non-billable transactions where Regis…19 Oct 201613 Oct 202419 Oct 2025
111maggie.blackGoDaddy.com, LLC3 Mar 202317 Apr 20253 Mar 2026
112maggie.socialDynadot, LLC14 Jan 202519 Jan 202514 Jan 2026
113maggie.earthGoDaddy.com, LLC24 Jan 202030 Jan 202524 Jan 2026
114maggie.gy-6 Jul 20104 Jul 20256 Jul 2026
115maggie.gop101domain, Inc.21 Mar 202421 Jan 202521 Mar 2026
116maggie.lawNameCheap, Inc.22 Jun 202527 Jun 202522 Jun 2026
117maggie.workTucows Domains Inc.6 Sep 201710 Sep 20246 Sep 2025
118maggie.ro-7 Mar 2006-5 Jul 2026
119maggie.zipGoogle, Inc.11 May 202322 Jun 202511 May 2025
120maggie.zoneNameCheap, Inc.12 Jul 202317 Jun 202512 Jul 2026
121maggie.yachtsPorkbun, LLC15 Jul 202327 Aug 202415 Jul 2024
122maggie.boatsPorkbun, LLC3 Aug 202314 Aug 20253 Aug 2026
123maggie.ovhOVH sas18 Aug 202315 Oct 202418 Aug 2024
124maggie.visionGoDaddy.com, LLC23 Oct 202312 Sep 202423 Oct 2028
125maggie.co.ke-17 Aug 202317 Sep 202417 Aug 2024
126maggie.rsvpPorkbun, LLC7 Nov 20235 Nov 20247 Nov 2025
127maggie.id.au--3 Jul 2025-
128maggie.expertName.com, Inc.18 Jan 202421 Jan 202518 Jan 2026
129maggie.lovePorkbun, LLC15 Jul 202515 Jul 202515 Jul 2027
130maggie.bostonGoDaddy.com, LLC19 Jan 202422 Aug 202419 Jan 2026
131maggie.cl-12 Jun 2016-12 Jun 2026
132maggie.com.au--13 Mar 2025-
133maggie.autosNameCheap, Inc.13 Mar 202424 Apr 202513 Mar 2025
134maggie.babyNameCheap, Inc.10 Apr 202422 May 202510 Apr 2025
135maggie.aiDynadot, LLC4 Feb 20205 Jul 20254 Feb 2026
136maggie.nl-23 May 201711 Jun 2025-
137maggie.me.uk-27 Apr 20212 May 202527 Apr 2027
138maggie.uk-16 Aug 201815 Aug 202516 Aug 2026
139maggie.ru-30 Mar 2009-30 Mar 2026
140maggie.hu-1 Jun 2010--
141maggie.plus1&1 Internet AG27 May 20246 Jun 202527 May 2025
142maggie.nz-18 Jun 202318 Jun 2025-
143maggie.fashionDNSPod, Inc.26 Jul 202429 Jul 202526 Jul 2025
144maggie.cz-3 Nov 202222 Apr 20253 Nov 2025
145maggie.partseNom, Inc.8 Sep 202413 Sep 20248 Sep 2025
146maggie.inkPorkbun, LLC12 Sep 202417 Jan 202512 Sep 2025
147maggie.newsNameCheap, Inc.22 Dec 2024-22 Dec 2025
148maggie.sk-24 Sep 200711 Oct 202424 Sep 2025
149maggie.casaCloudFlare, Inc.26 Feb 20253 Mar 202526 Feb 2026
150maggie.dayNameCheap, Inc.8 Mar 2025-8 Mar 2026
151maggie.directoryGoDaddy.com, LLC13 Apr 202526 Apr 202513 Apr 2027
152maggie.cafeAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 May 202530 May 202525 May 2026
153maggie.buzzGoogle, Inc.6 Jun 202526 Jun 20256 Jun 2026
154maggie.se-12 Aug 202422 Aug 202512 Aug 2025
155maggie.co-24 Sep 201116 Sep 202423 Sep 2026
156maggie.au--6 Aug 2025-
157maggie.helpPorkbun, LLC7 Aug 20257 Aug 20257 Aug 2026
158maggie.beautyNameCheap, Inc.9 Aug 20259 Aug 20259 Aug 2026
159maggie.pl-8 Sep 20258 Sep 20258 Sep 2026
160maggie.familyGoogle, Inc.16 Sep 202516 Sep 202516 Sep 2026
161maggiemake.comNet-Chinese Co., Ltd.11 Jun 200612 Jun 202411 Jun 2025
162maggiebeer.com.au--7 Jun 2025-
163maggiesnotebook.comNamesilo, LLC25 Jul 200613 Dec 202425 Jul 2026
164maggieonstore.comNameCheap, Inc.25 Aug 201012 Feb 202025 Aug 2025
165maggiescrochet.comGoDaddy.com, LLC7 Dec 19984 Sep 20226 Dec 2025
166maggiesdirect.com1&1 Internet AG22 May 202522 May 202522 May 2026
167maggiesottero.comregister.com, Inc.16 Jul 200116 Jun 202516 Jul 2028
168maggiebags.netNameCheap, Inc.20 Dec 200728 Jan 202520 Dec 2025
169maggieflaniganstudio.comGoDaddy.com, LLC24 Oct 200117 Jan 202524 Oct 2025
170maggiepatterson.comGoDaddy.com, LLC19 Apr 201219 Apr 202419 Apr 2026
171maggiesensei.com1&1 Internet AG10 Jun 20096 May 202310 Jun 2026
172maggiesmunchies.comSquarespace Domains LLC2 Sep 20252 Sep 20252 Sep 2026
173maggiepostnikoff.comregister.com, Inc.22 Oct 201422 Oct 201422 Oct 2015
174maggieleeburke.comGoDaddy.com, LLC21 Oct 201421 Oct 201421 Oct 2016
175maggiehalldesigns.comGoDaddy.com, LLC21 Oct 201422 Oct 202421 Oct 2025
176maggiegreen.comDomain.com, LLC31 Jan 20039 Jul 202531 Jan 2026
177maggiesusedbooks.comFastDomain Inc.23 Oct 201423 Oct 201723 Oct 2018
178maggieshafran.comGoDaddy.com, LLC22 Oct 201426 Oct 202422 Oct 2029
179maggiesandcosmospizza.comregister.com, Inc.23 Oct 201423 Oct 201423 Oct 2015
180maggiemayed.comName.com, Inc.22 Oct 201421 Oct 202422 Oct 2025
181maggiekavanaghwrites.comWild West Domains, LLC23 Oct 201423 Oct 201423 Oct 2015
182maggiebaker1.com1&1 Internet AG22 Oct 201422 Oct 201422 Oct 2015
183maggieanddanny.comGoDaddy.com, LLC23 Oct 201423 Oct 202423 Oct 2025
184maggiewilcox.comNameCheap, Inc.23 Oct 201423 Sep 202423 Oct 2025
185maggiesplanet.comTucows Domains Inc.31 Aug 202531 Aug 202531 Aug 2026
186maggies-corner.comAutomattic Inc.18 Jan 202018 Jan 202018 Jan 2021
187maggieqcosmetics.com1API GmbH23 Oct 201423 Oct 201423 Oct 2015
188maggiebritton.comDropCatch.com 373 LLC23 Oct 201424 Oct 201723 Oct 2018
189maggiestiefvater.comGoDaddy.com, LLC17 Dec 20064 Sep 202217 Dec 2025
190maggiecurran.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Aug 200316 Jul 202515 Aug 2026
191maggienancarrow.comFastDomain Inc.2 Jul 201117 Jun 20252 Jul 2026
192maggiescentres.org1&1 Internet AG4 Oct 200218 Nov 20244 Oct 2025
193maggiewhitley.comGoDaddy.com, LLC24 Jul 200924 Jul 202524 Jul 2026
194maggiesemall.comMelbourne IT, Ltd20 Jul 202325 Oct 202320 Jul 2026
195maggielopez3d.comGoDaddy.com, LLC25 Oct 201417 Sep 201625 Oct 2017
196maggiedaleypark.comGoDaddy.com, LLC5 Jan 201512 Aug 20255 Jan 2035
197maggiesorganics.comNetwork Solutions, LLC20 Sep 200222 Jul 202520 Sep 2026
198maggiemistal.comMelbourne IT, Ltd29 Sep 20021 Dec 202429 Sep 2026
199maggies-corner.neteNom, Inc.23 Oct 201423 Oct 201423 Oct 2015
200maggiesteele.tvGoDaddy.com, LLC24 May 201425 May 201524 May 2016
201maggiefitzg.comGoDaddy.com, LLC26 May 201327 May 201526 May 2016
202maggieruthcreations.comGoDaddy.com, LLC27 May 20138 Jun 201527 May 2016
203maggielockeemerson.comDomain.com, LLC12 Oct 200427 Sep 201712 Oct 2018
204maggielocke.comSquarespace Domains LLC6 Nov 202318 Dec 20246 Nov 2024
205maggiedeptuck.comGoDaddy.com, LLC28 May 201329 May 201528 May 2016
206maggiekolenkophotography.comGoDaddy.com, LLC28 May 201429 May 201528 May 2016
207maggiesams.comWild West Domains, LLC29 May 201329 May 201529 May 2016
208maggiesknitting.com----
209maggie63workfromhome.bizWild West Domains, LLC30 May 201330 May 201329 May 2015
210maggie-trumansburgweb.comGoDaddy.com, LLC3 Aug 201423 Apr 20153 Aug 2015
211maggiemaeve.comGoDaddy.com, LLC31 May 20141 Jun 201531 May 2016
212maggielockeemerson.netDomain.com, LLC12 Oct 200427 Sep 201712 Oct 2018
213maggielocke.netDomain.com, LLC12 Oct 200427 Sep 201712 Oct 2018
214maggiemarshmallow.comWild West Domains, LLC31 May 20091 Jun 201531 May 2016
215maggievalleychamber.comWild West Domains, LLC1 Jun 20112 Jun 20151 Jun 2016
216maggiezeng.comNameCheap, Inc.1 Jun 202313 Jul 20241 Jun 2024
217maggieyjose.comNetwork Solutions, LLC26 Oct 201424 Oct 201626 Oct 2017
218maggieswiftblog.comGoDaddy.com, LLC26 Oct 201426 Oct 201426 Oct 2015
219maggiestlist.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Oct 201426 Oct 201426 Oct 2015
220maggieshenanigans.comDreamHost, LLC26 Oct 20148 Jan 202526 Oct 2024
221maggiesbump.comTucows Domains Inc.23 Oct 201227 Oct 201423 Oct 2015
222maggieboylan.comregister.com, Inc.26 Oct 201411 Oct 201726 Oct 2019
223maggie8.comGoDaddy.com, LLC19 Nov 202321 Oct 202419 Nov 2026
224maggies-home.comGoDaddy.com, LLC23 May 201124 May 201523 May 2016
225maggiesniche.comGoDaddy.com, LLC4 Jun 20135 Jun 20154 Jun 2016
226maggiescustomembroidery.comGoDaddy.com, LLC4 Jun 20135 Jun 20154 Jun 2016
227maggiedownsmusic.comGoDaddy.com, LLC4 Jun 20135 Jun 20154 Jun 2016
228maggiesbluesshop.comGoDaddy.com, LLC5 Jun 201110 Jun 20155 Jun 2016
229maggiejonespilates.comGoDaddy.com, LLC20 Sep 201521 Sep 202320 Sep 2025
230maggiegadbois.comWild West Domains, LLC5 Jun 20086 Jun 20155 Jun 2016
231maggiemagnuson.comGoDaddy.com, LLC27 Oct 201427 Oct 201427 Oct 2015
232maggiekelly.asia-28 Oct 201423 Oct 201628 Oct 2017
233maggiefinns.comMesh Digital Limited27 Oct 20143 Nov 201727 Oct 2019
234maggieburant.comTucows Domains Inc.22 May 20167 May 202522 May 2026
235maggieadamsbooks.comNetwork Solutions, LLC27 Oct 201427 Sep 202427 Oct 2026
236maggie-spicer.comNetwork Solutions, LLC27 Oct 201420 Jul 201727 Oct 2019
237maggie-sanderson.comTucows Domains Inc.24 Oct 201329 Oct 202224 Oct 2023
238maggieanns.netGoDaddy.com, LLC13 Jun 201513 Jun 201513 Jun 2016
239maggiereilly.comeNom, Inc.16 Mar 201120 Mar 202516 Mar 2026
240maggieddd.infoDomain.com, LLC27 Oct 2014-27 Oct 2015
241maggiemorrell.comGoDaddy.com, LLC28 Oct 201429 Oct 202428 Oct 2025
242maggieinlove.comTucows Domains Inc.28 Oct 20141 Nov 201528 Oct 2016
243maggieharveytrust.comTucows Domains Inc.8 Feb 201121 Apr 20258 Feb 2025
244maggiecurry.com-28 Oct 201428 Oct 201428 Oct 2017
245maggie-wonka.comGMO Internet Inc.28 Oct 201428 Oct 201428 Oct 2015
246maggiedoyne.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…29 Jul 202213 Sep 202329 Jul 2023
247maggiemcguire.comeNom, Inc.10 Jun 201118 Jun 202510 Jun 2026
248maggievalleycabins.usGoDaddy.com, LLC27 Oct 201428 Oct 202426 Oct 2028
249maggiesinteriordesign.comTucows Domains Inc.26 Oct 201330 Oct 201426 Oct 2015
250maggiemyoung.comNetwork Solutions, LLC30 Oct 20141 Nov 201730 Oct 2018
251maggiemiss.comBizcn.com, Inc.22 Jun 202425 Jul 202522 Jun 2025
252maggieharrislee.comGoDaddy.com, LLC29 Oct 201426 Oct 201529 Oct 2017
253maggiewinslettfairygrandmothercom.comGoDaddy.com, LLC30 Oct 201422 Apr 201514 Dec 2018
254maggiescratchers.comNetwork Solutions, LLC30 Oct 201430 Oct 201430 Oct 2015
255maggieqwebcom.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
256maggielaw.comTurnCommerce, Inc. DBA NameBright.com30 Oct 201424 Oct 202030 Oct 2025
257maggiedaems.comInfomaniak Network SA30 Oct 201416 Oct 202430 Oct 2025
258maggieaachchi.comGoDaddy.com, LLC6 Oct 200821 May 20256 Oct 2025
259maggiejane.orgNameCheap, Inc.29 Oct 20144 Oct 202429 Oct 2025
260maggie-crittendon.useNom, Inc.29 Oct 201429 Oct 201428 Oct 2015
261maggiegrace.orgGoDaddy.com, LLC16 Sep 20087 Jun 201516 Sep 2015
262maggieq.netBeijing Lanhai Jiye Technology Co., Ltd30 Mar 202516 Jul 202530 Mar 2026
263maggiemakes.comInternet Domain Services BS Corp1 Dec 20244 Feb 20251 Dec 2026
264maggierosecouture.comGoDaddy.com, LLC21 Jan 201921 Jan 201921 Jan 2020
265maggie-mcclary.useNom, Inc.8 Aug 201425 Sep 20147 Aug 2015
266maggiewebber.com.au----
267maggieqweb.comGoDaddy.com, LLC31 Oct 201431 Oct 201431 Oct 2015
268maggiejeandesigns.comTucows Domains Inc.31 Oct 201430 Oct 202431 Oct 2025
269maggiegyllenhaal.netGoDaddy.com, LLC12 Mar 200813 Mar 201512 Mar 2016
270maggieparr.comTiger Technologies LLC23 Jun 200524 Jun 202523 Jun 2026
271maggie-maes.comNetwork Solutions, LLC14 Jul 200315 May 202514 Jul 2027
272maggieterlecki.comCompuglobalhypermega.com LLC26 Nov 20218 Feb 202526 Nov 2024
273maggievalleybikefest.com-11 Oct 202111 Oct 202111 Oct 2022
274maggie-q.netDynadot, LLC4 Aug 20254 Aug 20254 Aug 2026
275maggiemaecountry.comGoDaddy.com, LLC16 Nov 200415 Nov 202416 Nov 2025
276maggiegalton.comGoDaddy.com, LLC15 Dec 20085 Sep 202215 Dec 2028
277maggiespub.netNameCheap, Inc.6 Jul 20236 Jul 20256 Jul 2026
278maggiemadecards.comGoDaddy.com, LLC23 Oct 20115 Nov 202123 Oct 2026
279maggiewelby.orgNetwork Solutions, LLC3 Jan 20069 Nov 20243 Jan 2026
280maggiemadeit.comNamesilo, LLC25 Oct 202425 Oct 202425 Oct 2025
281maggievalleyrvpark.comGoDaddy.com, LLC6 Nov 20197 Nov 20246 Nov 2025
282maggie-lane.comGoDaddy.com, LLC23 Feb 201024 Feb 201723 Feb 2020
283maggievalleyusa.comProtocol Internet Technology Limited T/A Hosting I…11 Nov 202217 Jan 202411 Nov 2023
284maggiebarnesclothing.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Feb 200626 Jan 201710 Feb 2018
285maggiesmexican.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Apr 20116 May 201415 Apr 2016
286maggiestygoting.comNameCheap, Inc.8 Sep 202220 Oct 20238 Sep 2023
287maggiepiedust.comGoDaddy.com, LLC16 Nov 20142 Dec 201416 Nov 2015
288maggieblanck.comNetwork Solutions, LLC18 Nov 200123 Jul 202518 Nov 2025
289maggienowdesign.comGoDaddy.com, LLC5 Nov 20205 Nov 20205 Nov 2021
290maggiesrags.comNetwork Solutions, LLC24 Aug 199824 Jun 202423 Aug 2027
291maggiestolzbergblog.comWest263 International Limited23 Dec 201923 Dec 201923 Dec 2020
292maggiehooks.comGoDaddy.com, LLC15 May 201425 Apr 202515 May 2026
293maggiebeesflowers.netGoDaddy.com, LLC4 Sep 200323 Apr 20154 Sep 2015
294maggiecrochet.comKey-Systems GmbH11 Dec 200415 Jul 202510 Jun 2026
295maggiescafealbany.comGoDaddy.com, LLC15 Nov 201026 Oct 202415 Nov 2025
296maggieandfredsayido.comeNom, Inc.11 Jun 201412 Jun 201511 Jun 2016
297maggielibby.comTucows Domains Inc.2 Nov 201424 Apr 20252 Nov 2025
298maggieblank.comGoDaddy.com, LLC2 Nov 20142 Nov 20142 Nov 2016
299maggiemcflys.comGoDaddy.com, LLC20 Dec 200315 Sep 202230 Jan 2026
300maggieoverbystudios.comFastDomain Inc.13 Aug 201327 Nov 202413 Aug 2026
301maggievalleyclub.comNetwork Solutions, LLC6 Apr 20055 Feb 20256 Apr 2026
302maggiepierce.usGoDaddy.com, LLC9 Jun 20114 Jun 20138 Jun 2015
303maggiepierce.coGoDaddy.com, LLC9 Jun 201114 Jun 20158 Jun 2015
304maggiepierce.netGoDaddy.com, LLC9 Jun 201110 Jun 20159 Jun 2016
305maggiepierce.bizGoDaddy.com, LLC9 Jun 20114 Jun 20138 Jun 2015
306maggiesheldon.comTucows Domains Inc.6 Mar 201626 Apr 20256 Mar 2026
307maggiesgarden.comGoDaddy.com, LLC9 Dec 19984 Dec 20248 Dec 2026
308maggienellscreations.comFastDomain Inc.18 Oct 201219 Oct 201418 Oct 2015
309maggievalley.orgAdvanced Internet Technologies, Inc. (AIT)12 Jan 199927 Dec 202412 Jan 2026
310maggiehassan.comeasyDNS Technologies, Inc.17 Nov 200420 Aug 202517 Nov 2027
311maggiepierce.infoGoDaddy.com, LLC9 Jun 20119 Jun 20159 Jun 2016
312maggiemeader.comWild West Domains, LLC6 Jun 20127 Jun 20156 Jun 2016
313maggiecalder.comGoDaddy.com, LLC1 Dec 20152 Dec 20231 Dec 2025
314maggievalleylive.comNameCheap, Inc.12 Dec 201712 Dec 201712 Dec 2018
315maggiemoos.comNetwork Solutions, LLC30 Aug 199730 Jun 202529 Aug 2026
316maggiewang.comDreamHost, LLC24 Jul 200023 Jun 202525 Jul 2026
317maggies-relax-and-enjoy.comGoDaddy.com, LLC10 Jun 201311 Jun 201510 Jun 2016
318maggiehodorowicz.comNetwork Solutions, LLC17 Apr 201918 Mar 202517 Apr 2028
319maggievalleync.comDomain.com, LLC3 Aug 20039 Jul 20253 Aug 2028
320maggieoldham.comTucows Domains Inc.1 May 201316 Apr 20251 May 2026
321maggiepetersondesign.comGoDaddy.com, LLC12 Jun 200912 Jun 201512 Jun 2016
322maggiecordova.comFastDomain Inc.15 Jul 201230 Jun 202515 Jul 2026
323maggiedutton.comregister.com, Inc.15 Jan 200916 Jan 202515 Jan 2026
324maggieswestminster.comFabulous.com Pty Ltd.25 Jul 200119 Jun 202525 Jul 2026
325maggiesfarmmarijuana.comGoDaddy.com, LLC1 Mar 201316 Feb 20241 Mar 2027
326maggiecp.co.uk-27 Apr 200428 Mar 202527 Apr 2026
327maggievalleyswapmeet.comGoDaddy.com, LLC15 Jul 201116 Jul 202415 Jul 2026
328maggievalleyweddings.com1&1 Internet AG13 Jun 20056 Mar 202313 Jun 2026
329maggieharristeam.comGoDaddy.com, LLC13 Oct 201014 Oct 202413 Oct 2026
330maggiestuckey.comeNom, Inc.2 Dec 201126 Nov 20222 Dec 2027
331maggieplaystheharp.comGoDaddy.com, LLC19 Dec 200720 Dec 202419 Dec 2025
332maggiebyersprinzeles.comNetwork Solutions, LLC8 May 200213 May 20258 May 2028
333maggiesfarmmd.comWild West Domains, LLC2 Nov 20122 Nov 20242 Nov 2025
334maggiefaltin.comPSI-USA, Inc. dba Domain Robot14 Oct 20144 Dec 202414 Oct 2025
335maggiechandesign.comGoDaddy.com, LLC4 Nov 20144 Nov 20244 Nov 2025
336maggieanderson.netFastDomain Inc.2 Sep 200518 Aug 20242 Sep 2025
337maggieayres.co.uk-31 Aug 20061 Aug 201731 Aug 2018
338maggiekb.comGoDaddy.com, LLC24 May 200626 May 202524 May 2026
339maggievalley.comeNom, Inc.30 Mar 199630 Mar 202531 Mar 2026
340maggieandrachelblog.comTucows Domains Inc.4 Mar 20148 Mar 20174 Mar 2017
341maggiespeaks.comNameCheap, Inc.18 Feb 199919 Jan 202518 Feb 2028
342maggiescafega.comNetwork Solutions, LLC18 Jan 20139 Jun 202418 Jan 2026
343maggiesthrift.orgGoDaddy.com, LLC17 Aug 201125 Jun 202417 Aug 2028
344maggiemeetsamerica.comFastDomain Inc.28 Sep 201428 Sep 201728 Sep 2018
345maggiesalter.comTucows Domains Inc.26 Sep 201130 Sep 202426 Sep 2026
346maggiescrochetblog.comGoDaddy.com, LLC23 Aug 201315 Sep 202220 Mar 2026
347maggieundressed.comPSI-USA, Inc. dba Domain Robot3 Apr 20215 Apr 20213 Apr 2022
348maggiepriceart.comDomainLadder LLC4 Aug 20254 Aug 20254 Aug 2026
349maggiepaynich.mobiGoDaddy.com, LLC4 Nov 20144 Nov 20144 Nov 2015
350maggiesfarmrum.comTucows Domains Inc.22 Jan 201313 Jan 202522 Jan 2026
351maggiemarx.comDynadot, LLC19 Apr 202120 Apr 202419 Apr 2025
352maggieandhenry.comGoDaddy.com, LLC19 Jun 20087 Jun 202526 Mar 2025
353maggievalleycabinsandvillas.comDynadot, LLC5 Jul 20195 Jul 20195 Jul 2020
354maggievalleyfestivalgrounds.orgAdvanced Internet Technologies, Inc. (AIT)30 Mar 200710 Jan 201630 Mar 2022
355maggiecabins.comBrandon Gray Internet Services, Inc. (dba NameJuic…21 Apr 20009 Apr 202421 Apr 2026
356maggiewayrvparkatspearheadtrails.comGoDaddy.com, LLC4 Nov 20144 Nov 20144 Nov 2016
357maggiestores.comSquarespace Domains LLC5 Jul 202420 Jun 20255 Jul 2026
358maggiesmilk.comGoDaddy.com, LLC4 Nov 20145 Nov 20244 Nov 2025
359maggiesfurryfriends.comGoDaddy.com, LLC4 Nov 20145 Nov 20164 Nov 2017
360maggiegallagher.comGoDaddy.com, LLC10 Oct 20194 Oct 202410 Oct 2025
361maggiecottage.comTucows Domains Inc.12 Feb 20086 Jan 201512 Feb 2016
362maggieandsallywedding.comWild West Domains, LLC17 Aug 201422 Aug 201617 Aug 2017
363maggiegillespiedesign.comGoDaddy.com, LLC17 Aug 201417 Aug 201417 Aug 2017
364maggiegillespieplans.comGoDaddy.com, LLC17 Aug 201417 Aug 201417 Aug 2017
365maggiesdaughterbakes.comregister.com, Inc.17 Aug 201417 Aug 201417 Aug 2015
366maggiezhou-usa.netFastDomain Inc.17 Aug 201417 Aug 201617 Aug 2017
367maggie13zstyle.comGoDaddy.com, LLC13 Jun 201414 Jun 201513 Jun 2016
368maggiethemag.comGoDaddy.com, LLC14 Jun 201414 Jun 201514 Jun 2016
369maggiemcflysreviews.comGoDaddy.com, LLC14 Jun 201315 Jun 201514 Jun 2016
370maggiestievater.comGoDaddy.com, LLC16 Jun 201416 Jun 201516 Jun 2016
371maggiephilbin.org----
372maggiewendelphotography.netGoDaddy.com, LLC16 Jun 201016 Jun 201516 Jun 2016
373maggiestokyoshop.comKey-Systems GmbH6 Nov 201427 Nov 20146 Nov 2015
374maggiemayswim.comNetwork Solutions, LLC18 May 201622 May 201818 May 2021
375maggiedunbar.comSquarespace Domains LLC8 Jul 20258 Jul 20258 Jul 2026
376maggie-mitchell.comWild West Domains, LLC5 Nov 20145 Nov 20145 Nov 2015
377maggiebochat.comWild West Domains, LLC18 Aug 201412 Sep 201618 Aug 2018
378maggiecarrie.comGoDaddy.com, LLC18 Aug 201411 Jun 202518 Aug 2025
379maggiee.comSquarespace Domains LLC3 Jul 202414 Aug 20253 Jul 2025
380maggievalleycabin.comGoDaddy.com, LLC23 Sep 202423 Sep 202423 Sep 2027
381maggieconnollyhm.comeNom, Inc.26 Nov 201825 Nov 201826 Nov 2019
382maggiesmillion.comGoDaddy.com, LLC18 Jun 201419 Jun 201518 Jun 2016
383maggie-keenan.comGoDaddy.com, LLC18 Jun 20132 Jul 202518 Jun 2026
384maggievalleylogcabins.infoGoDaddy.com, LLC20 Jun 201220 Jun 201520 Jun 2016
385maggieaharvey.comeNom, Inc.19 Aug 201419 Aug 201419 Aug 2015
386maggieandbrendan.comWild West Domains, LLC19 Aug 201419 Aug 201419 Aug 2015
387maggieleighmedia.comBeijing Lanhai Jiye Technology Co., Ltd17 Dec 202318 Feb 202517 Dec 2024
388maggiescleaningny.comTucows Domains Inc.15 Aug 200919 Aug 201415 Aug 2015
389maggiescottagekitchen.comTucows Domains Inc.19 Aug 201423 Aug 201719 Aug 2017
390maggiestore88.comXin Net Technology Corporation19 Aug 201419 Aug 201419 Aug 2015
391maggiesoutlet.netGoDaddy.com, LLC3 Nov 20144 Nov 20243 Nov 2026
392maggie-sletten.useNom, Inc.4 Nov 20144 Nov 20143 Nov 2015
393maggiesdoodles.comRally Cry Domains, LLC21 Dec 202224 Dec 202321 Dec 2024
394maggievalleyindianmotorcyclerally.comGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
395maggievalleyrallysindianmotorcyclerally.comGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
396maggievalleyvendorsmarket.comTucows Domains Inc.24 Jun 201524 Jun 201524 Jun 2017
397maggieypatrick.comTucows Domains Inc.24 Jun 201528 Jun 201824 Jun 2018
398maggieescalante.comGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
399maggiepmoore.comTucows Domains Inc.20 Aug 201429 Jul 202520 Aug 2026
400maggiesand.infoTucows Domains Inc.3 Dec 20191 Dec 20243 Dec 2026
401maggiesden.comTurnCommerce, Inc. DBA NameBright.com30 May 201210 Aug 202530 May 2025
402maggiesmisadventures.comWild West Domains, LLC20 Aug 201421 Jul 201620 Aug 2017
403maggiespetcare.comGoDaddy.com, LLC29 Mar 201710 May 202529 Mar 2025
404maggiesundae.comeNom, Inc.20 Aug 201415 Aug 201720 Aug 2018
405maggievalleycardinalinn.comGoDaddy.com, LLC20 Aug 201421 Aug 202520 Aug 2026
406maggiezotti.comGoDaddy.com, LLC20 Aug 201421 Aug 202520 Aug 2026
407maggiearchibald.comLaunchpad, Inc.13 Jan 20155 Jan 202513 Jan 2026
408maggiecorwin.comFastDomain Inc.12 Jan 201512 Jan 201712 Jan 2018
409maggiesalvatierra.com1&1 Internet AG12 Jan 201512 Jan 201512 Jan 2016
410maggievalleymoonlightrun.comBlue Razor Domains, LLC1 Apr 20171 Apr 20171 Apr 2018
411maggievanscoyk.comGMO Internet Inc.6 Nov 20147 Nov 20146 Nov 2015
412maggieswreaths.comName.com, Inc.6 Nov 20146 Nov 20146 Nov 2016
413maggiestergosbush.comGoDaddy.com, LLC7 Nov 20147 Nov 20147 Nov 2015
414maggiemaymeow.comDreamHost, LLC6 Nov 20146 Nov 20146 Nov 2015
415maggielinders.comGoDaddy.com, LLC6 Nov 20147 Nov 20166 Nov 2017
416maggieknoedelseder.comGoDaddy.com, LLC7 Nov 20147 Nov 20147 Nov 2015
417maggiedowns.comGoogle, Inc.7 Aug 201824 Jul 20257 Aug 2026
418maggie-louie.useNom, Inc.21 Aug 201421 Aug 201420 Aug 2015
419maggieandsusan.comGoDaddy.com, LLC21 Aug 201422 Aug 201621 Aug 2018
420maggiecolvett.comLaunchpad, Inc.8 Aug 20188 Aug 20188 Aug 2019
421maggiehassan2016.comGoDaddy.com, LLC21 Aug 201421 Aug 201421 Aug 2015
422maggiehassan2016.infoGoDaddy.com, LLC22 Aug 201422 Aug 201422 Aug 2015
423maggiehassan2016.netGoDaddy.com, LLC21 Aug 201421 Aug 201421 Aug 2015
424maggiehassan2016.orgGoDaddy.com, LLC22 Aug 201422 Aug 201422 Aug 2015
425maggie-serum.comHiChina Zhicheng Technology Limited6 Feb 20156 Feb 20156 Feb 2016
426maggieandpattravel.comWild West Domains, LLC6 Feb 20157 Jan 20256 Feb 2026
427maggieboltassociates.comeNom, Inc.22 Apr 201524 Mar 201722 Apr 2018
428maggiemaeneworleans.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2017
429maggieslistings.comNetwork Solutions, LLC6 Feb 20155 Mar 20176 Feb 2018
430maggiethemastiff.comGoDaddy.com, LLC10 Apr 202510 Apr 202510 Apr 2028
431maggiebisesi.comGoDaddy.com, LLC1 Mar 20151 Mar 20151 Mar 2016
432maggiedolechek.comNetwork Solutions, LLC28 Feb 201528 Feb 201528 Feb 2016
433maggiehanleyyoga.comNetwork Solutions, LLC1 Mar 201530 Sep 20151 Mar 2018
434maggielowery.comTucows Domains Inc.28 Feb 201514 Feb 202528 Feb 2026
435maggiesartsandgarden.comGoDaddy.com, LLC28 Feb 201528 Feb 201528 Feb 2016
436maggieshousecleaningservices.comGoogle, Inc.27 Apr 202012 Apr 202527 Apr 2026
437maggieandnitwitsroadhouse.comregister.com, Inc.22 Aug 201422 Aug 201422 Aug 2015
438maggiemegahairextensions.comEveryones Internet, Ltd. dba SoftLayer7 Aug 201322 Aug 20147 Aug 2015
439maggiescleaningsantacruzcounty.comNetwork Solutions, LLC22 Aug 201422 Aug 201422 Aug 2015
440maggietantraporn.comLaunchpad, Inc.7 Nov 20147 Nov 20147 Nov 2015
441maggienemser.comGoDaddy.com, LLC7 Nov 20147 Nov 20147 Nov 2016
442maggiecocco.comGoDaddy.com, LLC7 Feb 20177 Feb 20257 Feb 2027
443maggieshots.comGoDaddy.com, LLC23 Aug 201424 Aug 201623 Aug 2018
444maggiesofprosper.comTucows Domains Inc.20 Aug 201324 Aug 201420 Aug 2015
445maggievincentdesigns.netWild West Domains, LLC6 Nov 20146 Nov 20146 Nov 2015
446maggielawartist.comTucows Domains Inc.12 Aug 201416 Aug 201812 Aug 2018
447maggietaylorkw.comGoDaddy.com, LLC12 Aug 201412 Aug 201412 Aug 2015
448maggiecreative.com-3 May 20241 May 20253 May 2026
449maggiemaefish.comGoDaddy.com, LLC24 Aug 201425 Aug 202524 Aug 2026
450maggiemustmove.comGoDaddy.com, LLC24 Aug 201425 Aug 202524 Aug 2026
451maggiemuth.comGoDaddy.com, LLC24 Aug 201425 Aug 201624 Aug 2018
452maggieschoonmaker.comGoDaddy.com, LLC24 Aug 201421 Aug 201624 Aug 2017
453maggiewheelermusic.comDreamHost, LLC9 Nov 20148 Nov 20149 Nov 2017
454maggiestaffins.comTucows Domains Inc.5 Nov 20139 Nov 20145 Nov 2015
455maggiesinteriors.comGoDaddy.com, LLC8 Nov 20149 Nov 20248 Nov 2025
456maggiemars.comDomaininfo AB, aka domaininfo.com8 Nov 20143 Nov 20178 Nov 2018
457maggiebreen.com-27 Mar 202328 Apr 202427 Mar 2024
458maggiehoran.infoNetwork Solutions, LLC7 Nov 20147 Nov 20147 Nov 2015
459maggie-tyus.useNom, Inc.13 Aug 201413 Aug 201412 Aug 2015
460maggieandjo.orgGMO Internet Inc.12 Aug 20148 Jul 201612 Aug 2017
461maggiebent.comWild West Domains, LLC5 Aug 20226 Aug 20255 Aug 2026
462maggiemcgeescloset.comHongkong Domain Name Information Management Co., L…1 Nov 202210 Jan 20241 Nov 2023
463maggieparrishphotography.comGoDaddy.com, LLC11 Nov 202112 Nov 202411 Nov 2025
464maggieandkevin.comeNom, Inc.15 Nov 202415 Nov 202415 Nov 2025
465maggieandnitwitstrinkets.comregister.com, Inc.25 Aug 201425 Aug 201425 Aug 2015
466maggiebrucker.comGoDaddy.com, LLC18 Dec 202028 Feb 202418 Dec 2023
467maggiebrucker.infoGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
468maggiebrucker.netGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
469maggiebrucker.orgGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
470maggieburnsdesigns.comregister.com, Inc.25 Aug 201410 Aug 201625 Aug 2018
471maggiehorgan.comGoDaddy.com, LLC26 Aug 201427 Aug 202326 Aug 2026
472maggiekathryn.comGoogle, Inc.8 Jan 20218 Jan 20218 Jan 2022
473maggiepena.comGMO Internet Inc.25 Aug 201425 Aug 201425 Aug 2015
474maggiestrip.comTucows Domains Inc.27 Aug 201431 Aug 202527 Aug 2026
475maggiethemovie.com1&1 Internet AG26 Aug 201427 Aug 201426 Aug 2015
476maggievpr.comFastDomain Inc.26 Aug 201426 Aug 201426 Aug 2015
477maggiewestfieldsellshomes.comTucows Domains Inc.22 Aug 201326 Aug 201422 Aug 2015
478maggiepthompson.comGoDaddy.com, LLC9 Nov 20149 Nov 20149 Nov 2015
479maggieeats.comNeubox Internet S.A. de C.V.24 Aug 202424 Aug 202524 Aug 2025
480maggiebeatrice.comSynergy Wholesale Pty Ltd2 Nov 20119 Nov 20142 Nov 2015
481maggieandwilliam.comNameCheap, Inc.9 Nov 20145 Aug 20259 Nov 2027
482maggieandmike2015.comGoDaddy.com, LLC10 Nov 201410 Nov 201410 Nov 2015
483maggieandbrandonwedding.comregister.com, Inc.9 Nov 20149 Nov 20149 Nov 2015
484maggie-lawson.comDynadot, LLC9 Nov 20149 Nov 20149 Nov 2015
485maggiebouchard.comTucows Domains Inc.15 Aug 201414 Aug 202515 Aug 2026
486maggielaneco.comGoDaddy.com, LLC14 Aug 201414 Aug 201414 Aug 2015
487maggielanecompany.comGoDaddy.com, LLC22 Mar 202123 Mar 202522 Mar 2026
488maggielaneinc.comGoDaddy.com, LLC14 Aug 201414 Aug 201414 Aug 2015
489maggiesayswhat.comTucows Domains Inc.14 Aug 201418 Aug 201914 Aug 2019
490maggiesellsaustin.comGoDaddy.com, LLC29 Mar 201729 Mar 201729 Mar 2018
491maggiepthompson.netGoDaddy.com, LLC9 Nov 20149 Nov 20149 Nov 2015
492maggiemagazine.netGoDaddy.com, LLC10 Nov 201410 Nov 201410 Nov 2015
493maggieandjeremywedding.comGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
494maggiefaire.comeNom, Inc.1 Mar 201031 Jan 20251 Mar 2026
495maggielaggie.comTucows Domains Inc.24 Aug 201227 Aug 201424 Aug 2015
496maggieshandbag.comTucows Domains Inc.24 Aug 201327 Aug 201424 Aug 2015
497maggieshandbags.comTucows Domains Inc.24 Aug 201327 Aug 201424 Aug 2015
498maggieslistmobile.comGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
499maggiesworldofwheelsllc.comGMO Internet Inc.16 Nov 201817 Oct 202416 Nov 2025
500maggielaggie.netTucows Domains Inc.24 Aug 201227 Aug 201424 Aug 2015
501maggiex.comAutomattic Inc.31 Dec 202011 Dec 202431 Dec 2025
502maggiesspaniels.comGoDaddy.com, LLC22 Nov 20163 Feb 202422 Nov 2023
503maggiesrspaniels.comGoDaddy.com, LLC10 Nov 201410 Nov 201410 Nov 2015
504maggiesmakeover.comeNom, Inc.10 Nov 201410 Nov 201410 Nov 2015
505maggiealiotta.comGoDaddy.com, LLC11 Nov 201411 Nov 201411 Nov 2015
506maggie-cedarstrom.comTucows Domains Inc.11 Nov 201411 Nov 201411 Nov 2015
507maggieandbud.comGoDaddy.com, LLC29 Aug 201429 Aug 202429 Aug 2025
508maggiedowd.comGoDaddy.com, LLC28 Aug 201429 Aug 201628 Aug 2018
509maggiefitness.comNetwork Solutions, LLC6 May 20206 May 20206 May 2021
510maggiejillphotography.comGoDaddy.com, LLC28 Aug 201429 Aug 202428 Aug 2026
511maggiemcintyre.comGoDaddy.com, LLC24 Mar 20221 Apr 202524 Mar 2026
512maggiemondanile.com-27 Oct 201627 Oct 201627 Oct 2018
513maggiemontgomeryphotography.comregister.com, Inc.29 Aug 201421 Apr 201629 Aug 2018
514maggienoriega.comGoDaddy.com, LLC28 Aug 201429 Aug 201628 Aug 2017
515maggieseuropeanskincare.netTucows Domains Inc.25 Aug 200929 Aug 201425 Aug 2015
516maggie-kenny.com-16 Aug 201416 Aug 201416 Aug 2017
517maggiesfarmarijuana.comHebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.…16 Aug 201416 Aug 201416 Aug 2015
518maggiesmonastery.comDreamHost, LLC16 Aug 201416 Jul 202516 Aug 2026
519maggiesoblessed.comWild West Domains, LLC16 Aug 201416 Aug 201416 Aug 2015
520maggiesbeautyisland.comMarcaria.com International, Inc.11 Nov 201411 Nov 201411 Nov 2015
521maggiereetz.comPorkbun, LLC11 Nov 201428 Jan 202411 Nov 2025
522maggieoharaphd.comWild West Domains, LLC11 Nov 201411 Nov 201411 Nov 2015
523maggiemalloy.comNameCheap, Inc.7 Aug 202318 Sep 20247 Aug 2024
524maggiebees.comBeijing Lanhai Jiye Technology Co., Ltd29 Jan 201822 Jul 202529 Jan 2026
525maggiebarber.comNetEarth One Inc. d/b/a NetEarth16 Nov 200811 Nov 202416 Nov 2025
526maggie-eye.comXin Net Technology Corporation12 Nov 201412 Nov 201412 Nov 2015
527maggiehu.netHiChina Zhicheng Technology Limited11 Nov 201420 Dec 201411 Nov 2017
528maggieatthefixx.comGoDaddy.com, LLC11 Sep 201411 Sep 201411 Sep 2015
529maggiebarron.comAtak Domain Hosting Internet d/b/a Atak Teknoloji27 Nov 202127 Nov 202127 Nov 2022
530maggiekellyfineart.comNetwork Solutions, LLC11 Sep 201427 Sep 201611 Sep 2017
531maggieogrady.comCrazy Domains FZ-LLC24 Aug 201221 Aug 202424 Aug 2027
532maggieshieldsofficiant.comDomain.com, LLC11 Sep 201427 Aug 202411 Sep 2025
533maggiessite2.comTucows Domains Inc.8 Sep 201112 Sep 20148 Sep 2015
534maggiewaring.netPDR Ltd. d/b/a PublicDomainRegistry.com11 Sep 201411 Sep 201411 Sep 2015
535maggieswayzata.comTucows Domains Inc.15 Aug 201917 Jul 202515 Aug 2026
536maggieoconnorviolin.comregister.com, Inc.13 Nov 201414 Nov 202413 Nov 2025
537maggiemuffler.comDomain.com, LLC24 Feb 20104 Feb 202524 Feb 2026
538maggiemik.comWild West Domains, LLC13 Nov 201414 Oct 201613 Nov 2017
539maggiemedala.comDomain.com, LLC13 Nov 201429 Oct 201613 Nov 2017
540maggiemarker.comGoDaddy.com, LLC13 Nov 201417 Sep 202229 Dec 2025
541maggiefullerceramics.comregister.com, Inc.13 Nov 201411 Aug 202513 Nov 2027
542maggiebcummings.com-19 Sep 202420 Sep 202519 Sep 2026
543maggie-marker.comGoDaddy.com, LLC13 Nov 201417 Sep 202229 Dec 2025
544maggie-main.comTucows Domains Inc.29 Aug 20142 Sep 202029 Aug 2020
545maggie4sales.comGoDaddy.com, LLC29 Aug 201429 Aug 201429 Aug 2015
546maggiebqj.netDomain.com, LLC29 Aug 201429 Aug 201429 Aug 2015
547maggiehubbard.netDreamHost, LLC29 Aug 201425 Jul 202529 Aug 2026
548maggiestoronto.orgTucows Domains Inc.3 Aug 20249 May 20253 Aug 2028
549maggiecromer.comWild West Domains, LLC12 Sep 201412 Sep 201412 Sep 2015
550maggiehousecleaner.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Sep 201431 Aug 201712 Sep 2018
551maggiejohnston.com1&1 Internet AG26 Jul 202126 Jul 202126 Jul 2026
552maggieelliott.infoGoDaddy.com, LLC12 Sep 201412 Sep 201412 Sep 2015
553maggie-dias-properties.comTucows Domains Inc.27 Aug 201231 Aug 201427 Aug 2015
554maggiecow1216.comLaunchpad, Inc.13 Sep 201413 Sep 201413 Sep 2015
555maggiejayjewellery.comregister.com, Inc.13 Sep 201413 Sep 201413 Sep 2015
556maggiesmanicures.comGoDaddy.com, LLC13 Sep 201413 Sep 201413 Sep 2015
557maggiessportsgrill.comGoDaddy.com, LLC13 Sep 201425 Sep 201813 Sep 2019
558maggiesweldshop.comTucows Domains Inc.10 Sep 201013 Sep 201410 Sep 2015
559maggieandandrew2015.comNameCheap, Inc.31 Aug 20141 Aug 202431 Aug 2025
560maggieandjackaregettingmarried.comGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
561maggieandjamie.comTucows Domains Inc.30 May 201930 May 201930 May 2020
562maggieband.comGoogle, Inc.23 Apr 202023 Apr 202023 Apr 2021
563maggiemaesjewels.comGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
564maggiemaomao.comGoDaddy.com, LLC1 Sep 20142 Sep 20161 Sep 2017
565maggie-pinkerton.useNom, Inc.13 Sep 201413 Sep 201412 Sep 2015
566maggiejeanne.comGoDaddy.com, LLC14 Nov 201414 Nov 201414 Nov 2019
567maggiecusworth.comWebfusion Ltd.14 Nov 20146 Nov 202414 Nov 2025
568maggiebellcounsellingandhypnotherapy.comTucows Domains Inc.11 Sep 201315 Sep 201411 Sep 2015
569maggieinthesky.comTucows Domains Inc.15 Sep 201419 Sep 202315 Sep 2024
570maggieshairspa.comGoDaddy.com, LLC15 Sep 201415 Sep 201415 Sep 2016
571maggiesjewelryboutique.comGoDaddy.com, LLC14 Sep 201414 Sep 201414 Sep 2015
572maggiecrumblefoot.comNetwork Solutions, LLC1 Sep 20141 Sep 20141 Sep 2015
573maggiehoran.netDomain.com, LLC1 Sep 20141 Sep 20141 Sep 2015
574maggielola.comGoDaddy.com, LLC1 Sep 20141 Sep 20141 Sep 2015
575maggiemorrissey.comBlacknight Internet Solutions Ltd.1 Sep 201427 Aug 20241 Sep 2026
576maggiesblog.comAutomattic Inc.9 Oct 20249 Oct 20249 Oct 2025
577maggietagarelli.comGoDaddy.com, LLC1 Sep 20141 Sep 20141 Sep 2015
578maggiemorales.comGoDaddy.com, LLC1 Feb 201929 Jan 20251 Feb 2026
579maggierealestatepro.comGoDaddy.com, LLC16 Sep 201417 Sep 201616 Sep 2018
580maggiemillersainsbury.comDropCatch.com 410 LLC16 Sep 201417 Sep 201716 Sep 2018
581maggiejmarcum.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Sep 20144 Aug 20172 Sep 2018
582maggiemacpherson.comGoDaddy.com, LLC2 Sep 20142 Sep 20142 Sep 2017
583maggieplayspiano.comFastDomain Inc.19 Jan 201624 Feb 202119 Jan 2022
584maggiesphotos4u.comTucows Domains Inc.2 Sep 20146 Sep 20152 Sep 2016
585maggieyescombe.comTucows Domains Inc.2 Sep 20143 Aug 20252 Sep 2026
586maggiefurey.comGMO Internet Inc.21 Feb 201621 Feb 201621 Feb 2017
587maggieowensdesign.comGoDaddy.com, LLC15 Sep 201415 Sep 201415 Sep 2016
588maggiesbarandgrill.comGoDaddy.com, LLC1 Mar 201826 Feb 20251 Mar 2026
589maggieschermerhorn.comGoDaddy.com, LLC15 Sep 201415 Sep 201415 Sep 2016
590maggiearandelaromano.comWild West Domains, LLC15 Nov 201415 Nov 201415 Nov 2015
591maggiespoint.comNameCheap, Inc.16 Sep 201417 Aug 202416 Sep 2025
592maggiemaude.comDomain.com, LLC3 Sep 20143 Sep 20143 Sep 2015
593maggiemmccullough.comWild West Domains, LLC3 Sep 20143 Aug 20243 Sep 2025
594maggieneeceou.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Sep 201410 Oct 20174 Sep 2018
595maggiestudholme.comTucows Domains Inc.3 Sep 201423 Apr 20253 Sep 2025
596maggietyler.netFastDomain Inc.3 Sep 20143 Sep 20143 Sep 2015
597maggiepurwin.comAcens Technologies, S.L.U.17 Sep 201417 Sep 201417 Sep 2015
598maggiesmindfulspace.comGoDaddy.com, LLC18 Sep 201419 Jul 202518 Jul 2026
599maggiesway.orgGoDaddy.com, LLC16 Aug 201716 Oct 201716 Aug 2019
600maggierun.orgGoDaddy.com, LLC14 Nov 201414 Nov 201414 Nov 2015
601maggiejulcher.comFastDomain Inc.17 Sep 201417 Sep 201417 Sep 2015
602maggiemaeferri.comGoDaddy.com, LLC18 Sep 201418 Sep 202418 Sep 2026
603maggiejane.comAzdomainz LLC16 Nov 20141 Jan 202516 Nov 2025
604maggiebortzportlandtherapy.comNetEarth One Inc. d/b/a NetEarth4 Sep 20145 Jul 20224 Sep 2026
605maggieinla.comWild West Domains, LLC5 Sep 201430 Sep 20165 Sep 2018
606maggielangleylaw.comNetwork Solutions, LLC4 Sep 20145 Oct 20164 Sep 2018
607maggielathamart.comGoDaddy.com, LLC1 Mar 202127 Oct 20221 Mar 2026
608maggielovesrealestate.comTucows Domains Inc.1 Sep 20114 Sep 20141 Sep 2015
609maggiemae.bizTucows Domains Inc.4 Sep 201425 Aug 20243 Sep 2025
610maggiemullerstyling.comGoDaddy.com, LLC4 Sep 20144 Sep 20144 Sep 2015
611maggiesconfidential.comNetwork Solutions, LLC4 Sep 20144 Sep 20144 Sep 2015
612maggiepatton.comAutomattic Inc.14 Mar 202314 Mar 202314 Mar 2024
613maggiestthomas.comGoDaddy.com, LLC18 Sep 201418 Sep 201418 Sep 2015
614maggiekingphotography.comTucows Domains Inc.26 Jan 202025 Jan 202526 Jan 2026
615maggiethegeek.usWild West Domains, LLC15 Nov 201421 Nov 201714 Nov 2018
616maggieconnor.org1&1 Internet AG18 Sep 2014-18 Sep 2015
617maggiectt.comHiChina Zhicheng Technology Limited28 Nov 201828 Nov 201828 Nov 2019
618maggiehelm.comGoDaddy.com, LLC5 Sep 201427 Jan 201726 Jan 2019
619maggiemarks.comGoDaddy.com, LLC5 Sep 20146 Sep 20245 Sep 2026
620maggieraffycaninecamp.comTucows Domains Inc.2 Sep 20135 Sep 20142 Sep 2015
621maggiestamping.com-21 Sep 202421 May 202521 Sep 2025
622maggieteach.comNetwork Solutions, LLC5 Sep 20145 Sep 20145 Sep 2015
623maggieandjb.comSquarespace Domains LLC12 Sep 202512 Sep 202512 Sep 2026
624maggiesmachtigemutsen.comTucows Domains Inc.17 Nov 201421 Nov 202117 Nov 2021
625maggieandbrad.comWild West Domains, LLC23 May 202123 May 202523 May 2027
626maggie5978.comWeb Commerce Communications Limited dba WebNic.cc18 Nov 201418 Nov 201418 Nov 2015
627maggiedeeblues.comDomain.com, LLC14 Sep 201724 Jun 202514 Sep 2025
628maggiekan.infoGoDaddy.com, LLC7 Sep 20147 Sep 20147 Sep 2015
629maggiemagic.comGoDaddy.com, LLC11 Jul 202322 Aug 202411 Jul 2024
630maggieherskowitz.comGoDaddy.com, LLC20 Sep 201421 Sep 202420 Sep 2026
631maggiebaugh.netGoDaddy.com, LLC20 Sep 201421 Sep 202420 Sep 2025
632maggiekirkland.comGoDaddy.com, LLC21 Sep 201430 Sep 202321 Sep 2033
633maggieslittlemixingbowl.comFastDomain Inc.20 Sep 201420 Sep 201420 Sep 2015
634maggiebaugh.infoGoDaddy.com, LLC20 Sep 20144 Nov 202420 Sep 2025
635maggiedrehermakeup.comTucows Domains Inc.4 Sep 20128 Sep 20144 Sep 2015
636maggiefinnegansoprano.comGoDaddy.com, LLC8 Sep 20148 Sep 20258 Sep 2026
637maggiemcfly.comDropCatch.com 1089 LLC8 Jun 202319 Aug 20248 Jun 2024
638maggiewalshblog.comWild West Domains, LLC7 Sep 20147 Sep 20147 Sep 2015
639maggiefinnegansoprano.infoGoDaddy.com, LLC8 Sep 20149 Sep 20168 Sep 2017
640maggiefinnegan.netGoDaddy.com, LLC7 Sep 20147 Sep 20147 Sep 2015
641maggiefinnegan.orgGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2015
642maggiefinnegansoprano.netGoDaddy.com, LLC7 Sep 20147 Sep 20147 Sep 2015
643maggiefinnegansoprano.orgGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2015
644maggie-marcil.useNom, Inc.8 Sep 20148 Sep 20147 Sep 2015
645maggie-wilde.comGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2015
646maggiebaker4you.comGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2015
647maggieginc.comGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2016
648maggieleyenberger.comFastDomain Inc.9 Sep 20149 Sep 20169 Sep 2017
649maggiellanso.comCosmotown, Inc.29 Sep 202427 Feb 202529 Sep 2025
650maggiespetservices.comFastDomain Inc.20 Sep 202113 Sep 202420 Sep 2025
651maggieon.comGoDaddy.com, LLC18 Nov 201418 Nov 201418 Nov 2016
652maggiegfashions.com1&1 Internet AG18 Nov 201418 Nov 201418 Nov 2015
653maggiedillon.comSquarespace Domains LLC28 May 202528 May 202528 May 2028
654maggiebabes.comGoDaddy.com, LLC30 Sep 201430 Sep 201430 Sep 2015
655maggiemoris.comCNOBIN INFORMATION TECHNOLOGY LIMITED25 Dec 202125 Dec 202125 Dec 2022
656maggiesandandserpentyne.comTucows Domains Inc.28 Sep 20132 Oct 201428 Sep 2015
657maggiebarley.comGoDaddy.com, LLC10 Sep 201410 Sep 201410 Sep 2019
658maggiewrapsyou.comGoDaddy.com, LLC9 Sep 20149 Sep 20149 Sep 2015
659maggieandbrianwedding.comTucows Domains Inc.27 Nov 201928 Nov 201927 Nov 2020
660maggieandtomwedding.comeNom, Inc.4 Oct 20144 Oct 20144 Oct 2015
661maggie1932.comGoDaddy.com, LLC4 Oct 20148 Oct 20164 Oct 2018
662maggiejw.comHiChina Zhicheng Technology Limited3 Oct 20143 Oct 20143 Oct 2015
663maggielivingstone.com-3 Oct 20143 Oct 20143 Oct 2017
664maggieyao.comHiChina Zhicheng Technology Limited6 Apr 201814 May 20246 Apr 2024
665maggieman.comDynadot, LLC7 Feb 202018 Mar 20247 Feb 2024
666maggiecoleman.comNamesilo, LLC22 Apr 202023 Apr 202022 Apr 2021
667maggiehodges.comGoDaddy.com, LLC10 Sep 201411 Sep 202410 Sep 2025
668maggiesays.comNameCheap, Inc.3 Jul 20253 Jul 20253 Jul 2026
669maggiesaysmusic.com1&1 Internet AG10 Sep 201420 Sep 201910 Sep 2020
670maggiethatcherlookalike.comTucows Domains Inc.7 Sep 200818 Nov 20237 Sep 2023
671maggiegomez.comGoDaddy.com, LLC16 Aug 20194 Aug 202516 Aug 2027
672maggiemckenna.comGoDaddy.com, LLC26 Jun 202327 Jun 202526 Jun 2027
673maggiescheesecakes.comGoDaddy.com, LLC12 Jan 201613 Jan 201812 Jan 2020
674maggiegross.comSquarespace Domains LLC31 Jan 202216 Jan 202531 Jan 2026
675maggiethurmon.comGoDaddy.com, LLC19 Nov 201420 Nov 202419 Nov 2029
676maggieshnayerson.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED14 May 201815 May 201814 May 2019
677maggiekelleyromance.comWild West Domains, LLC19 Nov 201419 Oct 202419 Nov 2025
678maggiebhomes.comTucows Domains Inc.20 Nov 201419 Nov 202420 Nov 2025
679maggie100.comGoDaddy.com, LLC3 Oct 20143 Oct 20143 Oct 2017
680maggiekmusic.comNetwork Solutions, LLC3 Oct 201412 Aug 20243 Oct 2028
681maggiemaedezigns.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Oct 20143 Oct 20143 Oct 2015
682maggiemaemedicinals.comGoDaddy.com, LLC5 Oct 20145 Oct 20145 Oct 2015
683maggiefred.comGoDaddy.com, LLC22 Sep 201423 Sep 201722 Sep 2018
684maggiehouse.comTurnCommerce, Inc. DBA NameBright.com22 Sep 201416 Sep 202022 Sep 2025
685maggiemhomes.comGoDaddy.com, LLC5 Oct 20146 Oct 20165 Oct 2017
686maggiedesignsthis.comTucows Domains Inc.24 Apr 202524 Apr 202524 Apr 2026
687maggieanddavid.usNameCheap, Inc.19 Nov 201424 Oct 202418 Nov 2025
688maggies-hair.comRealtime Register B.V.23 Sep 201419 Oct 201723 Sep 2018
689maggie-cakes.comDomain.com, LLC23 Sep 201423 Sep 201423 Sep 2015
690maggiemaysboutique.comGoDaddy.com, LLC23 Feb 201723 Feb 201723 Feb 2020
691maggieburnettphotographyblog.comFastDomain Inc.6 Oct 201421 Sep 20246 Oct 2025
692maggiechang.comGoDaddy.com, LLC7 Oct 20147 Oct 20247 Oct 2025
693maggiecostella.comWild West Domains, LLC6 Oct 20145 Sep 20246 Oct 2025
694maggiedykshorn.comWild West Domains, LLC7 Oct 20147 Oct 20147 Oct 2015
695maggiegoldhammer.comLiquidNet Ltd.19 Jan 202019 Jan 202019 Jan 2021
696maggiekitchen.comGoDaddy.com, LLC3 Jun 20225 Jun 20253 Jun 2026
697maggielile.comGoDaddy.com, LLC6 Oct 20147 Oct 20246 Oct 2025
698maggiemalson.comGoDaddy.com, LLC6 Oct 20147 Oct 20246 Oct 2026
699maggiepaynich.comGoDaddy.com, LLC7 Oct 20147 Oct 20247 Oct 2025
700maggiescottero.comTucows Domains Inc.2 Oct 20056 Oct 20142 Oct 2015
701maggievalleyrendezvous.comInterweb Advertising D.B.A. Profile Builder6 Oct 20146 Oct 20146 Oct 2015
702maggiedecaro.comGoDaddy.com, LLC24 Sep 201429 Jun 201624 Sep 2017
703maggielsaunders.comWild West Domains, LLC24 Sep 201424 Sep 201424 Sep 2015
704maggierotanz.comGoDaddy.com, LLC25 Sep 201418 Jul 202525 Sep 2025
705maggiestoudemire.comGoDaddy.com, LLC24 Sep 201425 Sep 202424 Sep 2025
706maggieaffolter.com-24 Sep 201424 Sep 201424 Sep 2017
707maggiebuukitchen.comWild West Domains, LLC24 Sep 201424 Aug 201624 Sep 2017
708maggiedylong.comGoDaddy.com, LLC8 Nov 20248 Nov 20248 Nov 2025
709maggieandjameswedding.comWild West Domains, LLC31 Jul 202011 Oct 202331 Jul 2023
710maggieandkale.comWild West Domains, LLC8 Oct 20148 Oct 20248 Oct 2025
711maggieecurrie.comTucows Domains Inc.7 Oct 201411 Oct 20227 Oct 2022
712maggieellingson.comTucows Domains Inc.7 Oct 201411 Oct 20187 Oct 2018
713maggiefic.comCloud Yuqu LLC30 May 202130 May 202130 May 2022
714maggiemark.comTucows Domains Inc.22 Nov 20219 Oct 202422 Nov 2025
715maggiemoy.comChengdu West Dimension Digital Technology Co., Ltd…5 Jun 20218 Jul 20235 Jun 2023
716maggiesfudge.comGoDaddy.com, LLC7 Oct 20147 Oct 20147 Oct 2015
717maggierosephotography.comNameCheap, Inc.7 Aug 202318 Sep 20247 Aug 2024
718maggieoneill.comGoDaddy.com, LLC21 Nov 201423 Oct 202421 Nov 2029
719maggiekavanaugh.comGoDaddy.com, LLC13 Feb 202314 Feb 202513 Feb 2027
720maggieellismakeup.comNetwork Solutions, LLC21 Nov 20143 Jan 202521 Nov 2024
721maggieandpearl.comregister.com, Inc.21 Nov 201421 Nov 201421 Nov 2015
722maggie-cn.com-10 Aug 202415 Aug 202510 Aug 2025
723maggiemulherindesigns.com-29 Sep 201429 Sep 201429 Sep 2017
724maggieomiranda.comGoDaddy.com, LLC28 Sep 20148 Oct 201628 Sep 2017
725maggiebuczak.comTucows Domains Inc.8 Oct 201412 Oct 20158 Oct 2016
726maggiemuff.comDropCatch.com 355 LLC22 Dec 201423 Dec 201622 Dec 2017
727maggiesprims.comTucows Domains Inc.8 Oct 201412 Oct 20158 Oct 2016
728maggiemulherin.com-29 Sep 201429 Sep 201429 Sep 2017
729maggiefrenchmassage.comGoDaddy.com, LLC28 Sep 201429 Sep 202328 Sep 2025
730maggiethegreek.comWild West Domains, LLC22 Nov 201422 Nov 201422 Nov 2015
731maggiestar.comKey-Systems GmbH16 Aug 202016 Aug 202016 Aug 2021
732maggieandtrent.comWild West Domains, LLC10 Oct 20219 Jun 202510 Oct 2025
733maggielgendy.comGoDaddy.com, LLC30 Jan 201630 Jan 201630 Jan 2017
734maggieandalex.comTurnCommerce, Inc. DBA NameBright.com10 Oct 20144 Oct 202210 Oct 2025
735maggiemayfoundation.comGoDaddy.com, LLC10 Oct 201412 Sep 202410 Oct 2025
736maggiemayfoundation.infoGoDaddy.com, LLC10 Oct 201417 Sep 202410 Oct 2025
737maggiemayfoundation.netGoDaddy.com, LLC10 Oct 201412 Sep 202410 Oct 2025
738maggiemayfoundation.orgGoDaddy.com, LLC10 Oct 201417 Sep 202410 Oct 2025
739maggiemayfoundation.usGoDaddy.com, LLC10 Oct 201410 Oct 20169 Oct 2018
740maggiecaspar.comGoogle, Inc.16 Oct 20141 Oct 202416 Oct 2025
741maggiedoulaservice.comTucows Domains Inc.18 Oct 201422 Oct 201518 Oct 2016
742maggiejophotography.comGoDaddy.com, LLC16 Oct 201416 Oct 201416 Oct 2016
743maggielennon1.comWild West Domains, LLC16 Oct 201415 Sep 202416 Oct 2025
744maggielynchbooks.comTucows Domains Inc.16 Oct 201424 Apr 202516 Oct 2025
745maggiesellyourhouse.comTucows Domains Inc.20 Nov 201324 Nov 201420 Nov 2015
746maggierust.comGoDaddy.com, LLC21 Mar 20192 May 202521 Mar 2025
747maggieandowen.comTucows Domains Inc.24 Nov 201428 Nov 201624 Nov 2016
748maggieboydceramics.comGoDaddy.com, LLC11 Oct 201412 Oct 202411 Oct 2026
749maggieduke.infoGoDaddy.com, LLC12 Oct 201412 Oct 201412 Oct 2015
750maggieduke.mobiGoDaddy.com, LLC12 Oct 201412 Oct 201412 Oct 2015
751maggieduke.netGoDaddy.com, LLC12 Oct 201412 Oct 201412 Oct 2015
752maggiedukeme.comGoDaddy.com, LLC12 Oct 201412 Oct 201412 Oct 2015
753maggiegiannone.comGoDaddy.com, LLC11 Oct 201412 Oct 202311 Oct 2025
754maggiegriffiths.comGoDaddy.com, LLC15 Jan 202115 Jan 202115 Jan 2022
755maggielalley.comNetwork Solutions, LLC6 Mar 20179 Jun 20246 Mar 2026
756maggiesbooks.orgeNom, Inc.11 Oct 201411 Oct 201411 Oct 2015
757maggiesdrawers.infoDynadot, LLC31 Dec 201831 Dec 201831 Dec 2019
758maggiedaly.netGandi SAS22 Nov 201422 Oct 202422 Nov 2025
759maggieandthevets.com-13 Oct 201413 Oct 201413 Oct 2017
760maggiebphotographer.comFastDomain Inc.12 Oct 201412 Oct 201412 Oct 2015
761maggieduke.bizGoDaddy.com, LLC12 Oct 201412 Oct 201411 Oct 2015
762maggieduke.orgGoDaddy.com, LLC12 Oct 201412 Oct 201412 Oct 2015
763maggieduke.usGoDaddy.com, LLC12 Oct 201412 Oct 201411 Oct 2015
764maggiedukeinc.comGoDaddy.com, LLC12 Oct 201412 Oct 201412 Oct 2015
765maggieharrington.comCloudFlare, Inc.13 Oct 20145 Feb 202113 Oct 2026
766maggiesummey.comWix.com Ltd.28 Sep 202328 Sep 202328 Sep 2026
767maggiereidy.comWild West Domains, LLC26 Sep 201426 Aug 202426 Sep 2025
768maggiefan.comGoogle, Inc.18 Jul 20203 Jul 202518 Jul 2026
769maggieandmoo.comTucows Domains Inc.23 Sep 201227 Sep 201423 Sep 2015
770maggievalleypd.comGMO Internet Inc.25 Nov 201430 Nov 201724 Nov 2018
771maggiesatthepark.comGoDaddy.com, LLC24 Nov 201425 Nov 201624 Nov 2018
772maggieren.comTucows Domains Inc.24 Nov 201428 Nov 201624 Nov 2016
773maggiedavid2015.comGoDaddy.com, LLC24 Nov 201424 Nov 201424 Nov 2015
774maggieclass.comGoDaddy.com, LLC27 Apr 202027 Apr 202027 Apr 2021
775maggiekeys.comTucows Domains Inc.14 Oct 201424 Apr 202514 Oct 2025
776maggiesmaids.netGoDaddy.com, LLC14 Oct 201414 Oct 201414 Oct 2015
777maggieshope.comTurnCommerce, Inc. DBA NameBright.com17 Oct 201426 Nov 202417 Oct 2024
778maggiescafe2014.comLaunchpad, Inc.17 Oct 20142 Oct 202417 Oct 2025
779maggiegarbino.comDynadot, LLC18 Oct 201428 Sep 201718 Oct 2018
780maggie-k-vocals.comGandi SAS17 Oct 201417 Oct 201417 Oct 2015
781maggieandrewsstudio.comNetwork Solutions, LLC14 Oct 201414 Oct 201414 Oct 2016
782maggieflomerfelt.infoGoDaddy.com, LLC14 Oct 201414 Oct 201414 Oct 2015
783maggieliu.comTurnCommerce, Inc. DBA NameBright.com22 Mar 20204 Mar 202422 Mar 2026
784maggiesholes.comFastDomain Inc.14 Oct 201413 Oct 201714 Oct 2018
785maggietibbettslcsw.comNamesilo, LLC14 Oct 201415 Oct 202414 Oct 2025
786maggiesorretto.comComfyDomains LLC15 Dec 201316 Dec 201715 Dec 2018
787maggielikesjuiceplus.comGMO Internet Inc.18 Oct 201418 Oct 201418 Oct 2015
788maggietangvintage.comHiChina Zhicheng Technology Limited20 Oct 201421 Oct 201820 Oct 2018
789maggiesmith-betelgeuseart.comDreamHost, LLC19 Oct 201419 Oct 201419 Oct 2015
790maggiejewellplunk.comDreamHost, LLC19 Oct 201418 Sep 202419 Oct 2025
791maggiebashford.comGoDaddy.com, LLC19 Oct 201431 Dec 202419 Oct 2024
792maggieandharold.comFastDomain Inc.19 Oct 201414 Oct 201719 Oct 2018
793maggiemoondesigns.comeNom, Inc.15 Oct 201414 Mar 201715 Oct 2017
794maggieschermerhornart.comTucows Domains Inc.15 Oct 201425 Nov 202415 Oct 2025
795maggietherapist.comGoDaddy.com, LLC26 Nov 201427 Nov 201626 Nov 2017
796maggieschwind.comDomain.com, LLC25 Nov 201425 Nov 201425 Nov 2015
797maggies4you.comGoDaddy.com, LLC25 Nov 201425 Nov 201425 Nov 2016
798maggielueg.comGoDaddy.com, LLC1 Oct 20201 Oct 20201 Oct 2021
799maggieandnathantietheknot.comWild West Domains, LLC25 Nov 201425 Nov 201425 Nov 2015
800maggiedubaimassage.comNetwork Solutions, LLC28 Nov 201428 Nov 201428 Nov 2015
801maggie-ancheta.useNom, Inc.26 Nov 201426 Nov 201425 Nov 2015
802maggieoldmixon.comGoDaddy.com, LLC28 Nov 201428 Nov 201428 Nov 2016
803maggiemaplefield.comFastDomain Inc.28 Nov 20148 Nov 201628 Nov 2017
804maggieellensoap.comGoDaddy.com, LLC28 Nov 201410 Dec 201628 Nov 2017
805maggiebrewer.comGoogle, Inc.28 Nov 201414 Nov 202428 Nov 2025
806maggiesmegadeals.comGoDaddy.com, LLC30 Nov 201430 Nov 201430 Nov 2016
807maggieandbrian.comDropCatch.com 431 LLC29 Nov 201430 Nov 201729 Nov 2018
808maggiesfinalcomeback.comFastDomain Inc.30 Nov 201430 Nov 201430 Nov 2015
809maggielitwin.comTucows Domains Inc.30 Nov 20144 Dec 201730 Nov 2017
810maggiefonge.comGoDaddy.com, LLC1 Dec 20141 Dec 20141 Dec 2016
811maggie77.comeNom, Inc.1 Dec 20142 Dec 20151 Dec 2016
812maggiesorganics.netFastDomain Inc.30 Nov 201430 Nov 201430 Nov 2015
813maggiemade.orgCloudFlare, Inc.11 Feb 202418 Dec 202411 Feb 2026
814maggiesphotography.comGoDaddy.com, LLC7 Nov 20227 Nov 20247 Nov 2026
815maggiesassociates.comGoDaddy.com, LLC1 Dec 20141 Dec 20141 Dec 2015
816maggieheintzman.comTucows Domains Inc.1 Dec 201424 Apr 20251 Dec 2025
817maggiehairstudio.comTLD Registrar Solutions Ltd.2 Dec 20142 Dec 20142 Dec 2015
818maggieglaize.comTucows Domains Inc.1 Dec 201424 Apr 20251 Dec 2025
819maggiefoskett.comGoDaddy.com, LLC2 Dec 20142 Dec 20142 Dec 2015
820maggieburton.comeNom, Inc.1 Dec 201424 Nov 20241 Dec 2025
821maggie-me.comTucows Domains Inc.28 Nov 20132 Dec 201428 Nov 2015
822maggiesfinalcomeback.orgFastDomain Inc.30 Nov 201430 Nov 201430 Nov 2015
823maggiemowbray.comGoDaddy.com, LLC21 Feb 202022 Feb 202421 Feb 2026
824maggienjhomes.netGoDaddy.com, LLC1 Dec 20141 Dec 20141 Dec 2017
825maggiepoblete.comeNom, Inc.25 Oct 201615 Nov 201725 Oct 2018
826maggiemullanarchitectsltd.comRegister.it SPA3 Dec 20143 Dec 20173 Dec 2018
827maggiemb.comGoogle, Inc.29 Jan 202029 Jan 202029 Jan 2021
828maggiemae-photography.comTucows Domains Inc.4 Dec 20148 Dec 20154 Dec 2016
829maggiecatedesign.comeNom, Inc.4 Dec 20144 Dec 20144 Dec 2015
830maggiesfarmbakery.comTucows Domains Inc.1 Dec 20135 Dec 20201 Dec 2020
831maggiecammiss.comWild West Domains, LLC4 Dec 20143 Nov 20244 Dec 2025
832maggiebdesign.com-1 May 20242 Jun 20251 May 2025
833maggiebarr.comGoDaddy.com, LLC5 Dec 201414 Mar 20255 Dec 2025
834maggiesfarmbakery.netTucows Domains Inc.1 Dec 20135 Dec 20201 Dec 2020
835maggiesorganic.comCosmotown, Inc.6 May 20247 May 20256 May 2026
836maggiesolaun.comGoDaddy.com, LLC8 Dec 20148 Dec 20148 Dec 2015
837maggiehennessy.comTucows Domains Inc.7 Dec 201424 Apr 20257 Dec 2025
838maggieandmatty.comWild West Domains, LLC7 Dec 20147 Dec 20147 Dec 2015
839maggiemayschmid.comGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
840maggieelizabethjesse.comGandi SAS8 Dec 20148 Dec 20148 Dec 2015
841maggiedill.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Dec 20149 Dec 20149 Dec 2015
842maggie4u.comAscio Technologies, Inc. Danmark - Filial af Ascio…11 Nov 202011 Nov 202011 Nov 2021
843maggiewilliamsart.comGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
844maggieunzueta.comNameCheap, Inc.29 Apr 201830 Mar 202529 Apr 2026
845maggieshewrote.comGoDaddy.com, LLC9 Dec 201410 Dec 20249 Dec 2026
846maggiehelmer.com1&1 Internet AG9 Dec 201414 Mar 20189 Dec 2025
847maggiegracestationery.comNetwork Solutions, LLC9 Dec 201412 Dec 20169 Dec 2017
848maggiegracestationary.comNetwork Solutions, LLC9 Dec 20149 Dec 20149 Dec 2015
849maggieayres.comInternet Domain Services BS Corp9 Dec 20142 Mar 20179 Dec 2018
850maggieannre.comTucows Domains Inc.9 Dec 201424 Apr 20259 Dec 2025
851maggiesmorsels.comGoDaddy.com, LLC25 Oct 201725 Oct 202325 Oct 2025
852maggiesellstexas.comregister.com, Inc.10 Dec 201410 Dec 201410 Dec 2015
853maggiemata.comMesh Digital Limited11 Dec 201424 Jun 201911 Dec 2020
854maggielindhomes.comGoDaddy.com, LLC10 Dec 201410 Dec 201410 Dec 2016
855maggiesotterro.comNameCheap, Inc.4 Dec 202416 Mar 20254 Dec 2025
856maggiemartinezrealestate.comeNom, Inc.11 Dec 201411 Dec 201411 Dec 2015
857maggiegphotography.comGoDaddy.com, LLC26 Mar 202124 Jan 202326 Mar 2029
858maggiegardenerphotography.comInstra Corporation Pty Ltd.11 Dec 201412 Dec 201411 Dec 2015
859maggiecorner.comGoDaddy.com, LLC3 Apr 20173 Apr 20173 Apr 2019
860maggiestrong.comGoDaddy.com, LLC5 Feb 201618 Jul 20245 Feb 2027
861maggiemayfotografia.comTucows Domains Inc.12 Dec 201416 Dec 201512 Dec 2016
862maggieandluke.comeNom, Inc.28 Jan 202311 Apr 202428 Jan 2024
863maggiemaescupcakes.comTucows Domains Inc.10 Dec 201314 Dec 201410 Dec 2015
864maggieinca.comAscio Technologies, Inc. Danmark - Filial af Ascio…13 Dec 201413 Dec 201413 Dec 2015
865maggiedriver.comWild West Domains, LLC14 Dec 201414 Dec 201414 Dec 2015
866maggiedempsey.comNetwork Solutions, LLC13 Dec 201413 Nov 202413 Dec 2026
867maggieddesigns.comTucows Domains Inc.14 Dec 201418 Dec 201814 Dec 2018
868maggie-weiss.comTucows Domains Inc.30 May 201830 May 201830 May 2019
869maggiemoss.net1&1 Internet AG13 Dec 201413 Dec 201413 Dec 2015
870maggiewinslettfairygrandfeathers.comGoDaddy.com, LLC14 Dec 201414 Dec 201414 Dec 2018
871maggieshannoncurry.comGoDaddy.com, LLC14 Dec 201415 Dec 201614 Dec 2017
872maggies-nails.comMesh Digital Limited14 Dec 201414 Nov 202414 Dec 2025
873maggiehomerental.comNameCheap, Inc.15 Dec 201415 Nov 202415 Dec 2025
874maggiefarmboutique.comGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2015
875maggiesmark.netNetwork Solutions, LLC14 Dec 201425 Mar 201514 Dec 2017
876maggiesdavis.comGoDaddy.com, LLC16 Dec 201416 Dec 201416 Dec 2015
877maggiesatoro.comFabulous.com Pty Ltd.29 Nov 20051 Dec 201529 Nov 2016
878maggiegravier.comDropCatch.com 1239 LLC3 Mar 20183 Mar 20183 Mar 2019
879maggieandthesauce.comGoDaddy.com, LLC23 Apr 20205 Jul 202323 Apr 2023
880maggieandcurtis.comDomain.com, LLC15 Dec 201415 Dec 201415 Dec 2015
881maggiewallphotography.comTucows Domains Inc.13 Dec 201217 Dec 201713 Dec 2017
882maggiesdc.comDynadot, LLC21 Jul 202121 Jul 202121 Jul 2022
883maggiemaeconsultant.comGoDaddy.com, LLC16 Dec 201416 Dec 201416 Dec 2016
884maggieandmarc.comNameCheap, Inc.17 Apr 202229 May 202417 Apr 2024
885maggie-spring.comTucows Domains Inc.17 Dec 201421 Dec 201817 Dec 2018
886maggiemaephotography.netNetwork Solutions, LLC16 Dec 201416 Dec 201616 Dec 2017
887maggiebowen.orgAscio Technologies, Inc. Danmark - Filial af Ascio…15 Dec 2014-15 Dec 2015
888maggiesfarmmiddleboro.comregister.com, Inc.17 Dec 201417 Dec 201417 Dec 2015
889maggiemccannpike.comPSI-USA, Inc. dba Domain Robot2 Sep 20202 Sep 20202 Sep 2021
890maggieinuganda.comTucows Domains Inc.18 Dec 201422 Dec 201718 Dec 2017
891maggiecooks-hub.comGoDaddy.com, LLC17 Dec 201417 Dec 201417 Dec 2015
892maggiekuo.infoWild West Domains, LLC17 Dec 201417 Dec 201417 Dec 2015
893maggiesmithphotography.comDomain.com, LLC19 Mar 200429 Feb 201619 Mar 2019
894maggiesguesthouse.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Dec 201424 Jan 201718 Dec 2017
895maggiemejia.comNameSourceDomains, LLC21 Apr 20235 Jul 202421 Apr 2024
896maggiesnuskinresearch.comTucows Domains Inc.18 Nov 200922 Nov 201618 Nov 2016
897maggieservices.comGoDaddy.com, LLC2 May 20213 May 20252 May 2026
898maggiemoo.comDropCatch.com 1037 LLC8 Mar 20203 Apr 20238 Mar 2026
899maggieandmark.comeNom, Inc.24 Mar 20225 Jun 202524 Mar 2025
900maggiesshayne.comGoDaddy.com, LLC22 Dec 201422 Dec 201422 Dec 2015
901maggieisdabomb.comGoDaddy.com, LLC22 Dec 201422 Dec 201422 Dec 2015
902maggieandandy.comGoDaddy.com, LLC6 Feb 20177 Feb 20246 Feb 2026
903maggieswaffles.com-22 May 201622 May 201622 May 2017
904maggiesolotravel.comLaunchpad, Inc.22 Dec 201426 Nov 201622 Dec 2017
905maggieoxford.comGoDaddy.com, LLC22 Dec 201423 Dec 202422 Dec 2025
906maggiesfarminthebethelwoods.comFastDomain Inc.23 Dec 20149 Dec 202423 Dec 2025
907maggieovereasy.comTucows Domains Inc.24 Dec 201428 Dec 201624 Dec 2016
908maggiegottlieb.comTucows Domains Inc.20 Aug 20155 Aug 202520 Aug 2026
909maggieeyebrows.comGoDaddy.com, LLC23 Dec 201417 Sep 202223 Dec 2025
910maggiebunting.netEpik Inc.22 Dec 201422 Dec 201422 Dec 2017
911maggiesbagsandmore.comTucows Domains Inc.21 Dec 201325 Dec 201421 Dec 2015
912maggiemccoy.comGoDaddy.com, LLC11 May 201911 May 201911 May 2020
913maggiejiaozi.comTucows Domains Inc.24 Dec 20142 May 202424 Dec 2025
914maggievalleyrental.netInterweb Advertising D.B.A. Profile Builder23 Dec 201423 Dec 201423 Dec 2015
915maggiesaccessories.comDropCatch.com 714 LLC14 Mar 201714 Mar 201714 Mar 2018
916maggiemayvw.comGoDaddy.com, LLC25 Dec 201425 Dec 201425 Dec 2017
917maggiemayvan.comGoDaddy.com, LLC25 Dec 20145 Feb 202525 Dec 2024
918maggielemere.comTucows Domains Inc.26 Dec 201424 Apr 202526 Dec 2025
919maggiebrownlaw.comGoDaddy.com, LLC26 Dec 201426 Dec 201426 Dec 2016
920maggieanddaniel.comNameCheap, Inc.22 Mar 202120 Feb 202522 Mar 2026
921maggieandadam.comGoDaddy.com, LLC27 Dec 201427 Dec 202427 Dec 2026
922maggieness.com-23 Oct 20244 Nov 202423 Oct 2025
923maggiezi.comGoDaddy.com, LLC29 Dec 20149 Jan 201729 Dec 2017
924maggiedillondesigns.comFastDomain Inc.28 Dec 201413 Dec 202428 Dec 2026
925maggieandjacob.comeNom, Inc.25 Feb 202025 Feb 202025 Feb 2022
926maggie-chambers.comGoogle, Inc.28 Dec 201418 Apr 201728 Dec 2018
927maggiewelshrealtor.comeNom, Inc.29 Dec 201427 Dec 201629 Dec 2017
928maggietreats.comWild West Domains, LLC3 Jun 20253 Jun 20253 Jun 2026
929maggiespin.comKey-Systems GmbH29 Dec 201427 Nov 201629 Dec 2017
930maggieknooihuizen.comWild West Domains, LLC29 Dec 201429 Dec 201429 Dec 2015
931maggiedickman.comTucows Domains Inc.30 Dec 201415 Dec 202430 Dec 2025
932maggieandmoose.comGoDaddy.com, LLC29 Dec 201430 Dec 202429 Dec 2025
933maggieshannon.netNameCheap, Inc.28 Dec 201428 Nov 202428 Dec 2025
934maggiesettero.comFabulous.com Pty Ltd.11 Dec 20048 Jan 201611 Dec 2016
935maggiesmart.comWeb Commerce Communications Limited dba WebNic.cc21 Nov 202215 Mar 202321 Nov 2024
936maggiemayboutique.comTucows Domains Inc.31 Dec 20144 Jan 201631 Dec 2016
937maggiemaephoto.netTucows Domains Inc.30 Dec 20143 Jan 201630 Dec 2016
938maggieconnelly.netGo China Domains, LLC2 Jun 20173 Jun 20252 Jun 2026
939maggiesunseri.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Jan 201520 Nov 20241 Jan 2026
940maggiesbarkery.comPDR Ltd. d/b/a PublicDomainRegistry.com9 May 20169 May 20169 May 2017
941maggielandman.comKey-Systems GmbH29 Dec 200228 Apr 202529 Dec 2028
942maggiefuller.comWix.com Ltd.3 Apr 20246 Mar 20253 Apr 2026
943maggiewines.comHostinger, UAB26 Jun 201926 Jun 201926 Jun 2020
944maggiestmall.comDropCatch.com 1355 LLC21 Mar 202021 Mar 202021 Mar 2021
945maggielici-shoes.comAscio Technologies, Inc. Danmark - Filial af Ascio…2 Jan 20152 Jan 20152 Jan 2016
946maggiegivesback.comGoDaddy.com, LLC3 Jan 20153 Jan 20253 Jan 2027
947maggiecazaresrealestate.comWild West Domains, LLC2 Jan 20152 Jan 20152 Jan 2016
948maggie-brad.comName.com, Inc.2 Jan 20152 Jan 20152 Jan 2016
949maggiestewartdesign.comTucows Domains Inc.18 Apr 200420 Mar 202318 Apr 2026
950maggieleedds.comDomain.com, LLC3 Jan 201528 Jun 20163 Jan 2020
951maggieschoices.comGoDaddy.com, LLC4 Jan 20154 Jan 20154 Jan 2016
952maggielouisecondections.comGoDaddy.com, LLC5 Jan 20155 Jan 20155 Jan 2016
953maggiekattan.comeNom, Inc.4 Jan 201531 Jan 20254 Jan 2026
954maggiecmurphy.comGoDaddy.com, LLC5 Jan 20155 Jan 20255 Jan 2027
955maggie-voight.useNom, Inc.3 Jan 20153 Jan 20152 Jan 2016
956maggiemadedolls.xyzNetwork Solutions, LLC16 Jul 201416 Jul 201416 Jul 2015
957maggiesupholstery.xyzNetwork Solutions, LLC26 Jul 201426 Jul 201426 Jul 2015
958maggies.photosTucows Domains Inc.25 Jul 201429 Jul 202525 Jul 2026
959maggieoreck.houseGoDaddy.com, LLC25 Jul 201427 Mar 202025 Jul 2020
960maggiefaisans.xyzNetwork Solutions, LLC23 Jul 201424 Jul 201423 Jul 2015
961maggiestenson.actorGoDaddy.com, LLC19 Aug 201430 Sep 202419 Aug 2024
962maggieg.fitnessNameCheap, Inc.27 Aug 201428 Jul 202527 Aug 2026
963maggiebaugh.xyzGoDaddy.com, LLC20 Sep 201420 Dec 202420 Sep 2025
964maggiekwan.nycNetwork Solutions, LLC3 Oct 20148 Aug 20242 Oct 2025
965maggiewall.nycunited-domains AG8 Oct 2014-7 Oct 2015
966maggiepatrick.nycregister.com, Inc.8 Oct 201412 Sep 20247 Oct 2025
967maggieduke.clubGoDaddy.com, LLC12 Oct 201412 Oct 201411 Oct 2015
968maggieduke.cashGoDaddy.com, LLC12 Oct 201412 Oct 201412 Oct 2015
969maggievalley.clubNetwork Solutions, LLC23 Apr 202123 Apr 202123 Apr 2022
970maggietlynn.comDropCatch.com 1041 LLC30 Oct 201830 Oct 201830 Oct 2019
971maggiepuddle.comRegister.it SPA11 Aug 20158 Jul 202511 Aug 2026
972maggiemunley.comGoDaddy.com, LLC11 Aug 201512 Aug 202511 Aug 2026
973maggielynn.infoGoDaddy.com, LLC11 Aug 201512 Aug 201611 Aug 2017
974maggiekloss.comNameCheap, Inc.11 Aug 201512 Jul 202511 Aug 2026
975maggiejday.comNameCheap, Inc.11 Aug 201527 Mar 202411 Aug 2031
976maggie-grace.usNameKing.com Inc.24 Nov 20218 Feb 202224 Nov 2022
977maggiekay.lifeGoDaddy.com, LLC11 Nov 201411 Nov 201411 Nov 2015
978maggiet.websiteCrazy Domains FZ-LLC5 Nov 2014-5 Nov 2015
979maggielee.realtorName Share, Inc.17 Nov 201417 Nov 201417 Nov 2015
980maggiewilmoth.realtorName Share, Inc.24 Nov 201424 Nov 201424 Nov 2015
981maggies.clubGoogle, Inc.7 Jun 202319 Jul 20257 Jun 2025
982maggieandme.xyzTucows Domains Inc.28 Nov 20142 Dec 201528 Nov 2016
983maggiedahlgren.realtorName Share, Inc.2 Dec 20142 Dec 20142 Dec 2015
984maggieweb.gentHosting Concepts B.V. dba Openprovider8 Dec 201423 Jan 20178 Dec 2017
985maggieofaberdour.scotMesh Digital Limited19 Dec 2014-19 Dec 2016
986maggiespeaks.rocksGoDaddy.com, LLC6 Jan 20156 Jan 20156 Jan 2016
987maggievalltravelagent.comregister.com, Inc.12 Aug 201512 Aug 201512 Aug 2016
988maggiesottero.usGoDaddy.com, LLC12 Aug 201512 Aug 201511 Aug 2017
989maggiescove.comeNom, Inc.12 Aug 201512 Aug 201512 Aug 2016
990maggiemademe.comGoDaddy.com, LLC19 Jan 202320 Jan 202519 Jan 2027
991maggiedorego.comGoDaddy.com, LLC12 Aug 20159 Aug 202512 Aug 2026
992maggieandjon2016.comeNom, Inc.12 Aug 201512 Aug 201512 Aug 2016
993maggie-heintzman.comTucows Domains Inc.12 Aug 201516 Aug 201712 Aug 2017
994maggiespeaks.bandGoDaddy.com, LLC28 Jan 201528 Jan 201528 Jan 2016
995maggiesuniquebraiding.websiteNameCheap, Inc.26 Jan 201526 Jan 201526 Jan 2016
996maggievalley.propertyUniregistrar Corp31 Jan 20154 Feb 201531 Jan 2016
997maggies.worldGoDaddy.com, LLC23 Jun 20207 Aug 202523 Jun 2026
998maggiesmunchies.kitchenKey-Systems, LLC22 Mar 201522 Mar 201522 Mar 2016
999maggiesfarmmarijuana.greenName.com, Inc.24 Mar 201524 Mar 201524 Mar 2016
1000maggieb.link1API GmbH24 Mar 20156 Apr 202424 Mar 2025

Displaying 1,000 out of 22,163 domains starting with the keyword "MAGGIE". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=maggie

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now