Our database now contains whois records of 630 Million (630,844,658) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1589 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [630 Million Domains] $10,000 Details

Keyword: LOCKSMITHSERVICES

Reverse Whois » KEYWORD [locksmithservices ]  { 321 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1locksmithservices.nycGo China Domains, LLC8 Oct 201413 Oct 20177 Oct 2018
2locksmithservices.melbourneCrazy Domains FZ-LLC23 May 201620 May 202523 May 2026
3locksmithservices.sydneyCrazy Domains FZ-LLC10 Mar 2015-10 Mar 2016
4locksmithservices.london1&1 Internet AG25 Apr 20157 Jul 202425 Apr 2024
5locksmithservices.infoNamesilo, LLC11 Feb 202111 Feb 202111 Feb 2022
6locksmithservices.orgAzdomainz LLC14 May 201525 Jun 201714 May 2018
7locksmithservices.miamiYnot Domains Corp.4 Oct 2015-4 Oct 2016
8locksmithservices.comGoDaddy.com, LLC19 Apr 200320 Apr 202519 Apr 2026
9locksmithservices.mobiGoDaddy.com, LLC31 Jan 20161 Feb 201731 Jan 2018
10locksmithservices.netGoDaddy.com, LLC5 Feb 20196 Feb 20255 Feb 2026
11locksmithservices.xyzGoDaddy.com, LLC25 Jun 2025-25 Jun 2026
12locksmithservices.bizDynadot, LLC3 Jun 20203 Jun 20213 Jun 2021
13locksmithservices.siteGoDaddy.com, LLC25 Jun 202525 Jun 202525 Jun 2026
14locksmithservices.guruNameCheap, Inc.7 Sep 20177 Sep 20177 Sep 2018
15locksmithservices.groupNameCheap, Inc.18 Sep 201718 Sep 201718 Sep 2018
16locksmithservices.me.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…10 Apr 20063 Apr 201610 Apr 2018
17locksmithservices.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…10 Apr 20063 Apr 201610 Apr 2018
18locksmithservices.onlineNameCheap, Inc.15 Nov 202422 Nov 202415 Nov 2025
19locksmithservices.zonePorkbun, LLC24 Apr 201824 Apr 201824 Apr 2019
20locksmithservices.ca-26 Jul 201027 Jul 202526 Jul 2026
21locksmithservices.todayGoDaddy.com, LLC17 Apr 202429 May 202517 Apr 2025
22locksmithservices.coNameKing.com Inc.21 Jun 202226 Jun 202321 Jun 2023
23locksmithservices.sbsNamesilo, LLC14 Nov 202114 Nov 202114 Nov 2022
24locksmithservices.agencyNetwork Solutions, LLC13 Mar 202217 May 202513 Mar 2025
25locksmithservices.storeCrazy Domains FZ-LLC10 Aug 20227 Aug 202410 Aug 2025
26locksmithservices.companyGoogle, Inc.21 Oct 202221 Oct 202221 Oct 2023
27locksmithservices.clickDynadot, LLC12 Jun 202512 Jun 202512 Jun 2026
28locksmithservices.ae----
29locksmithservices.monsterNameCheap, Inc.15 Oct 202216 Oct 202315 Oct 2024
30locksmithservices.co.uk-5 Aug 202331 Oct 20245 Aug 2025
31locksmithservices.uk-17 Apr 202517 Apr 202517 Apr 2026
32locksmithservices.ltdPDR Ltd. d/b/a PublicDomainRegistry.com23 Mar 20243 May 202523 Mar 2025
33locksmithservices.com.au--18 Jan 2025-
34locksmithservices.shopPDR Ltd. d/b/a PublicDomainRegistry.com17 Aug 202417 Aug 202417 Aug 2025
35locksmithservices.ie-16 Jun 201117 Jun 202517 Jun 2026
36locksmithservices.directoryNamesilo, LLC29 Mar 20253 Apr 202529 Mar 2026
37locksmithservices.proNameCheap, Inc.21 May 202526 May 202521 May 2026
38locksmithservices.help1API GmbH25 Jun 202525 Jun 202525 Jun 2026
39locksmithservices.spaceGoDaddy.com, LLC25 Jun 2025-25 Jun 2026
40locksmithservicessilverspringmd.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
41locksmithservicessanantonio.comGoDaddy.com, LLC28 Oct 202129 Oct 202428 Oct 2025
42locksmithservicesbethesdamd.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
43locksmithservicesphoenix.comNameCheap, Inc.6 Nov 20146 Oct 20246 Nov 2025
44locksmithservicesatlanta.comGoDaddy.com, LLC8 Nov 20149 Nov 20248 Nov 2025
45locksmithservicestaugustine.comTucows Domains Inc.25 Aug 201030 Aug 201425 Aug 2015
46locksmithservicesseattle.com1&1 Internet AG30 Aug 201430 Aug 201430 Aug 2015
47locksmithservicesqueens.comNameCheap, Inc.16 Feb 202417 Jan 202516 Feb 2026
48locksmithservicesdetroit.comGoDaddy.com, LLC10 Sep 201410 Sep 201410 Sep 2015
49locksmithservicesdenver.comGoogle, Inc.16 Jan 20192 Jan 202516 Jan 2026
50locksmithserviceswesthempstead.comGoDaddy.com, LLC21 Nov 201421 Nov 201421 Nov 2015
51locksmithservicesfl.comGoDaddy.com, LLC18 Oct 201418 Oct 201418 Oct 2015
52locksmithservicesacramento.netName.com, Inc.24 Nov 201424 Nov 201424 Nov 2015
53locksmithservicesplus.com-19 Feb 202219 Feb 202219 Feb 2023
54locksmithservicessantaana.comeNom, Inc.5 Dec 20145 Dec 20145 Dec 2015
55locksmithservicespring.comDotmedia Limited18 Mar 202328 May 202418 Mar 2024
56locksmithservicespringhill.comeNom, Inc.2 Jan 20152 Jan 20152 Jan 2016
57locksmithserviceshawaii.comGoDaddy.com, LLC4 Jan 20154 Jan 20154 Jan 2016
58locksmithservicespokane.comNetwork Solutions, LLC6 Jan 20156 Jan 20156 Jan 2016
59locksmithservicesantaclarita.comeNom, Inc.20 Jan 201520 Jan 201520 Jan 2016
60locksmithserviceslancaster.mobiTucows Domains Inc.18 Jan 201222 Jan 201518 Jan 2016
61locksmithserviceslancashire.mobiTucows Domains Inc.18 Jan 201222 Jan 201518 Jan 2016
62locksmithserviceslasvegas.comGoDaddy.com, LLC24 Jan 202024 Jan 202024 Jan 2021
63locksmithservicesgreenville.comGoDaddy.com, LLC18 Aug 201530 Sep 202018 Aug 2021
64locksmithservicesshawnee.comGoDaddy.com, LLC30 Jan 201530 Jan 201530 Jan 2016
65locksmithservicesdallastx.comeNom, Inc.12 Feb 201512 Feb 201512 Feb 2016
66locksmithservicespro.comGoDaddy.com, LLC21 Aug 201522 Aug 202321 Aug 2025
67locksmithservices1.comTucows Domains Inc.27 Feb 20083 Mar 201527 Feb 2016
68locksmithservicesintexas.comLaunchpad, Inc.4 Mar 20154 Mar 20154 Mar 2016
69locksmithservicesaintlouis.comGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2016
70locksmithservicesnearyou.comGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2016
71locksmithservicesqueens.netGoDaddy.com, LLC26 Aug 201526 Aug 201526 Aug 2017
72locksmithservicesmanhattan.comGoDaddy.com, LLC26 Aug 201526 Aug 201526 Aug 2017
73locksmithserviceslongisland.comGoDaddy.com, LLC26 Aug 201526 Aug 201526 Aug 2017
74locksmithservicesbrooklyn.comName.com, Inc.7 Feb 20177 Feb 20177 Feb 2018
75locksmithservicesbronx.comGoDaddy.com, LLC26 Aug 201527 Aug 201526 Aug 2016
76locksmithservicesnearme.comTLD Registrar Solutions Ltd.22 Mar 201529 Apr 202522 Mar 2026
77locksmithservicesalemor.comeNom, Inc.23 Mar 201523 Mar 201523 Mar 2016
78locksmithserviceswichitaks.comeNom, Inc.27 Mar 201527 Mar 201527 Mar 2016
79locksmithservicescavecreek.comGoDaddy.com, LLC7 Apr 20157 Apr 20157 Apr 2016
80locksmithservicesdunwoody.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Sep 20155 Sep 20155 Sep 2016
81locksmithservicestucson.comGoDaddy.com, LLC27 May 201527 May 201527 May 2016
82locksmithservices247.netNetwork Solutions, LLC25 Feb 20249 Feb 202525 Feb 2026
83locksmithservicesranchocucamonga.comGoDaddy.com, LLC3 Jul 20154 Jul 20253 Jul 2026
84locksmithservicesacworth.comGoDaddy.com, LLC24 Sep 201524 Sep 201524 Sep 2016
85locksmithservicesingapore.comNameCheap, Inc.10 Jul 20156 Jul 202510 Jul 2030
86locksmithservicesingeorgetownde.comeNom, Inc.24 Jul 201524 Jul 201524 Jul 2016
87locksmithservicesphiladelphia.comGoDaddy.com, LLC30 Jul 201530 Jul 201530 Jul 2016
88locksmithserviceshoustontx.comGoDaddy.com, LLC31 Jul 20151 Aug 202331 Jul 2025
89locksmithservicesouthwest.comTucows Domains Inc.18 Oct 200922 Oct 201518 Oct 2016
90locksmithservicesmilfordct.comeNom, Inc.18 Nov 20157 Apr 201718 Nov 2017
91locksmithserviceslosangeles.comGoDaddy.com, LLC20 Nov 201521 Jun 202420 Nov 2025
92locksmithservicesinlongbeachca.comeNom, Inc.1 Dec 20151 Dec 20151 Dec 2016
93locksmithserviceshermanoaks.comGoDaddy.com, LLC7 Dec 20157 Dec 20157 Dec 2016
94locksmithservicesavannahga.comeNom, Inc.15 Dec 201515 Dec 201515 Dec 2016
95locksmithservicesorangecounty.comGoDaddy.com, LLC12 Jan 201612 Jan 201612 Jan 2018
96locksmithservicescolumbus.comGoDaddy.com, LLC13 Jan 201613 Jan 201613 Jan 2017
97locksmithservicesmiami.comDynadot, LLC14 Nov 202014 Nov 202014 Nov 2021
98locksmithservicesaltlakecityut.comGoDaddy.com, LLC26 Jan 201626 Jan 201626 Jan 2017
99locksmithservicesforall.com35 Technology Co., Ltd.27 Apr 20226 Jul 202327 Apr 2023
100locksmithservicesmiamifl.comeNom, Inc.1 Mar 20161 Mar 20161 Mar 2017
101locksmithservicesmarietta.comGoDaddy.com, LLC22 Mar 20162 Jun 202522 Mar 2025
102locksmithserviceshoustontexas.comGoDaddy.com, LLC23 Mar 201624 Mar 202423 Mar 2026
103locksmithservicestx.comDomain.com, LLC20 Oct 20222 Jan 202520 Oct 2024
104locksmithservicestpaul.comLaunchpad, Inc.29 Mar 201611 May 202529 Mar 2026
105locksmithservicesjacksonville.comregister.com, Inc.25 May 20164 Nov 202125 May 2026
106locksmithservicesinc.xyzNameCheap, Inc.21 May 201610 Jun 201621 May 2017
107locksmithservicestroy.comNameCheap, Inc.30 Sep 201430 Aug 202430 Sep 2025
108locksmithservices-24h.comInternet Domain Services BS Corp19 Jul 201620 Jul 201719 Jul 2017
109locksmithservicesslc.xyzNameCheap, Inc.28 Jul 20165 Aug 201628 Jul 2017
110locksmithservicesdesmoines.comeNom, Inc.14 Mar 201328 Feb 201714 Mar 2018
111locksmithservicesandiegoca.comeNom, Inc.17 Aug 201629 Sep 201717 Aug 2017
112locksmithservices247.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…23 Feb 200820 May 202523 Feb 2027
113locksmithservicesvancouver.comGoDaddy.com, LLC6 Jul 20117 Jul 20166 Jul 2017
114locksmithservicesedmonton.comGoDaddy.com, LLC19 Feb 201422 Sep 201519 Feb 2017
115locksmithservicesinc.comGoDaddy.com, LLC20 May 200823 May 202520 May 2026
116locksmithservices24-7.comAmazon Registrar, Inc.12 Dec 20068 Nov 202412 Dec 2025
117locksmithserviceslocksmithshops.comWild West Domains, LLC22 Dec 200723 Dec 201522 Dec 2016
118locksmithservicestoronto.comGoDaddy.com, LLC29 May 201929 May 201929 May 2020
119locksmithservicesnyc.comGoDaddy.com, LLC8 Mar 20248 Mar 20248 Mar 2027
120locksmithserviceshuntsville.comNameCheap, Inc.10 Jun 201411 May 202510 Jun 2026
121locksmithservicescarborough.comGoDaddy.com, LLC27 Jan 201228 Jan 202427 Jan 2026
122locksmithserviceseverett.comChengdu West Dimension Digital Technology Co., Ltd…31 May 201831 May 201831 May 2019
123locksmithservicescottsdale.comGoDaddy.com, LLC31 May 20131 Jun 201631 May 2017
124locksmithservicesd.comregister.com, Inc.9 Apr 20149 Apr 20149 Apr 2018
125locksmithserviceslansing.comTucows Domains Inc.3 Dec 20107 Dec 20173 Dec 2017
126locksmithservicesfortmyers.comNameCheap, Inc.25 Jun 201425 May 202525 Jun 2026
127locksmithservicesandiego.comGoDaddy.com, LLC24 Nov 202125 Nov 202424 Nov 2025
128locksmithserviceskennesaw.comGoDaddy.com, LLC2 Jul 20133 Jul 20252 Jul 2026
129locksmithserviceswoodbridge.comGoDaddy.com, LLC30 Mar 201422 Sep 201530 Mar 2017
130locksmithservicesacramento.comGoDaddy.com, LLC24 Nov 202125 Nov 202424 Nov 2025
131locksmithserviceshouston.comGoDaddy.com, LLC2 Jan 20143 Jan 20252 Jan 2026
132locksmithserviceskaty.comregister.com, Inc.11 Apr 201311 Apr 201311 Apr 2017
133locksmithservices-naples.comregister.com, Inc.3 Sep 20135 Sep 20163 Sep 2017
134locksmithservicesinmiami.comNameCheap, Inc.18 Apr 201219 Mar 202518 Apr 2026
135locksmithserviceshome.comregister.com, Inc.1 Nov 201311 Jan 20161 Nov 2016
136locksmithservicessandiego.comeNom, Inc.4 Aug 20147 Aug 20164 Aug 2016
137locksmithservicesqueensny.comregister.com, Inc.2 Aug 20137 Sep 20162 Aug 2017
138locksmithservicesofindiana.comDomain.com, LLC22 Jul 201324 Jun 202522 Jul 2029
139locksmithservicesnorcross.comGoDaddy.com, LLC25 Feb 201425 Feb 202525 Feb 2026
140locksmithservicesscarborough.comGoDaddy.com, LLC7 Jul 20128 Jul 20167 Jul 2017
141locksmithservicesrichmond.comGoDaddy.com, LLC16 Sep 201328 Oct 201516 Sep 2016
142locksmithservicestlouis.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED17 Nov 201817 Nov 201817 Nov 2019
143locksmithservicessingapore.comPSI-USA, Inc. dba Domain Robot15 Nov 202015 Nov 202015 Nov 2021
144locksmithservicesmd.comGoDaddy.com, LLC11 Jan 20108 Apr 202411 Jan 2026
145locksmithservices-sanantonio.comGoDaddy.com, LLC23 Apr 201324 Feb 202523 Apr 2026
146locksmithservicesoftyler.comNetwork Solutions, LLC18 Aug 200718 Jun 202218 Aug 2027
147locksmithservicesjerseycity.comGoDaddy.com, LLC6 Aug 20137 Aug 20166 Aug 2017
148locksmithserviceswinstonsalemnc.comregister.com, Inc.24 Jan 201424 Jan 201424 Jan 2018
149locksmithservicesuk.comFreeparking Domain Registrars, Inc.23 Jan 200722 May 201523 Jan 2022
150locksmithservicestpetersburg.comeNom, Inc.25 Jul 201426 Jun 201525 Jul 2017
151locksmithservicesdover.comeNom, Inc.25 Jul 201429 Aug 201625 Jul 2017
152locksmithservicesanfrancisco.comeNom, Inc.5 Jan 201426 Dec 20245 Jan 2026
153locksmithservicesbuffalo.comregister.com, Inc.30 Sep 201430 Sep 201430 Sep 2016
154locksmithservicesd.netregister.com, Inc.9 Apr 20149 Apr 20149 Apr 2018
155locksmithservicesoftyler.netTucows Domains Inc.24 Jun 201328 Jun 201724 Jun 2017
156locksmithservicestoronto.netGoDaddy.com, LLC7 Jul 20128 Jul 20167 Jul 2017
157locksmithservicesanjose.netregister.com, Inc.27 Mar 201427 Mar 201427 Mar 2021
158locksmithserviceshouston.netGoDaddy.com, LLC2 Jan 20143 Jan 20252 Jan 2026
159locksmithservicesandiego.netregister.com, Inc.27 Mar 201427 Mar 201427 Mar 2021
160locksmithservicesunnyside.comTucows Domains Inc.24 Oct 201628 Oct 201724 Oct 2017
161locksmithservicesinca.comeNom, Inc.27 Oct 201628 Sep 201727 Oct 2018
162locksmithservicesca.comeNom, Inc.27 Oct 201628 Sep 201727 Oct 2018
163locksmithserviceseattle.comGoDaddy.com, LLC27 Oct 201628 Oct 202427 Oct 2025
164locksmithservicesinny.comeNom, Inc.27 Oct 201628 Sep 201727 Oct 2018
165locksmithservicesny.comNameCheap, Inc.16 Jan 2020-16 Jan 2021
166locksmithservicesatl.comTucows Domains Inc.12 Nov 201616 Nov 201712 Nov 2017
167locksmithservicesincharlottenc.comeNom, Inc.27 Nov 201627 Nov 201627 Nov 2018
168locksmithservicesnearby.comGoDaddy.com, LLC10 Apr 202422 Jun 202510 Apr 2025
169locksmithservices4u.comGoDaddy.com, LLC13 Dec 201624 Feb 202513 Dec 2024
170locksmithservicesroswell.comDomainsoftheday.net LLC8 Apr 202512 Apr 20258 Apr 2026
171locksmithserviceskensington.comTucows Domains Inc.7 Feb 201711 Feb 20197 Feb 2019
172locksmithservicescardiff.comeNom, Inc.16 Feb 201721 Jan 201816 Feb 2018
173locksmithservicesllc.comGoDaddy.com, LLC15 Oct 202026 Dec 202415 Oct 2024
174locksmithservicesboise.comGoDaddy.com, LLC7 Mar 20177 Mar 20177 Mar 2018
175locksmithservicesblog.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Mar 201724 May 201724 Mar 2018
176locksmithservicesalem.comName.com, Inc.11 May 201712 Apr 202511 May 2026
177locksmithservicesoftware.comGoDaddy.com, LLC7 Jun 20177 Jun 20177 Jun 2018
178locksmithservicesincardiff.comeNom, Inc.3 Jul 201725 Jun 20253 Jul 2026
179locksmithserviceshillsboro.comName.com, Inc.18 Jul 201726 Sep 201718 Jul 2018
180locksmithservices24h.menNameCheap, Inc.1 Nov 20176 Nov 20171 Nov 2018
181locksmithservices24hr.menNameCheap, Inc.1 Nov 20171 Nov 20171 Nov 2018
182locksmithservices24hr.techNameCheap, Inc.16 Nov 201716 Nov 201716 Nov 2018
183locksmithservicescoppell.comName.com, Inc.21 Nov 201721 Nov 201721 Nov 2018
184locksmithserviceslancaster.comFastDomain Inc.3 Jan 201818 Dec 20243 Jan 2026
185locksmithservicescardiff.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…22 Sep 201622 Sep 201622 Sep 2018
186locksmithserviceslondon.co.uk-18 Dec 201520 Aug 202418 Dec 2025
187locksmithservicesbirmingham.co.uk-29 Jul 201523 May 201729 Jul 2018
188locksmithservicesgrimsby.co.uk-3 Nov 200821 Jan 20253 Nov 2026
189locksmithservicesouthampton.co.uk-10 Jan 201726 Dec 201710 Jan 2019
190locksmithservicestwickenham.co.uk-25 Feb 201327 Dec 201725 Feb 2018
191locksmithservicessheffield.co.ukHello Internet Corp.15 May 201415 May 201715 May 2018
192locksmithservicesbirmingham.comeNom, Inc.9 Jan 20189 Jan 20189 Jan 2019
193locksmithservicesessex.co.uk-7 Oct 20134 Aug 20177 Oct 2020
194locksmithservicesportland.comName.com, Inc.30 Jan 201830 Jan 201830 Jan 2019
195locksmithservices06.comNetwork Solutions, LLC2 Mar 20182 Mar 20182 Mar 2020
196locksmithservicesummerhill.comTucows Domains Inc.7 Mar 201811 Mar 20197 Mar 2019
197locksmithservicesbirminghamal.comTucows Domains Inc.14 Mar 20182 Apr 202514 Mar 2026
198locksmithserviceschicago.comGransy s.r.o. d/b/a subreg.cz11 Jul 202514 Jul 202511 Jul 2026
199locksmithservicesedmonton.ca-19 Feb 20145 Apr 201919 Feb 2020
200locksmithservicesforyou.comeNom, Inc.5 Apr 20185 Apr 20185 Apr 2019
201locksmithservicesvaughan.comTucows Domains Inc.14 May 201818 May 201914 May 2019
202locksmithservicesbarrie.comTucows Domains Inc.14 May 201818 May 201914 May 2019
203locksmithservicesinwoodstock.comNetwork Solutions, LLC26 May 201826 May 201826 May 2019
204locksmithservicesinroswell.comNetwork Solutions, LLC26 May 201826 May 201826 May 2019
205locksmithservicesinburbank.comGoDaddy.com, LLC31 May 201831 May 201831 May 2019
206locksmithservicesinglendale.comGoDaddy.com, LLC31 May 201831 May 201831 May 2019
207locksmithservicesinsantaclarita.comGoDaddy.com, LLC31 May 201831 May 201831 May 2019
208locksmithservicesinhollywood.comGoDaddy.com, LLC1 Jun 20181 Jun 20181 Jun 2019
209locksmithserviceswildwood.comTucows Domains Inc.7 Jun 201811 Jun 20197 Jun 2019
210locksmithservicesummerfield.comTucows Domains Inc.7 Jun 201811 Jun 20197 Jun 2019
211locksmithservicesgroup.comGoDaddy.com, LLC7 Jun 202110 Jun 20257 Jun 2027
212locksmithserviceswi.comGoDaddy.com, LLC20 Nov 201820 Nov 201820 Nov 2020
213locksmithservices247.clubNameCheap, Inc.24 Dec 201824 Dec 201824 Dec 2019
214locksmithservicescoloradosprings.usNameCheap, Inc.21 Jul 202221 Jul 202321 Jul 2023
215locksmithservicesgta.comGoDaddy.com, LLC3 Aug 20216 Aug 20213 Aug 2022
216locksmithserviceslondon.comGoDaddy.com, LLC12 Mar 201911 Mar 202512 Mar 2026
217locksmithservices-in-fr.comKey-Systems GmbH9 Apr 20199 Apr 20199 Apr 2020
218locksmithservices-in-us.comKey-Systems GmbH9 Apr 20199 Apr 20199 Apr 2020
219locksmithserviceselginmills.comTucows Domains Inc.23 Apr 201927 Apr 202023 Apr 2020
220locksmithservicesintoronto.ca-23 Dec 201524 Dec 202423 Dec 2026
221locksmithservicespreston.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Jul 20193 Jul 20193 Jul 2020
222locksmithservicesnow.comSquarespace Domains LLC11 Feb 202511 Feb 202511 Feb 2026
223locksmithservicescallnow.comNameCheap, Inc.16 Jul 2019-16 Jul 2020
224locksmithservicesandsecurity.comeNom, Inc.4 Oct 20194 Oct 20194 Oct 2020
225locksmithservices24.comFastDomain Inc.1 Dec 201916 Nov 20241 Dec 2025
226locksmithserviceshop.comNameCheap, Inc.1 Dec 2019-1 Dec 2020
227locksmithservicesla.comGoDaddy.com, LLC23 Feb 202024 Feb 202523 Feb 2026
228locksmithserviceseagan.comName.com, Inc.26 Feb 202026 Feb 202026 Feb 2021
229locksmithservicesisrael.comNameCheap, Inc.22 Mar 202023 Mar 202522 Mar 2026
230locksmithserviceshome.infoGoDaddy.com, LLC18 May 202018 May 202018 May 2021
231locksmithserviceslongmont.comGoogle, Inc.16 Jan 20192 Jan 202516 Jan 2026
232locksmithservicesanjose.comGoDaddy.com, LLC8 Jul 20208 Jul 20208 Jul 2021
233locksmithservicesonline.comGoDaddy.com, LLC23 Jul 202023 Jul 202523 Jul 2026
234locksmithservicesgateshead.xyzNameCheap, Inc.24 Jul 202025 Jul 202524 Jul 2026
235locksmithservicesoftyler1.comName.com, Inc.9 Sep 20209 Sep 20209 Sep 2021
236locksmithservicesoftyler2.comName.com, Inc.10 Sep 202010 Sep 202010 Sep 2021
237locksmithservicesbayarea.comGoDaddy.com, LLC16 Sep 202028 Oct 202416 Sep 2024
238locksmithservicespaloalto.comGoDaddy.com, LLC16 Sep 202028 Oct 202416 Sep 2024
239locksmithservicessanmateo.comGoDaddy.com, LLC16 Sep 202028 Oct 202416 Sep 2024
240locksmithservicesincs.com1&1 Internet AG13 Oct 202013 Oct 202013 Oct 2021
241locksmithserviceschampaignil.comGoDaddy.com, LLC17 Oct 20202 Nov 202217 Oct 2030
242locksmithservicesllc.coGoDaddy.com, LLC31 Oct 202016 Aug 202131 Oct 2021
243locksmithservicescollc.comGoDaddy.com, LLC5 Jan 20245 Jan 20255 Jan 2026
244locksmithservicespros.comNameCheap, Inc.16 May 202027 Jul 202516 May 2025
245locksmithservicesca.siteDOTSERVE INC.22 Apr 20197 Jul 202022 Apr 2021
246locksmithservicesilnet.comKey-Systems GmbH12 Jan 202112 Jan 202112 Jan 2022
247locksmithservicesdallas.comDynadot, LLC12 Mar 202112 Mar 202112 Mar 2022
248locksmithservicesusa.comGoDaddy.com, LLC4 May 20215 May 20254 May 2026
249locksmithservicesit.spaceDOTSERVE INC.29 Jun 20219 May 202229 Jun 2024
250locksmithservicesusanet.comKey-Systems GmbH2 Aug 20212 Aug 20212 Aug 2022
251locksmithservicesforever.comNameCheap, Inc.14 Aug 2021-14 Aug 2022
252locksmithservicesinwashingtondc.comFastDomain Inc.26 Aug 202126 Aug 202126 Aug 2022
253locksmithservicesspring.comNameCheap, Inc.27 Sep 202128 Aug 202427 Sep 2025
254locksmithservicesukweb.comKey-Systems GmbH8 Oct 20218 Oct 20218 Oct 2022
255locksmithserviceswebuk.comKey-Systems GmbH7 Jan 20227 Jan 20227 Jan 2023
256locksmithservicescan.comNamesilo, LLC26 Jan 202227 Jan 202226 Jan 2023
257locksmithservicesbrighton.comWild West Domains, LLC20 Aug 202230 Sep 202320 Aug 2023
258locksmithservices24hr.sbsNamesilo, LLC28 Aug 202228 Aug 202228 Aug 2023
259locksmithservicesinit.spaceDOTSERVE INC.8 Sep 20228 Sep 20228 Sep 2023
260locksmithservicesus.comAbove.com Pty Ltd.3 Oct 202213 Dec 20233 Oct 2023
261locksmithservices-uk.siteDOTSERVE INC.11 Oct 202211 Oct 202211 Oct 2023
262locksmithservicesokc.comGoDaddy.com, LLC27 Dec 201816 Oct 202227 Dec 2026
263locksmithservicesaurora.comGoDaddy.com, LLC19 Oct 202219 Oct 202219 Oct 2027
264locksmithservicesink.comDomain.com, LLC19 Oct 20221 Jan 202519 Oct 2024
265locksmithservicesmn.comGoDaddy.com, LLC29 Oct 20229 Nov 202429 Oct 2025
266locksmithservicesydney.onlineCrazy Domains FZ-LLC16 Dec 202222 Dec 202316 Dec 2024
267locksmithservices247.co.ukDynadot, LLC26 Dec 202227 Dec 202326 Dec 2023
268locksmithserviceslondon247.co.uk-28 Dec 202212 Feb 202528 Dec 2025
269locksmithservicestouffville.comHostinger, UAB8 Jan 202317 Feb 20248 Jan 2024
270locksmithservices24hours.buzzNameKing.com Inc.17 Jan 202222 Jan 202217 Jan 2023
271locksmithservices24hr.buzzNameKing.com Inc.17 Jan 202222 Jan 202217 Jan 2023
272locksmithservices-bayarea.comGoDaddy.com, LLC27 Jan 202327 Jan 202527 Jan 2027
273locksmithservices24h.buzzNameKing.com Inc.6 Jul 20226 Aug 20236 Jul 2023
274locksmithservices247.buzzNamesilo, LLC14 Oct 202217 Nov 202314 Oct 2023
275locksmithservicesydneyservice.comWild West Domains, LLC30 Jan 202312 Mar 202430 Jan 2024
276locksmithservicesindc.comGoDaddy.com, LLC2 Aug 201713 Sep 20232 Aug 2023
277locksmithservicesboulder.comGoogle, Inc.16 Jan 20192 Jan 202516 Jan 2026
278locksmithservicesaz.comGoDaddy.com, LLC5 May 202116 Jun 20235 May 2023
279locksmithservicesunnybank.comWild West Domains, LLC1 Apr 202313 Apr 20241 Apr 2025
280locksmithservicesfriendswood.comGoDaddy.com, LLC27 Sep 202128 Sep 202427 Sep 2025
281locksmithservicesrichardson.comGoDaddy.com, LLC27 Sep 202128 Sep 202427 Sep 2025
282locksmithservicesbaltimore.comGoDaddy.com, LLC5 Oct 202110 Oct 20245 Oct 2025
283locksmithservicespringtx.comGoDaddy.com, LLC5 Oct 202110 Oct 20245 Oct 2025
284locksmithservicesatlantaga.comGoDaddy.com, LLC24 Nov 202125 Nov 202424 Nov 2025
285locksmithservicesboston.comPorkbun, LLC28 Sep 202413 Apr 202528 Sep 2025
286locksmithserviceschelmsford.comGoDaddy.com, LLC13 Jul 202224 Aug 202413 Jul 2024
287locksmithserviceslongmont.orgGoogle, Inc.16 Dec 201917 Jul 202516 Dec 2025
288locksmithservicesbalwyn.comHostinger, UAB16 May 202325 Jun 202416 May 2024
289locksmithservicesmississauga.comWild West Domains, LLC24 May 20235 Aug 202424 May 2024
290locksmithservices-it.spaceDOTSERVE INC.27 Jun 20233 Aug 202427 Jun 2024
291locksmithservicesfast.comGoogle, Inc.18 Jul 202317 Sep 202418 Jul 2024
292locksmithservicesarc.comPorkbun, LLC20 Nov 20233 Jan 202520 Nov 2024
293locksmithserviceslanecovesydney.comHosting Concepts B.V. dba Openprovider29 Dec 20238 Feb 202529 Dec 2024
294locksmithserviceswestmeadsydney.comHosting Concepts B.V. dba Openprovider29 Dec 20238 Feb 202529 Dec 2024
295locksmithservicescharlotte.comGoDaddy.com, LLC7 Jan 202411 Feb 20257 Jan 2027
296locksmithservicesurfersparadise.comHostinger, UAB12 Jan 202427 Mar 202512 Jan 2025
297locksmithservicesmaryland.comGoDaddy.com, LLC17 Jan 202418 Jan 202517 Jan 2026
298locksmithservicesmb.comGoDaddy.com, LLC20 Jan 202420 Jan 202420 Jan 2027
299locksmithservicesouthportgoldcoast.comHostinger, UAB7 Feb 202422 Apr 20257 Feb 2025
300locksmithservicesbiggerawaters.comHostinger, UAB7 Feb 202422 Apr 20257 Feb 2025
301locksmithservicesliverpool.co.uk-14 Mar 202414 Mar 202414 Mar 2027
302locksmithservicess.comNameCheap, Inc.18 Mar 202419 Mar 202518 Mar 2026
303locksmithservicesadelaide.comHostinger, UAB14 Apr 202415 Apr 202514 Apr 2026
304locksmithservicesedwardstown.comHostinger, UAB14 Apr 202415 Apr 202514 Apr 2026
305locksmithserviceschelmsford.co.uk-12 Jul 20223 Jul 202312 Jul 2024
306locksmithservicesglenwaverley.comHostinger, UAB7 Jul 202412 Jul 20257 Jul 2026
307locksmithservicesus.todayGoDaddy.com, LLC30 Jul 20244 Aug 202430 Jul 2025
308locksmithservicesduae.comHostinger, UAB8 Oct 20248 Oct 20248 Oct 2025
309locksmithservicesvictoria.comGoogle, Inc.9 Oct 202424 Oct 20249 Oct 2025
310locksmithservicesgroup.co.uk-16 Oct 202416 Oct 202416 Oct 2025
311locksmithservicescalgary.ca-21 Feb 20237 Apr 202521 Feb 2026
312locksmithservicesglobal.todayNameCheap, Inc.19 Dec 202424 Dec 202419 Dec 2025
313locksmithservicesusa.netHostinger, UAB20 Dec 202420 Dec 202420 Dec 2025
314locksmithservicesll.comGoDaddy.com, LLC7 Jan 20257 Jan 20257 Jan 2026
315locksmithservicesapls.comGoDaddy.com, LLC13 Jan 202513 Jan 202513 Jan 2026
316locksmithservicesglobal2.todayNameCheap, Inc.11 Feb 202516 Feb 202511 Feb 2026
317locksmithservicesmelbourne.siteNameCheap, Inc.15 Apr 20251 May 202515 Apr 2026
318locksmithservicesqueencreek.comTucows Domains Inc.24 Apr 202524 Apr 202524 Apr 2026
319locksmithservicesconnecticut.comGransy s.r.o. d/b/a subreg.cz4 Jun 20254 Jun 20254 Jun 2028
320locksmithservices-0.clickDynadot, LLC12 Jun 202512 Jun 202512 Jun 2026
321locksmithservicesredmond.comNameCheap, Inc.12 Jul 202512 Jul 202512 Jul 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=locksmithservices

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now