With support for 
Keyword: LIVINGWELL
Reverse Whois » KEYWORD [livingwell ] { 4,418 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | livingwell.ca | - | 12 May 2001 | 28 Apr 2025 | 12 May 2026 |
| 2 | livingwell.com | MarkMonitor Inc. | 16 Aug 1995 | 14 Jul 2024 | 15 Aug 2025 |
| 3 | livingwell.org.au | - | - | 14 Dec 2024 | - |
| 4 | livingwell.works | GoDaddy.com, LLC | 1 Aug 2014 | 29 Sep 2017 | 1 Aug 2018 |
| 5 | livingwell.rocks | NameCheap, Inc. | 13 Jan 2017 | 13 Jan 2018 | 13 Jan 2019 |
| 6 | livingwell.church | Mesh Digital Limited | 17 Sep 2014 | 1 Nov 2024 | 17 Sep 2025 |
| 7 | livingwell.guide | NameCheap, Inc. | 24 Jun 2019 | 9 Jul 2022 | 24 Jun 2023 |
| 8 | livingwell.life | GoDaddy.com, LLC | 5 Oct 2014 | 19 Nov 2024 | 5 Oct 2025 |
| 9 | livingwell.support | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Oct 2014 | 29 Sep 2017 | 14 Oct 2018 |
| 10 | livingwell.space | Tucows Domains Inc. | 18 Dec 2017 | 8 Jan 2025 | 18 Dec 2025 |
| 11 | livingwell.how | 101domain, Inc. | 10 Feb 2015 | - | 10 Feb 2016 |
| 12 | livingwell.social | Automattic Inc. | 30 Jun 2021 | 15 Jun 2024 | 30 Jun 2025 |
| 13 | livingwell.solutions | Network Solutions, LLC | 26 Aug 2017 | 9 Jun 2024 | 26 Aug 2025 |
| 14 | livingwell.directory | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 May 2015 | 3 Jul 2020 | 23 May 2020 |
| 15 | livingwell.website | - | 13 Jul 2024 | 18 Jul 2024 | 13 Jul 2025 |
| 16 | livingwell.design | GoDaddy.com, LLC | 17 Jan 2023 | 28 Feb 2024 | 17 Jan 2024 |
| 17 | livingwell.miami | GoDaddy.com, LLC | 13 Oct 2015 | 13 Oct 2015 | 13 Oct 2016 |
| 18 | livingwell.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Oct 2015 | 13 Nov 2024 | 24 Oct 2025 |
| 19 | livingwell.healthcare | GoDaddy.com, LLC | 20 Apr 2017 | 29 Sep 2017 | 20 Apr 2018 |
| 20 | livingwell.expert | GoDaddy.com, LLC | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 21 | livingwell.live | GoDaddy.com, LLC | 25 Jan 2016 | 11 Mar 2025 | 25 Jan 2026 |
| 22 | livingwell.institute | GoDaddy.com, LLC | 25 Jan 2016 | 11 Mar 2025 | 25 Jan 2026 |
| 23 | livingwell.international | GoDaddy.com, LLC | 7 Jul 2020 | 7 Jul 2023 | 7 Jul 2024 |
| 24 | livingwell.top | Alpnames Limited | 16 Mar 2016 | 16 Mar 2016 | 16 Mar 2017 |
| 25 | livingwell.site | GoDaddy.com, LLC | 30 Jan 2024 | 12 Apr 2025 | 30 Jan 2025 |
| 26 | livingwell.link | Alpnames Limited | 17 Mar 2016 | 27 Apr 2017 | 17 Mar 2017 |
| 27 | livingwell.click | Alpnames Limited | 17 Mar 2016 | 27 Apr 2017 | 17 Mar 2017 |
| 28 | livingwell.tech | Regional Network Information Center, JSC dba RU-CE… | 15 Jun 2024 | 10 Jul 2024 | 15 Jun 2025 |
| 29 | livingwell.org | GoDaddy.com, LLC | 15 Apr 2000 | 30 May 2024 | 15 Apr 2026 |
| 30 | livingwell.fit | GoDaddy.com, LLC | 6 Jan 2025 | 11 Jan 2025 | 6 Jan 2026 |
| 31 | livingwell.work | GoDaddy.com, LLC | 3 Sep 2021 | 15 Oct 2024 | 3 Sep 2024 |
| 32 | livingwell.team | GoDaddy.com, LLC | 17 May 2016 | 1 Jul 2018 | 17 May 2020 |
| 33 | livingwell.xyz | West263 International Limited | 25 Feb 2021 | 30 Aug 2024 | 25 Feb 2026 |
| 34 | livingwell.us | Wild West Domains, LLC | 11 Jun 2016 | 16 Jun 2024 | 10 Jun 2025 |
| 35 | livingwell.store | GoDaddy.com, LLC | 5 Apr 2024 | 6 Apr 2025 | 5 Apr 2026 |
| 36 | livingwell.guru | GoDaddy.com, LLC | 20 Apr 2018 | 21 Apr 2025 | 20 Apr 2026 |
| 37 | livingwell.tips | Amazon Registrar, Inc. | 9 Mar 2014 | 7 Feb 2025 | 9 Mar 2026 |
| 38 | livingwell.today | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Feb 2024 | 13 Jan 2025 | 17 Feb 2026 |
| 39 | livingwell.care | Network Solutions, LLC | 10 Dec 2019 | 12 Jun 2023 | 10 Dec 2025 |
| 40 | livingwell.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Oct 2023 | 19 Oct 2024 | 19 Oct 2024 |
| 41 | livingwell.center | eNom, Inc. | 4 Aug 2016 | 25 Jul 2024 | 4 Aug 2025 |
| 42 | livingwell.email | GoDaddy.com, LLC | 23 Apr 2021 | 4 Jul 2024 | 23 Apr 2024 |
| 43 | livingwell.asia | NameCheap, Inc. | 15 Feb 2023 | 28 Apr 2025 | 15 Feb 2025 |
| 44 | livingwell.info | NameKing.com Inc. | 14 Apr 2025 | 15 Apr 2025 | 14 Apr 2026 |
| 45 | livingwell.mobi | CSC Corporate Domains, Inc. | 26 Sep 2006 | 17 Oct 2024 | 26 Sep 2024 |
| 46 | livingwell.net | Dynadot, LLC | 28 Mar 1998 | 29 Jan 2025 | 27 Mar 2026 |
| 47 | livingwell.tv | 1&1 Internet AG | 22 Apr 2008 | 6 Jun 2024 | 22 Apr 2025 |
| 48 | livingwell.co.uk | - | 22 Oct 1997 | 20 Sep 2024 | 22 Oct 2025 |
| 49 | livingwell.news | GoDaddy.com, LLC | 18 Feb 2023 | 1 Apr 2025 | 18 Feb 2025 |
| 50 | livingwell.fyi | GoDaddy.com, LLC | 8 Apr 2019 | 9 Apr 2023 | 8 Apr 2024 |
| 51 | livingwell.ltd | Mesh Digital Limited | 31 May 2017 | 2 Mar 2025 | 31 May 2025 |
| 52 | livingwell.nl | - | 30 Nov 1998 | 26 Mar 2025 | - |
| 53 | livingwell.agency | Mesh Digital Limited | 1 Apr 2021 | 13 May 2024 | 1 Apr 2024 |
| 54 | livingwell.business | GoDaddy.com, LLC | 29 Sep 2017 | 29 Sep 2017 | 29 Sep 2018 |
| 55 | livingwell.consulting | GoDaddy.com, LLC | 23 Jan 2024 | 2 Aug 2024 | 23 Jan 2026 |
| 56 | livingwell.coach | GoDaddy.com, LLC | 16 Oct 2017 | 10 Oct 2019 | 16 Oct 2020 |
| 57 | livingwell.academy | Google, Inc. | 10 Mar 2023 | 9 May 2024 | 10 Mar 2024 |
| 58 | livingwell.media | GoDaddy.com, LLC | 17 Oct 2023 | 1 Dec 2024 | 17 Oct 2025 |
| 59 | livingwell.uk | - | 22 Dec 2015 | 20 Nov 2024 | 22 Dec 2025 |
| 60 | livingwell.org.uk | - | 21 Feb 2023 | 21 Mar 2025 | 21 Feb 2026 |
| 61 | livingwell.fitness | eNom, Inc. | 12 Feb 2018 | 16 Feb 2025 | 12 Feb 2026 |
| 62 | livingwell.company | GoDaddy.com, LLC | 21 Apr 2018 | 21 Apr 2025 | 21 Apr 2026 |
| 63 | livingwell.properties | NameCheap, Inc. | 11 Feb 2025 | 26 Feb 2025 | 11 Feb 2026 |
| 64 | livingwell.zone | Domain.com, LLC | 12 Jul 2022 | 15 Jul 2023 | 12 Jul 2024 |
| 65 | livingwell.group | 1&1 Internet AG | 5 Nov 2018 | 20 Dec 2024 | 5 Nov 2025 |
| 66 | livingwell.club | GoDaddy.com, LLC | 7 Jul 2020 | 13 Jul 2024 | 7 Jul 2025 |
| 67 | livingwell.direct | NameCheap, Inc. | 25 Feb 2019 | 2 Mar 2019 | 25 Feb 2020 |
| 68 | livingwell.world | GoDaddy.com, LLC | 11 Dec 2023 | 25 Jan 2025 | 11 Dec 2025 |
| 69 | livingwell.foundation | Network Solutions, LLC | 18 Mar 2019 | 23 Jan 2020 | 18 Mar 2021 |
| 70 | livingwell.coffee | Google, Inc. | 6 Jun 2019 | 27 May 2024 | 6 Jun 2025 |
| 71 | livingwell.nyc | eNom, Inc. | 5 Aug 2018 | 7 Aug 2023 | 5 Aug 2027 |
| 72 | livingwell.pro | - | 7 Dec 2024 | 1 Feb 2025 | 7 Dec 2025 |
| 73 | livingwell.financial | NameCheap, Inc. | 8 Nov 2019 | 8 Nov 2019 | 8 Nov 2020 |
| 74 | livingwell.farm | GoDaddy.com, LLC | 26 Nov 2019 | 10 Jan 2025 | 26 Nov 2025 |
| 75 | livingwell.clinic | Tucows Domains Inc. | 11 Feb 2020 | 15 Feb 2022 | 11 Feb 2023 |
| 76 | livingwell.co | GoDaddy.com, LLC | 20 Jul 2010 | 11 Mar 2025 | 19 Jul 2025 |
| 77 | livingwell.net.nz | - | 24 Jun 2014 | 3 Mar 2025 | - |
| 78 | livingwell.one | NameCheap, Inc. | 10 Apr 2020 | 11 Apr 2025 | 10 Apr 2026 |
| 79 | livingwell.realestate | Name Share, Inc. | 7 Mar 2019 | 7 Mar 2023 | 7 Mar 2024 |
| 80 | livingwell.technology | GoDaddy.com, LLC | 1 Feb 2018 | 18 Mar 2025 | 1 Feb 2026 |
| 81 | livingwell.community | GoDaddy.com, LLC | 3 Mar 2017 | 4 Mar 2025 | 3 Mar 2026 |
| 82 | livingwell.house | GoDaddy.com, LLC | 29 Sep 2023 | 13 Nov 2024 | 29 Sep 2025 |
| 83 | livingwell.clothing | GoDaddy.com, LLC | 7 Jul 2020 | 7 Jul 2023 | 7 Jul 2024 |
| 84 | livingwell.kitchen | GoDaddy.com, LLC | 30 Oct 2017 | 14 Dec 2019 | 30 Oct 2020 |
| 85 | livingwell.management | Wild West Domains, LLC | 8 Dec 2020 | 8 Dec 2020 | 8 Dec 2021 |
| 86 | livingwell.global | Epik Inc. | 30 Mar 2023 | 22 Mar 2025 | 30 Mar 2026 |
| 87 | livingwell.gold | Porkbun, LLC | 17 Jan 2021 | 17 Jan 2021 | 17 Jan 2022 |
| 88 | livingwell.ventures | register.com, Inc. | 4 Mar 2021 | 4 Mar 2021 | 4 Mar 2022 |
| 89 | livingwell.travel | NameCheap, Inc. | 16 Mar 2021 | 16 Mar 2021 | 16 Mar 2022 |
| 90 | livingwell.host | Hostinger, UAB | 27 Mar 2024 | 28 Mar 2025 | 27 Mar 2026 |
| 91 | livingwell.digital | Hostinger, UAB | 8 Oct 2021 | 8 Oct 2022 | 8 Oct 2023 |
| 92 | livingwell.be | Realtime Register B.V. | 4 Oct 2021 | - | - |
| 93 | livingwell.fr | - | 12 Mar 2023 | 12 Mar 2025 | 12 Mar 2026 |
| 94 | livingwell.quest | NameCheap, Inc. | 1 Mar 2022 | 18 Mar 2022 | 1 Mar 2024 |
| 95 | livingwell.green | GoDaddy.com, LLC | 12 May 2022 | 23 Jul 2024 | 12 May 2024 |
| 96 | livingwell.cc | Key-Systems GmbH | 5 Oct 2018 | 26 Sep 2024 | 5 Oct 2025 |
| 97 | livingwell.training | Mesh Digital Limited | 1 Apr 2021 | 6 Apr 2025 | 1 Apr 2026 |
| 98 | livingwell.la | eNom, Inc. | 18 Jan 2019 | 3 Jan 2025 | 18 Jan 2026 |
| 99 | livingwell.kr | - | 13 Apr 2007 | 10 Mar 2021 | 13 Apr 2023 |
| 100 | livingwell.me | Wild West Domains, LLC | 18 Jun 2013 | 2 Aug 2024 | 18 Jun 2025 |
| 101 | livingwell.co.nz | - | 8 Aug 2002 | 31 Oct 2022 | - |
| 102 | livingwell.energy | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Sep 2022 | 10 Sep 2022 | 10 Sep 2023 |
| 103 | livingwell.realty | CloudFlare, Inc. | 17 Sep 2022 | 23 Aug 2024 | 17 Sep 2025 |
| 104 | livingwell.org.nz | - | 16 Jul 2018 | 16 Jul 2024 | - |
| 105 | livingwell.us.com | Network Solutions, LLC | 10 Nov 2011 | 12 Nov 2024 | 10 Nov 2025 |
| 106 | livingwell.tools | Google, Inc. | 3 Nov 2022 | 2 Jan 2025 | 3 Nov 2024 |
| 107 | livingwell.app | Porkbun, LLC | 23 Nov 2022 | 9 Jan 2025 | 23 Nov 2025 |
| 108 | livingwell.best | Whois Networks Co., Ltd. | 16 Apr 2022 | 17 Apr 2023 | 16 Apr 2024 |
| 109 | livingwell.blog | GoDaddy.com, LLC | 5 Aug 2022 | 30 Oct 2024 | 5 Aug 2025 |
| 110 | livingwell.co.th | - | 6 Aug 2011 | 2 Jul 2024 | 5 Aug 2025 |
| 111 | livingwell.bio | Name.com, Inc. | 7 Feb 2023 | 21 Mar 2024 | 7 Feb 2024 |
| 112 | livingwell.net.au | - | - | 21 Mar 2024 | - |
| 113 | livingwell.vip | Go Canada Domains, LLC | 30 Mar 2022 | 1 Apr 2023 | 30 Mar 2024 |
| 114 | livingwell.credit | GoDaddy.com, LLC | 12 Apr 2023 | 13 Apr 2025 | 12 Apr 2026 |
| 115 | livingwell.earth | GoDaddy.com, LLC | 8 Apr 2018 | 20 May 2024 | 8 Apr 2024 |
| 116 | livingwell.fun | West263 International Limited | 10 Nov 2024 | 16 Dec 2024 | 10 Nov 2025 |
| 117 | livingwell.homes | GoDaddy.com, LLC | 26 Jul 2019 | 26 Jun 2023 | 26 Jul 2024 |
| 118 | livingwell.it | - | 2 Nov 2021 | 30 Nov 2024 | 14 Nov 2025 |
| 119 | livingwell.co.jp | - | 9 Nov 2004 | 1 Dec 2024 | - |
| 120 | livingwell.com.ng | - | 19 Jul 2023 | 16 Oct 2024 | 19 Jul 2024 |
| 121 | livingwell.pt | - | - | - | - |
| 122 | livingwell.com.au | - | - | 5 Mar 2025 | - |
| 123 | livingwell.ai | - | - | - | - |
| 124 | livingwell.jp | - | 31 Jul 2009 | 1 Aug 2024 | 31 Jul 2025 |
| 125 | livingwell.tours | Tucows Domains Inc. | 13 Mar 2024 | 17 Mar 2025 | 13 Mar 2026 |
| 126 | livingwell.ro | - | 8 Dec 2007 | - | 5 Nov 2028 |
| 127 | livingwell.shop | Wild West Domains, LLC | 26 Sep 2016 | 5 Jun 2024 | 26 Sep 2024 |
| 128 | livingwell.studio | Domain.com, LLC | 27 Apr 2024 | 17 Apr 2025 | 27 Apr 2026 |
| 129 | livingwell.ru | - | 14 Jan 2003 | - | 15 Jan 2026 |
| 130 | livingwell.de | - | - | 24 Jan 2022 | - |
| 131 | livingwell.beauty | Name.com, Inc. | 24 Jul 2024 | 1 Aug 2024 | 24 Jul 2025 |
| 132 | livingwell.ma | - | 9 Oct 2023 | 11 Oct 2024 | 9 Oct 2024 |
| 133 | livingwell.lat | Hostinger, UAB | 2 Dec 2024 | 7 Dec 2024 | 2 Dec 2025 |
| 134 | livingwell.property | NameCheap, Inc. | 11 Feb 2025 | 26 Feb 2025 | 11 Feb 2026 |
| 135 | livingwell.land | Whois Networks Co., Ltd. | 12 Mar 2025 | 12 Mar 2025 | 12 Mar 2027 |
| 136 | livingwellspendingless.com | Tucows Domains Inc. | 11 Sep 2010 | 13 Aug 2024 | 11 Sep 2025 |
| 137 | livingwellisthebestrevengethemovie.com | Network Solutions, LLC | 21 Oct 2014 | 22 Aug 2024 | 21 Oct 2025 |
| 138 | livingwellinfo.com | TurnCommerce, Inc. DBA NameBright.com | 21 Oct 2014 | 15 Oct 2020 | 21 Oct 2025 |
| 139 | livingwellwithlymphedema.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 140 | livingwellgouda.com | Mijn InternetOplossing B.V. | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 141 | livingwellchurch.com | GoDaddy.com, LLC | 4 Feb 2008 | 5 Feb 2025 | 4 Feb 2026 |
| 142 | livingwelladdressed.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2016 |
| 143 | livingwellnlp.com | Wild West Domains, LLC | 24 Aug 2009 | 25 Aug 2024 | 24 Aug 2025 |
| 144 | livingwellservices.biz | Tucows Domains Inc. | 22 Oct 2009 | 25 Oct 2014 | 21 Oct 2014 |
| 145 | livingwellforms.com | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 146 | livingwellgrocers.com | GoDaddy.com, LLC | 27 May 2014 | 28 May 2015 | 27 May 2016 |
| 147 | livingwellwithheartfailure.net | GoDaddy.com, LLC | 31 May 2014 | 31 May 2015 | 31 May 2016 |
| 148 | livingwellwithheartfailure.info | GoDaddy.com, LLC | 31 May 2014 | 31 May 2015 | 31 May 2016 |
| 149 | livingwellwithheartfailure.org | GoDaddy.com, LLC | 31 May 2014 | 12 Jun 2015 | 31 May 2016 |
| 150 | livingwell-healthandhealing.com | GoDaddy.com, LLC | 3 Jun 2012 | 4 Jun 2015 | 3 Jun 2016 |
| 151 | livingwellresources.net | GoDaddy.com, LLC | 22 May 2014 | 23 May 2015 | 22 May 2016 |
| 152 | livingwellaftercancer.com | GoDaddy.com, LLC | 12 Apr 2023 | 23 Mar 2025 | 12 Apr 2026 |
| 153 | livingwellwitheds.com | 1&1 Internet AG | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 154 | livingwelldyingwell.com | Register.it SPA | 29 Oct 2016 | 29 Oct 2024 | 29 Oct 2025 |
| 155 | livingwellwithchronicillness.com | Xiamen Nawang Technology Co., Ltd | 1 Apr 2025 | 1 Apr 2025 | 1 Apr 2026 |
| 156 | livingwellnessforlife.com | GoDaddy.com, LLC | 1 Nov 2012 | 28 Sep 2013 | 1 Nov 2015 |
| 157 | livingwellneveryday.com | GoDaddy.com, LLC | 2 Nov 2012 | 30 Apr 2015 | 2 Nov 2015 |
| 158 | livingwellnesseveryday.com | GoDaddy.com, LLC | 28 Mar 2016 | 28 Mar 2016 | 28 Mar 2019 |
| 159 | livingwellwithleisa.com | eNom, Inc. | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 160 | livingwellsolutions.com | TurnCommerce, Inc. DBA NameBright.com | 16 Jul 2011 | 29 Jun 2023 | 16 Jul 2025 |
| 161 | livingwellness.co | GoDaddy.com, LLC | 13 May 2018 | 30 Jun 2024 | 13 May 2025 |
| 162 | livingwellstudio.com | TurnCommerce, Inc. DBA NameBright.com | 29 Oct 2014 | 11 Jan 2025 | 29 Oct 2024 |
| 163 | livingwellhme.com | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2024 | 30 Oct 2025 |
| 164 | livingwellhd.com | Domain.com, LLC | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 165 | livingwellhme.biz | GoDaddy.com, LLC | 30 Oct 2014 | 5 Nov 2017 | 29 Oct 2018 |
| 166 | livingwelldiets.com | eNom, Inc. | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 167 | livingwellhme.net | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 168 | livingwellmedicalspa.com | GoDaddy.com, LLC | 11 May 2020 | 12 May 2024 | 11 May 2026 |
| 169 | livingwellmendocino.com | 1API GmbH | 24 Sep 2012 | 25 May 2023 | 24 Sep 2025 |
| 170 | livingwellsalina.com | GoDaddy.com, LLC | 29 Jul 2011 | 30 Jul 2024 | 29 Jul 2025 |
| 171 | livingwellhme.org | GoDaddy.com, LLC | 30 Oct 2014 | 31 Oct 2017 | 30 Oct 2018 |
| 172 | livingwellhenderson.us | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 29 Oct 2015 |
| 173 | livingwelltrends.net | eNom, Inc. | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 174 | livingwellmedicalsupplies.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Apr 2010 | 8 Apr 2015 | 29 Apr 2016 |
| 175 | livingwellwithcopd.com | Sibername Internet and Software Technologies Inc. | 12 Dec 2003 | 13 Dec 2024 | 12 Dec 2025 |
| 176 | livingwell-24-7.com | - | - | - | - |
| 177 | livingwellwithmigraine.com | Dynadot, LLC | 18 Jun 2014 | 18 Jun 2017 | 18 Jun 2017 |
| 178 | livingwellnessworld.com | eNom, Inc. | 2 Nov 2014 | 1 Oct 2015 | 2 Nov 2018 |
| 179 | livingwellcontemplativepractices.org | - | - | - | - |
| 180 | livingwellservices.net | 1&1 Internet AG | 3 Nov 2014 | 5 Dec 2017 | 3 Nov 2025 |
| 181 | livingwellservices.info | 1&1 Internet AG | 3 Nov 2014 | 18 Dec 2024 | 3 Nov 2025 |
| 182 | livingwelltrends.com | Above.com Pty Ltd. | 20 Feb 2019 | 28 Jan 2025 | 20 Feb 2026 |
| 183 | livingwellmasso.com | Tucows Domains Inc. | 25 Jan 2009 | 29 Jan 2016 | 25 Jan 2017 |
| 184 | livingwellness.com | Network Solutions, LLC | 27 Jan 1999 | 27 Jan 2025 | 27 Jan 2026 |
| 185 | livingwellmag.com | GoDaddy.com, LLC | 3 Mar 2011 | 4 Mar 2025 | 3 Mar 2026 |
| 186 | livingwellonthecheap.com | GoDaddy.com, LLC | 5 Sep 2020 | 11 Sep 2024 | 5 Sep 2025 |
| 187 | livingwellcenter.net | GoDaddy.com, LLC | 15 Oct 2020 | 15 Oct 2024 | 15 Oct 2026 |
| 188 | livingwelllifesolutions.tv | GoDaddy.com, LLC | 31 Aug 2009 | 7 May 2015 | 31 Aug 2015 |
| 189 | livingwellconsciouslymagazine.com | GoDaddy.com, LLC | 12 Jun 2013 | 13 Jun 2015 | 12 Jun 2016 |
| 190 | livingwellconsciously.com | GoDaddy.com, LLC | 12 Jun 2013 | 13 Jun 2015 | 12 Jun 2016 |
| 191 | livingwellinstudiocity.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 192 | livingwellonthewestside.net | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 193 | livingwellinvenice.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 194 | livingwellinlosangeles.net | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 195 | livingwellonthewestcoast.net | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 196 | livingwellinwesthollywood.net | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 197 | livingwellinveniceca.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 198 | livingwellinsantamonica.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 199 | livingwellinthehollywoodhills.net | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 200 | livingwellinmalibu.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 201 | livingwellnesscenter.net | GoDaddy.com, LLC | 25 Oct 2021 | 25 Oct 2021 | 25 Oct 2022 |
| 202 | livingwellonthewestcoast.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 203 | livingwellinbeverlyhills.net | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 204 | livingwellinwestlosangeles.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 205 | livingwellinthehollywoodhills.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 206 | livingwellinbeverlyhills.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 207 | livingwellinculvercity.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 208 | livingwellinwesthollywood.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 209 | livingwellinthevalley.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 210 | livingwellinlaurelcanyon.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 211 | livingwellinlosangeles.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 212 | livingwellonthewestside.com | GoDaddy.com, LLC | 16 Jun 2013 | 16 Jun 2015 | 16 Jun 2016 |
| 213 | livingwellwithleisa.net | GoDaddy.com, LLC | 16 Jun 2009 | 17 Jun 2015 | 16 Jun 2016 |
| 214 | livingwellwithdanielle.net | GoDaddy.com, LLC | 16 Apr 2020 | 18 Apr 2025 | 16 Apr 2026 |
| 215 | livingwelljourney.com | GoDaddy.com, LLC | 5 Nov 2014 | 6 Nov 2024 | 5 Nov 2034 |
| 216 | livingwellandfree.com | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2016 |
| 217 | livingwellwithlisa.net | GoDaddy.com, LLC | 16 Jun 2009 | 17 Jun 2015 | 16 Jun 2016 |
| 218 | livingwellretail.com | Wild West Domains, LLC | 19 Aug 2014 | 24 Aug 2016 | 19 Aug 2017 |
| 219 | livingwellnutrients.com | register.com, Inc. | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 220 | livingwellinalbany.com | FastDomain Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 221 | livingwellwithkat.com | GoDaddy.com, LLC | 1 Aug 2018 | 1 Aug 2018 | 1 Aug 2020 |
| 222 | livingwellservices.us | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 22 Aug 2015 |
| 223 | livingwellcoaches.com | eNom, Inc. | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 224 | livingwelltrust.com | TurnCommerce, Inc. DBA NameBright.com | 12 Aug 2014 | 6 Aug 2020 | 12 Aug 2025 |
| 225 | livingwellfamilyandchildinstitute.com | Wix.com Ltd. | 14 Mar 2022 | 21 Feb 2025 | 14 Mar 2028 |
| 226 | livingwellspendingless.info | GoDaddy.com, LLC | 13 Aug 2014 | 14 Aug 2017 | 13 Aug 2018 |
| 227 | livingwellspendingless.net | GoDaddy.com, LLC | 13 Aug 2014 | 14 Aug 2016 | 13 Aug 2017 |
| 228 | livingwellspendingless.org | GoDaddy.com, LLC | 13 Aug 2014 | 14 Aug 2017 | 13 Aug 2018 |
| 229 | livingwellwithpain.com | TurnCommerce, Inc. DBA NameBright.com | 4 Jul 2013 | 5 Aug 2024 | 4 Jul 2024 |
| 230 | livingwellinyourtownmagazine.com | GoDaddy.com, LLC | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2015 |
| 231 | livingwellasia.com | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2016 |
| 232 | livingwellht.com | Tucows Domains Inc. | 23 Aug 2011 | 28 Aug 2014 | 23 Aug 2015 |
| 233 | livingwellsprings.com | TurnCommerce, Inc. DBA NameBright.com | 14 Nov 2022 | 8 Nov 2023 | 14 Nov 2025 |
| 234 | livingwellsprings.net | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2023 | 28 Aug 2026 |
| 235 | livingwellatfremonthealth.com | GoDaddy.com, LLC | 15 Aug 2014 | 16 Aug 2024 | 15 Aug 2025 |
| 236 | livingwellfamily.com | Dynadot, LLC | 26 Jul 2023 | 5 Oct 2024 | 26 Jul 2024 |
| 237 | livingwellintensives.com | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 238 | livingwellwater.com | NameCheap, Inc. | 17 Aug 2014 | 18 Jul 2024 | 17 Aug 2025 |
| 239 | livingwellconnections.info | FastDomain Inc. | 10 Nov 2014 | 31 Oct 2024 | 10 Nov 2025 |
| 240 | livingwellhealth.net | GoDaddy.com, LLC | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2017 |
| 241 | livingwellwithclaudia.com | Domain.com, LLC | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 242 | livingwellcookbook.com | GoDaddy.com, LLC | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2016 |
| 243 | livingwellcookbook.us | GoDaddy.com, LLC | 31 Aug 2014 | 31 Aug 2014 | 30 Aug 2016 |
| 244 | livingwellwithkate.com | Namesilo, LLC | 29 Nov 2018 | 30 Nov 2018 | 29 Nov 2019 |
| 245 | livingwellbodyworks.info | GoDaddy.com, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 246 | livingwellapartments.com | DreamHost, LLC | 8 Feb 2018 | 8 Jan 2025 | 8 Feb 2026 |
| 247 | livingwellskin.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 May 2023 | 13 Apr 2025 | 2 May 2026 |
| 248 | livingwellwithlaura.com | GoDaddy.com, LLC | 5 Dec 2018 | 16 Feb 2025 | 5 Dec 2024 |
| 249 | livingwellpersonalfitness.com | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 250 | livingwellretreats.com | GoDaddy.com, LLC | 20 Apr 2019 | 26 Oct 2022 | 20 Apr 2029 |
| 251 | livingwellorganics.us | Wild West Domains, LLC | 24 Aug 2017 | 24 Aug 2017 | 23 Aug 2018 |
| 252 | livingwellretreats.org | GoDaddy.com, LLC | 18 Sep 2014 | 6 Jul 2024 | 18 Sep 2025 |
| 253 | livingwelllivingbetter.com | GoDaddy.com, LLC | 17 Nov 2014 | 18 Nov 2024 | 17 Nov 2025 |
| 254 | livingwellbodyworks.org | GoDaddy.com, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 255 | livingwellprograms.org | GoDaddy.com, LLC | 18 Feb 2016 | 18 Feb 2016 | 18 Feb 2017 |
| 256 | livingwellconcierge.com | Launchpad, Inc. | 8 Sep 2014 | 4 Sep 2016 | 8 Sep 2017 |
| 257 | livingwellwithseven.com | FastDomain Inc. | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 258 | livingwellalbany.com | Annulet LLC | 10 Oct 2013 | 2 Jan 2017 | 10 Oct 2017 |
| 259 | livingwellmyproducts.com | NameCheap, Inc. | 23 Apr 2024 | 24 Apr 2025 | 23 Apr 2026 |
| 260 | livingwellattowneandcountry.com | NameCheap, Inc. | 5 Jul 2024 | 19 Aug 2024 | 5 Jul 2025 |
| 261 | livingwellinlo.com | register.com, Inc. | 9 Sep 2014 | 9 Sep 2024 | 9 Sep 2034 |
| 262 | livingwellyleo.com | DropCatch.com 407 LLC | 20 Dec 2017 | 20 Dec 2017 | 20 Dec 2018 |
| 263 | livingwellinlo.org | register.com, Inc. | 9 Sep 2014 | 14 Sep 2024 | 9 Sep 2034 |
| 264 | livingwellnaturallytv.com | GoDaddy.com, LLC | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2019 |
| 265 | livingwellrealty.biz | GoDaddy.com, LLC | 3 Oct 2014 | 13 Nov 2024 | 2 Oct 2024 |
| 266 | livingwellrealty.info | GoDaddy.com, LLC | 3 Oct 2014 | 14 Dec 2024 | 3 Oct 2024 |
| 267 | livingwellrealty.org | GoDaddy.com, LLC | 3 Oct 2014 | 14 Dec 2024 | 3 Oct 2024 |
| 268 | livingwellrealty.net | GoDaddy.com, LLC | 3 Oct 2014 | 5 Sep 2024 | 3 Oct 2025 |
| 269 | livingwellrealty.us | GoDaddy.com, LLC | 3 Oct 2014 | 8 Oct 2017 | 2 Oct 2019 |
| 270 | livingwelloiled.com | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 271 | livingwelltestimonials.com | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 272 | livingwellalf.com | Network Solutions, LLC | 2 Oct 2014 | 4 Oct 2024 | 2 Oct 2025 |
| 273 | livingwellpanama.com | Google, Inc. | 16 Feb 2018 | 16 Feb 2018 | 16 Feb 2019 |
| 274 | livingwellrealstate.com | Arsys Internet, S.L. dba NICLINE.COM | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 275 | livingwellbodyworks.com | GoDaddy.com, LLC | 4 Mar 2025 | 5 Mar 2025 | 4 Mar 2026 |
| 276 | livingwellatanyage.info | 1&1 Internet AG | 4 Oct 2014 | 4 Oct 2017 | 4 Oct 2018 |
| 277 | livingwellguide.net | Wix.com Ltd. | 3 Nov 2024 | 3 Nov 2024 | 3 Nov 2025 |
| 278 | livingwellstayingwell.com | GoDaddy.com, LLC | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 279 | livingwellgoodtimes.com | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 280 | livingwellgoodtimes.info | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 281 | livingwellwithsararoe.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Nov 2014 | 22 Nov 2014 | 22 Nov 2015 |
| 282 | livingwelloily.com | GoDaddy.com, LLC | 21 Nov 2014 | 2 Feb 2025 | 21 Nov 2024 |
| 283 | livingwellministries.org | GoDaddy.com, LLC | 27 Sep 2014 | 29 Sep 2024 | 27 Sep 2026 |
| 284 | livingwellgoodtimes.org | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 285 | livingwelldme.com | GoDaddy.com, LLC | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2016 |
| 286 | livingwellnessndclinic.com | GoDaddy.com, LLC | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2019 |
| 287 | livingwellfinance.com | NameCheap, Inc. | 3 Mar 2023 | 15 May 2024 | 3 Mar 2024 |
| 288 | livingwellwithdanielle.com | GoDaddy.com, LLC | 9 Jan 2020 | 5 May 2024 | 9 Jan 2026 |
| 289 | livingwellsolutions.info | FastDomain Inc. | 29 Sep 2014 | 29 Sep 2014 | 29 Sep 2015 |
| 290 | livingwellchristianfaithcenter.org | FastDomain Inc. | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 291 | livingwelllifehacks.com | Wild West Domains, LLC | 10 Oct 2014 | 11 Oct 2024 | 10 Oct 2025 |
| 292 | livingwellplan.com | DreamHost, LLC | 2 Aug 2021 | 27 Jul 2024 | 2 Aug 2025 |
| 293 | livingwellsense.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 3 Dec 2024 | 3 Dec 2024 | 3 Dec 2025 |
| 294 | livingwellconnected.com | Tucows Domains Inc. | 24 Jul 2024 | 24 Jul 2024 | 24 Jul 2025 |
| 295 | livingwelloasis.com | TurnCommerce, Inc. DBA NameBright.com | 30 Dec 2018 | 23 Aug 2022 | 30 Dec 2025 |
| 296 | livingwelloasis.info | GoDaddy.com, LLC | 13 Oct 2014 | 14 Oct 2016 | 13 Oct 2018 |
| 297 | livingwelloasis.net | GoDaddy.com, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2016 |
| 298 | livingwelltherapeutic.com | GoDaddy.com, LLC | 23 Jan 2024 | 23 Jan 2024 | 23 Jan 2027 |
| 299 | livingwelleo.com | GoDaddy.com, LLC | 13 Oct 2014 | 22 Jan 2025 | 13 Oct 2034 |
| 300 | livingwellmarkets.com | GoDaddy.com, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2016 |
| 301 | livingwelloasis.org | GoDaddy.com, LLC | 13 Oct 2014 | 14 Oct 2016 | 13 Oct 2018 |
| 302 | livingwellwithyoungliving.com | register.com, Inc. | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 303 | livingwelllifesolution.com | GoDaddy.com, LLC | 20 Oct 2014 | 20 Oct 2014 | 20 Oct 2015 |
| 304 | livingwellgc.com | GoDaddy.com, LLC | 22 Mar 2024 | 22 Mar 2024 | 22 Mar 2029 |
| 305 | livingwellwhenunwell.com | Rebel.com Corp. | 15 Oct 2014 | 31 Aug 2024 | 15 Oct 2025 |
| 306 | livingwellfestival.com | GoDaddy.com, LLC | 20 Oct 2024 | 20 Oct 2024 | 20 Oct 2025 |
| 307 | livingwellcnc.com | GoDaddy.com, LLC | 5 May 2017 | 23 May 2023 | 5 May 2028 |
| 308 | livingwellwomen.com | GoDaddy.com, LLC | 12 Nov 2024 | 12 Nov 2024 | 12 Nov 2025 |
| 309 | livingwellretirement.com | GoDaddy.com, LLC | 31 Aug 2024 | 15 Apr 2025 | 31 Aug 2025 |
| 310 | livingwellblog.com | Hostinger, UAB | 18 Feb 2025 | 18 Feb 2025 | 18 Feb 2026 |
| 311 | livingwellselections.com | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 312 | livingwellhealthandfitness.com | DropCatch.com 595 LLC | 18 Feb 2018 | 18 Feb 2018 | 18 Feb 2019 |
| 313 | livingwellselections.info | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 314 | livingwellnesssolutions.com | Tucows Domains Inc. | 20 Sep 2024 | 27 Sep 2024 | 20 Sep 2025 |
| 315 | livingwellcompanies.com | DropCatch.com 396 LLC | 2 Dec 2014 | 3 Dec 2017 | 2 Dec 2018 |
| 316 | livingwellselections.net | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 317 | livingwellselections.org | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 318 | livingwellwithadisabilityconference.org | GMO Internet Inc. | 3 Dec 2014 | 4 Dec 2014 | 3 Dec 2015 |
| 319 | livingwellyouth.org | Launchpad, Inc. | 6 Dec 2014 | 26 Nov 2024 | 6 Dec 2025 |
| 320 | livingwellc.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 321 | livingwell4you.com | GoDaddy.com, LLC | 16 Nov 2020 | 16 Nov 2024 | 16 Nov 2026 |
| 322 | livingwellcs.com | Google, Inc. | 6 Dec 2023 | 14 Feb 2025 | 6 Dec 2025 |
| 323 | livingwellwithliz.com | Launchpad, Inc. | 24 Aug 2020 | 24 Aug 2020 | 24 Aug 2021 |
| 324 | livingwellsanantonio.com | GoDaddy.com, LLC | 2 Oct 2024 | 2 Oct 2024 | 2 Oct 2025 |
| 325 | livingwellpractice.com | GoDaddy.com, LLC | 18 Dec 2014 | 29 Jan 2025 | 18 Dec 2024 |
| 326 | livingwellinnovations.com | GoDaddy.com, LLC | 19 Dec 2014 | 20 Dec 2024 | 19 Dec 2026 |
| 327 | livingwellbelowmymeans.com | Namesilo, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 328 | livingwellpractice.org | - | 5 Mar 2025 | 5 Mar 2025 | 5 Mar 2026 |
| 329 | livingwellinberks.org | GMO Internet Inc. | 20 Dec 2014 | 16 Dec 2016 | 20 Dec 2017 |
| 330 | livingwellwithdisorders.com | GoDaddy.com, LLC | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2016 |
| 331 | livingwellriverview.com | Tucows Domains Inc. | 28 Dec 2014 | 1 Jan 2016 | 28 Dec 2016 |
| 332 | livingwelltheexperience.com | GoDaddy.com, LLC | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 333 | livingwellrested.com | FastDomain Inc. | 14 Dec 2020 | 28 Nov 2024 | 14 Dec 2025 |
| 334 | livingwellihealth.com | GoDaddy.com, LLC | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 335 | livingwellhealthfitness.com | GoDaddy.com, LLC | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 336 | livingwellchiropracticjuiceplus.com | - | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2017 |
| 337 | livingwellselfhelp.com | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 338 | livingwellicorrectives.com | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 339 | livingwellhendersonville.com | Domain.com, LLC | 5 Jan 2015 | 15 Sep 2015 | 5 Jan 2020 |
| 340 | livingwelleast.com | Domain.com, LLC | 5 Jan 2015 | 15 Sep 2015 | 5 Jan 2020 |
| 341 | livingwell148.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 342 | livingwellness.solutions | NameCheap, Inc. | 31 Oct 2017 | 3 Nov 2019 | 31 Oct 2020 |
| 343 | livingwellportland.rocks | GoDaddy.com, LLC | 7 Aug 2014 | 7 Aug 2014 | 7 Aug 2015 |
| 344 | livingwelldentalgroup.dental | GoDaddy.com, LLC | 15 Aug 2014 | 6 Jan 2017 | 15 Aug 2017 |
| 345 | livingwellness.tips | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 346 | livingwellventures.com | register.com, Inc. | 11 Aug 2015 | 27 Aug 2020 | 11 Aug 2025 |
| 347 | livingwellhealthcarefunding.com | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 348 | livingwellness.today | GoDaddy.com, LLC | 8 Sep 2022 | 23 Oct 2024 | 8 Sep 2026 |
| 349 | livingwellworkingwell.com | GoDaddy.com, LLC | 13 Aug 2015 | 24 Oct 2024 | 13 Aug 2024 |
| 350 | livingwellmagazine.pub | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 351 | livingwellwithadhd.life | GoDaddy.com, LLC | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2016 |
| 352 | livingwellworkingwell.org | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 353 | livingwellptbo.org | Domain.com, LLC | 13 Aug 2015 | 29 Jul 2016 | 13 Aug 2017 |
| 354 | livingwellptbo.net | Domain.com, LLC | 13 Aug 2015 | 31 Jul 2016 | 13 Aug 2017 |
| 355 | livingwellptbo.com | TurnCommerce, Inc. DBA NameBright.com | 2 Nov 2017 | 27 Oct 2020 | 2 Nov 2025 |
| 356 | livingwellptbo.biz | Domain.com, LLC | 13 Aug 2015 | 28 Jul 2016 | 12 Aug 2017 |
| 357 | livingwellmobility.org | Domain.com, LLC | 13 Aug 2015 | 29 Jul 2016 | 13 Aug 2017 |
| 358 | livingwellmobility.net | Domain.com, LLC | 13 Aug 2015 | 29 Jul 2016 | 13 Aug 2017 |
| 359 | livingwellmobility.com | GoDaddy.com, LLC | 13 Aug 2015 | 14 Aug 2024 | 13 Aug 2025 |
| 360 | livingwellmobility.biz | Domain.com, LLC | 13 Aug 2015 | 28 Jul 2016 | 12 Aug 2017 |
| 361 | livingwellexperiment.com | Wild West Domains, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 362 | livingwell360.org | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 363 | livingwellwithlucy.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 364 | livingwelltravel.com | NameCheap, Inc. | 5 Jan 2015 | 6 Dec 2024 | 5 Jan 2026 |
| 365 | livingwell1.com | NameCheap, Inc. | 3 Mar 2025 | 3 Mar 2025 | 3 Mar 2026 |
| 366 | livingwelltools.com | CommuniGal Communication Ltd. | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 367 | livingwelltubs.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 368 | livingwellhappyandhealthy.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 369 | livingwellnesstowson.com | GoDaddy.com, LLC | 11 Jan 2015 | 11 Jan 2015 | 11 Jan 2017 |
| 370 | livingwellhq.com | eNom, Inc. | 6 Aug 2023 | 5 Jul 2024 | 6 Aug 2025 |
| 371 | livingwellpma.com | Launchpad, Inc. | 17 Jan 2015 | 2 Jan 2019 | 17 Jan 2020 |
| 372 | livingwellresources.club | Crazy Domains FZ-LLC | 12 Jul 2015 | 11 Jul 2017 | 11 Jul 2017 |
| 373 | livingwellwitht.info | GoDaddy.com, LLC | 16 Jan 2015 | - | 16 Jan 2016 |
| 374 | livingwellwitht.org | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 375 | livingwellwitht.net | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 376 | livingwelllovingchrist.com | GoDaddy.com, LLC | 18 Jan 2015 | 18 Jan 2015 | 18 Jan 2016 |
| 377 | livingwellfarm.com | GoDaddy.com, LLC | 9 May 2018 | 2 Sep 2024 | 9 May 2025 |
| 378 | livingwelllovingchrist.org | GoDaddy.com, LLC | 18 Jan 2015 | 19 Jan 2017 | 18 Jan 2018 |
| 379 | livingwelllovingchrist.net | GoDaddy.com, LLC | 18 Jan 2015 | 18 Jan 2015 | 18 Jan 2016 |
| 380 | livingwellwithvisualimpairment.com | 1&1 Internet AG | 20 Jan 2015 | 14 Mar 2018 | 20 Jan 2026 |
| 381 | livingwelldetroit.com | GoDaddy.com, LLC | 21 Jan 2015 | 4 Mar 2025 | 21 Jan 2025 |
| 382 | livingwellcorporation.com | GoDaddy.com, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 383 | livingwell2015.com | Tucows Domains Inc. | 22 Jan 2015 | 26 Jan 2016 | 22 Jan 2017 |
| 384 | livingwellwithluanne.com | GoDaddy.com, LLC | 25 Jan 2015 | 25 Jan 2015 | 25 Jan 2017 |
| 385 | livingwellhealingwell.com | Go Canada Domains, LLC | 14 Apr 2018 | 27 Oct 2024 | 26 Oct 2025 |
| 386 | livingwellfeelingwell.com | Go Canada Domains, LLC | 14 Apr 2018 | 27 Oct 2024 | 26 Oct 2025 |
| 387 | livingwellecig.com | Tucows Domains Inc. | 23 Jan 2013 | 27 Jan 2015 | 23 Jan 2016 |
| 388 | livingwellatotsuka.com | CSC Corporate Domains, Inc. | 26 Jan 2015 | 3 Mar 2024 | 26 Jan 2026 |
| 389 | livingwellnutritionalcleansing.com | GoDaddy.com, LLC | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 390 | livingwelladultdaycareri.com | GoDaddy.com, LLC | 28 Jan 2015 | 10 Apr 2025 | 28 Jan 2025 |
| 391 | livingwellifitness.com | GoDaddy.com, LLC | 29 May 2019 | 29 May 2019 | 29 May 2020 |
| 392 | livingwellfitness.com | TurnCommerce, Inc. DBA NameBright.com | 19 Apr 2017 | 13 Apr 2021 | 19 Apr 2025 |
| 393 | livingwell-solutions.com | GoDaddy.com, LLC | 21 Jul 2023 | 22 Jul 2024 | 21 Jul 2025 |
| 394 | livingwellwithdrmike.com | GoDaddy.com, LLC | 31 Jan 2015 | 31 Jan 2024 | 31 Jan 2027 |
| 395 | livingwellbenefitsstore.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 396 | livingwellmyway.org | GoDaddy.com, LLC | 19 Aug 2015 | 19 Oct 2015 | 19 Aug 2017 |
| 397 | livingwellmyway.net | GoDaddy.com, LLC | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2017 |
| 398 | livingwellmyway.info | GoDaddy.com, LLC | 19 Aug 2015 | 18 Oct 2015 | 19 Aug 2017 |
| 399 | livingwellhub.com | GoDaddy.com, LLC | 17 Nov 2021 | 18 Nov 2023 | 17 Nov 2025 |
| 400 | livingwellhc.com | Tucows Domains Inc. | 3 Feb 2015 | 20 Jan 2025 | 3 Feb 2026 |
| 401 | livingwellmagazines.com | GoDaddy.com, LLC | 6 Dec 2016 | 6 Dec 2024 | 6 Dec 2025 |
| 402 | livingwellmagazine.us | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 3 Feb 2016 |
| 403 | livingwellinstitute.us | GoDaddy.com, LLC | 5 Feb 2015 | 5 Feb 2015 | 4 Feb 2016 |
| 404 | livingwellinstitute.net | GoDaddy.com, LLC | 18 Jul 2017 | 19 Jul 2023 | 18 Jul 2025 |
| 405 | livingwellinstitute.info | GoDaddy.com, LLC | 5 Feb 2015 | - | 5 Feb 2016 |
| 406 | livingwellwithjoce.com | GMO Internet Inc. | 2 May 2016 | 9 May 2017 | 2 May 2018 |
| 407 | livingwellfulltime.com | GoDaddy.com, LLC | 9 Feb 2015 | 21 Feb 2025 | 9 Feb 2026 |
| 408 | livingwellepresentshowtowriteascreenplay.com | GoDaddy.com, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 409 | livingwellwithsabine.com | Tucows Domains Inc. | 8 Feb 2011 | 12 Feb 2015 | 8 Feb 2016 |
| 410 | livingwellwithlh.com | GoDaddy.com, LLC | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 411 | livingwellessex.com | 1&1 Internet AG | 12 Feb 2015 | 13 Feb 2017 | 12 Feb 2018 |
| 412 | livingwellapostolicchurch.com | GoDaddy.com, LLC | 9 Nov 2016 | 10 Nov 2024 | 9 Nov 2026 |
| 413 | livingwellwithintention.com | Wild West Domains, LLC | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 414 | livingwellessex.org | Namesilo, LLC | 12 Feb 2015 | 29 Mar 2025 | 12 Feb 2026 |
| 415 | livingwellbainbridge.net | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 416 | livingwellplayers.com | GoDaddy.com, LLC | 15 Feb 2015 | 15 Feb 2015 | 15 Feb 2016 |
| 417 | livingwellenterprises.info | GoDaddy.com, LLC | 14 Feb 2015 | - | 14 Feb 2016 |
| 418 | livingwelldental.org | Gabia, Inc. | 13 Aug 2010 | 12 Aug 2017 | 13 Aug 2018 |
| 419 | livingwellplayers.org | GoDaddy.com, LLC | 15 Feb 2015 | 15 Feb 2015 | 15 Feb 2016 |
| 420 | livingwellglobal.net | Synergy Wholesale Pty Ltd | 27 Apr 2021 | 27 Apr 2021 | 27 Apr 2022 |
| 421 | livingwellness.biz | GoDaddy.com, LLC | 29 Aug 2021 | 4 Sep 2024 | 29 Aug 2025 |
| 422 | livingwellmindfulness.com | Tucows Domains Inc. | 7 Sep 2024 | 16 Oct 2024 | 7 Sep 2025 |
| 423 | livingwell-ourplan.org | Mesh Digital Limited | 18 Feb 2015 | 15 Feb 2016 | 18 Feb 2018 |
| 424 | livingwellmindfulness.org | Mesh Digital Limited | 19 Feb 2015 | 12 Feb 2017 | 19 Feb 2019 |
| 425 | livingwellisrael.com | GoDaddy.com, LLC | 21 Feb 2015 | 21 Feb 2015 | 21 Feb 2016 |
| 426 | livingwellassociates.org | GoDaddy.com, LLC | 20 Feb 2015 | 21 Feb 2017 | 20 Feb 2018 |
| 427 | livingwellassociates.info | GoDaddy.com, LLC | 20 Feb 2015 | - | 20 Feb 2016 |
| 428 | livingwellwithdorothy.com | Key-Systems GmbH | 12 May 2016 | 12 May 2016 | 12 May 2017 |
| 429 | livingwellwithmelissa.com | GoDaddy.com, LLC | 23 Aug 2015 | 23 Aug 2015 | 23 Aug 2016 |
| 430 | livingwelltherapies.us | NameKing.com Inc. | 2 Sep 2024 | 15 Jan 2025 | 2 Sep 2025 |
| 431 | livingwellwithcfs.com | eNom, Inc. | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 432 | livingwellfortomorrow.com | Tucows Domains Inc. | 28 Aug 2017 | 1 Sep 2019 | 28 Aug 2019 |
| 433 | livingwellyouthandfitness.com | GoDaddy.com, LLC | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2016 |
| 434 | livingwellguides.com | GoDaddy.com, LLC | 9 Aug 2021 | 10 Aug 2024 | 9 Aug 2025 |
| 435 | livingwellabc.com | GoDaddy.com, LLC | 26 Feb 2015 | 27 Feb 2025 | 26 Feb 2035 |
| 436 | livingwellwithpulmonaryfibrosis.com | Sibername Internet and Software Technologies Inc. | 26 Feb 2015 | 13 Jan 2025 | 26 Feb 2026 |
| 437 | livingwellinthesouth.com | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 438 | livingwellatx.com | Tucows Domains Inc. | 27 Feb 2015 | 3 Mar 2017 | 27 Feb 2017 |
| 439 | livingwellabc.org | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 440 | livingwellabc.net | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 441 | livingwellwithpulmonaryfibrosis.org | GoDaddy.com, LLC | 26 Feb 2015 | 27 Feb 2017 | 26 Feb 2018 |
| 442 | livingwellwithpulmonaryfibrosis.net | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 443 | livingwellwithpulmonaryfibrosis.info | GoDaddy.com, LLC | 26 Feb 2015 | 27 Feb 2017 | 26 Feb 2018 |
| 444 | livingwelllouisiana.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 445 | livingwellwithpets.com | 1&1 Internet AG | 2 Dec 2016 | 2 Dec 2016 | 2 Dec 2018 |
| 446 | livingwellwithmelissa.us | GoDaddy.com, LLC | 23 Aug 2015 | 23 Aug 2015 | 22 Aug 2016 |
| 447 | livingwellaftercoloncancer.com | Launchpad, Inc. | 6 Mar 2015 | 19 Feb 2017 | 6 Mar 2018 |
| 448 | livingwellbain.com | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 449 | livingwellbain.net | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 450 | livingwellwithsonia.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 451 | livingwellorganics.com | TurnCommerce, Inc. DBA NameBright.com | 25 May 2017 | 20 May 2020 | 25 May 2025 |
| 452 | livingwellingtonfl.com | GoDaddy.com, LLC | 8 Mar 2015 | 8 Mar 2015 | 8 Mar 2016 |
| 453 | livingwellwithscd.com | GoDaddy.com, LLC | 17 Jan 2017 | 17 Jan 2017 | 17 Jan 2018 |
| 454 | livingwelldone.com | GoDaddy.com, LLC | 4 Jan 2021 | 4 Jan 2021 | 4 Jan 2023 |
| 455 | livingwellspasaratoga.com | Wild West Domains, LLC | 14 Nov 2020 | 14 Nov 2020 | 14 Nov 2021 |
| 456 | livingwellrd.com | Squarespace Domains LLC | 1 Mar 2024 | 14 Feb 2025 | 1 Mar 2026 |
| 457 | livingwellpond.com | GoDaddy.com, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 458 | livingwell-online.com | NetEarth One Inc. d/b/a NetEarth | 8 Feb 2025 | 10 Apr 2025 | 8 Feb 2026 |
| 459 | livingwelltea.com | GoDaddy.com, LLC | 21 Mar 2022 | 27 Mar 2025 | 21 Mar 2026 |
| 460 | livingwellwithparkinsons.org | GoDaddy.com, LLC | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2017 |
| 461 | livingwellwithnicole.com | Wix.com Ltd. | 28 Feb 2024 | 28 Feb 2024 | 28 Feb 2026 |
| 462 | livingwell2agewell.com | GoDaddy.com, LLC | 25 Aug 2015 | 28 Aug 2023 | 25 Aug 2025 |
| 463 | livingwelllasvegas.com | GoDaddy.com, LLC | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 464 | livingwellwithleanne.com | GoDaddy.com, LLC | 19 Mar 2015 | 19 Mar 2015 | 19 Mar 2016 |
| 465 | livingwell-og.com | GoDaddy.com, LLC | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 466 | livingwellah.org | GoDaddy.com, LLC | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 467 | livingwellnutritionandhealthcoaching.com | GoDaddy.com, LLC | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2018 |
| 468 | livingwellfinishingwell.com | Network Solutions, LLC | 22 Mar 2015 | 6 Mar 2020 | 22 Mar 2026 |
| 469 | livingwellorganic.org | GoDaddy.com, LLC | 21 Mar 2015 | 21 Mar 2015 | 21 Mar 2016 |
| 470 | livingwellorganic.net | GoDaddy.com, LLC | 21 Mar 2015 | 21 Mar 2015 | 21 Mar 2016 |
| 471 | livingwellinsandiego.com | GoDaddy.com, LLC | 9 Mar 2022 | 10 Mar 2025 | 9 Mar 2026 |
| 472 | livingwellfinishingwell.org | Domain.com, LLC | 22 Mar 2015 | - | 22 Mar 2016 |
| 473 | livingwellat50.com | FastDomain Inc. | 30 Mar 2015 | 30 Mar 2015 | 30 Mar 2016 |
| 474 | livingwelldna.com | DropCatch.com 569 LLC | 26 Mar 2015 | 27 Mar 2017 | 26 Mar 2018 |
| 475 | livingwellrecoveryhouse.com | GoDaddy.com, LLC | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 476 | livingwell-coach.com | FastDomain Inc. | 30 Mar 2015 | 30 Mar 2015 | 30 Mar 2016 |
| 477 | livingwellrecoveryhouse.org | GoDaddy.com, LLC | 28 Mar 2015 | 9 Apr 2017 | 28 Mar 2018 |
| 478 | livingwellrecoveryhouse.net | GoDaddy.com, LLC | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 479 | livingwellrecoveryhouse.info | GoDaddy.com, LLC | 28 Mar 2015 | - | 28 Mar 2016 |
| 480 | livingwellatanyage.com | GoDaddy.com, LLC | 16 Nov 2020 | 28 Nov 2024 | 16 Nov 2025 |
| 481 | livingwellwithmichelle.info | Launchpad, Inc. | 30 Mar 2015 | 30 Mar 2015 | 30 Mar 2016 |
| 482 | livingwellwithhashimotos.com | Google, Inc. | 1 Apr 2015 | 9 Apr 2024 | 1 Apr 2030 |
| 483 | livingwellunlimited.com | GoDaddy.com, LLC | 9 Jun 2021 | 9 Jun 2021 | 9 Jun 2022 |
| 484 | livingwellwithadhd.org | GoDaddy.com, LLC | 3 Apr 2015 | 9 Apr 2025 | 3 Apr 2026 |
| 485 | livingwellretreatday.com | FastDomain Inc. | 16 Feb 2013 | 5 Apr 2015 | 16 Feb 2016 |
| 486 | livingwell4less.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Sep 2016 | 12 Nov 2016 | 12 Sep 2018 |
| 487 | livingwell-books.com | Tucows Domains Inc. | 2 Apr 2010 | 6 Apr 2015 | 2 Apr 2016 |
| 488 | livingwellproperties.com | TurnCommerce, Inc. DBA NameBright.com | 25 Jun 2017 | 19 Jun 2020 | 25 Jun 2025 |
| 489 | livingwellnessshop.com | GoDaddy.com, LLC | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 490 | livingwellnazarene.com | GoDaddy.com, LLC | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2016 |
| 491 | livingwellathome.us | - | 9 Aug 2010 | 28 Mar 2017 | 8 Aug 2018 |
| 492 | livingwellcampbellriver.com | GoDaddy.com, LLC | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2016 |
| 493 | livingwellspanc.com | GoDaddy.com, LLC | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2016 |
| 494 | livingwellindia.com | GoDaddy.com, LLC | 24 Mar 2008 | 24 Mar 2025 | 24 Mar 2026 |
| 495 | livingwellfreedom.net | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 496 | livingwellwithlupusfellowship.com | Tucows Domains Inc. | 10 Apr 2014 | 14 Apr 2015 | 10 Apr 2016 |
| 497 | livingwelluniversity.com | GoDaddy.com, LLC | 26 Jun 2017 | 27 Jun 2024 | 26 Jun 2025 |
| 498 | livingwelloutlet.com | Tucows Domains Inc. | 10 Apr 2010 | 14 Apr 2015 | 10 Apr 2016 |
| 499 | livingwellnotdyingearly.com | FastDomain Inc. | 5 Sep 2015 | 5 Sep 2015 | 5 Sep 2016 |
| 500 | livingwellonthego.com | register.com, Inc. | 14 Jun 2017 | 14 Jun 2017 | 14 Jun 2018 |
| 501 | livingwellberlin.com | GoDaddy.com, LLC | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 502 | livingwellbusiness.info | GoDaddy.com, LLC | 6 Sep 2015 | - | 6 Sep 2016 |
| 503 | livingwellwithdechantell.com | Wild West Domains, LLC | 18 Apr 2015 | 22 Apr 2025 | 18 Apr 2026 |
| 504 | livingwellberlin.org | GoDaddy.com, LLC | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 505 | livingwellberlin.net | GoDaddy.com, LLC | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 506 | livingwellberlin.info | GoDaddy.com, LLC | 16 Apr 2015 | - | 16 Apr 2016 |
| 507 | livingwellwithshell.com | GoDaddy.com, LLC | 9 Sep 2019 | 10 Sep 2024 | 9 Sep 2025 |
| 508 | livingwellandpaleo.com | GoDaddy.com, LLC | 22 Apr 2015 | 22 Apr 2015 | 22 Apr 2016 |
| 509 | livingwellandorganized.com | FastDomain Inc. | 22 Apr 2015 | 22 Apr 2015 | 22 Apr 2016 |
| 510 | livingwellinc.org | GoDaddy.com, LLC | 4 May 2022 | 17 Aug 2024 | 4 May 2025 |
| 511 | livingwellmom.com | Namesilo, LLC | 24 Apr 2015 | 12 Apr 2025 | 24 Apr 2026 |
| 512 | livingwellyourway.org | 1&1 Internet AG | 7 Sep 2015 | 8 Sep 2016 | 7 Sep 2017 |
| 513 | livingwellyourway.net | 1&1 Internet AG | 7 Sep 2015 | 8 Sep 2016 | 7 Sep 2017 |
| 514 | livingwellyourway.com | Hosting Concepts B.V. dba Openprovider | 27 Nov 2020 | 27 Nov 2020 | 27 Nov 2021 |
| 515 | livingwellwithsam.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2016 |
| 516 | livingwellsacramento.com | GoDaddy.com, LLC | 24 Apr 2023 | 24 Apr 2023 | 24 Apr 2024 |
| 517 | livingwellbalancedlife.com | GoDaddy.com, LLC | 27 Apr 2015 | 18 Sep 2022 | 27 Apr 2025 |
| 518 | livingwellwithmaryell.com | Wild West Domains, LLC | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2016 |
| 519 | livingwellpropertiesinc.com | Tucows Domains Inc. | 24 Apr 2013 | 28 Apr 2015 | 24 Apr 2016 |
| 520 | livingwellwithleeroy.com | GoDaddy.com, LLC | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 521 | livingwellny.com | GoDaddy.com, LLC | 20 Jun 2019 | 20 Jun 2019 | 20 Jun 2020 |
| 522 | livingwellla.com | Google, Inc. | 29 Sep 2022 | 14 Sep 2024 | 29 Sep 2025 |
| 523 | livingwellchi.com | GoDaddy.com, LLC | 20 Jun 2019 | 20 Jun 2019 | 20 Jun 2020 |
| 524 | livingwellswaterministry.org | GoDaddy.com, LLC | 13 Oct 2016 | 14 Oct 2017 | 13 Oct 2018 |
| 525 | livingwellwholefoodsandmore.com | register.com, Inc. | 9 Sep 2015 | 1 Oct 2016 | 9 Sep 2018 |
| 526 | livingwell-agingwell.com | Tucows Domains Inc. | 30 Apr 2015 | 4 May 2017 | 30 Apr 2017 |
| 527 | livingwellinc.net | GoDaddy.com, LLC | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2016 |
| 528 | livingwelltip.com | GoDaddy.com, LLC | 29 Dec 2023 | 2 Jan 2025 | 29 Dec 2025 |
| 529 | livingwellisthebestrevenge.info | GoDaddy.com, LLC | 4 May 2015 | - | 4 May 2016 |
| 530 | livingwellwithoils.com | GoDaddy.com, LLC | 24 Aug 2020 | 24 Aug 2020 | 24 Aug 2021 |
| 531 | livingwellcarehome.com | GoDaddy.com, LLC | 6 May 2015 | 6 May 2015 | 6 May 2016 |
| 532 | livingwellstuff.com | Tucows Domains Inc. | 4 May 2012 | 8 May 2015 | 4 May 2016 |
| 533 | livingwelllab.com | Gandi SAS | 26 Dec 2018 | 25 Nov 2024 | 26 Dec 2025 |
| 534 | livingwellpdx.org | Wild West Domains, LLC | 6 May 2015 | 5 May 2017 | 6 May 2019 |
| 535 | livingwellassociation.com | GoDaddy.com, LLC | 8 May 2015 | 20 Jul 2024 | 8 May 2024 |
| 536 | livingwellhealthcare.biz | NameCheap, Inc. | 9 May 2015 | 14 Nov 2016 | 8 May 2017 |
| 537 | livingwellassociation.org | GoDaddy.com, LLC | 8 May 2015 | 19 Jun 2024 | 8 May 2024 |
| 538 | livingwellassociation.net | GoDaddy.com, LLC | 8 May 2015 | 20 Jul 2024 | 8 May 2024 |
| 539 | livingwellassociation.info | GoDaddy.com, LLC | 8 May 2015 | 19 Jun 2024 | 8 May 2024 |
| 540 | livingwellnesswisdom.com | GoDaddy.com, LLC | 25 Mar 2021 | 25 Mar 2025 | 25 Mar 2027 |
| 541 | livingwellnesstoday.com | Domain.com, LLC | 23 May 2019 | 23 May 2019 | 23 May 2020 |
| 542 | livingwellcommunityprograms.com | Tucows Domains Inc. | 9 May 2015 | 9 May 2015 | 9 May 2017 |
| 543 | livingwelllifesolutions.com | EastEndDomains, LLC | 11 May 2015 | 11 May 2015 | 11 May 2016 |
| 544 | livingwellsfarm.com | GoDaddy.com, LLC | 13 May 2015 | 21 May 2024 | 13 May 2026 |
| 545 | livingwellforsuccess.net | NameCheap, Inc. | 18 Apr 2021 | 30 Jun 2024 | 18 Apr 2024 |
| 546 | livingwellsfarm.info | GoDaddy.com, LLC | 13 May 2015 | 9 Jul 2024 | 13 May 2026 |
| 547 | livingwellsfarm.org | GoDaddy.com, LLC | 13 May 2015 | 9 Jul 2024 | 13 May 2026 |
| 548 | livingwellsfarm.net | GoDaddy.com, LLC | 13 May 2015 | 21 May 2024 | 13 May 2026 |
| 549 | livingwellandsuccessful.com | Launchpad, Inc. | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 550 | livingwellmgt.com | GoDaddy.com, LLC | 5 Dec 2019 | 5 Dec 2019 | 5 Dec 2020 |
| 551 | livingwellllc.com | GoDaddy.com, LLC | 7 Sep 2020 | 8 Sep 2024 | 7 Sep 2025 |
| 552 | livingwelladvisors.com | Tucows Domains Inc. | 15 Jun 2019 | 1 Jun 2024 | 15 Jun 2025 |
| 553 | livingwellwithmarielle.com | GoDaddy.com, LLC | 12 Sep 2015 | 13 Sep 2023 | 12 Sep 2025 |
| 554 | livingwellpast50.com | West263 International Limited | 17 Dec 2020 | 17 Dec 2020 | 17 Dec 2021 |
| 555 | livingwellndh.com | GoDaddy.com, LLC | 21 May 2015 | 14 May 2024 | 21 May 2025 |
| 556 | livingwellbeyond50.com | GoDaddy.com, LLC | 8 Aug 2020 | 9 Aug 2024 | 8 Aug 2025 |
| 557 | livingwelllivingstrong.com | GoDaddy.com, LLC | 22 May 2015 | 22 May 2015 | 22 May 2016 |
| 558 | livingwellandsuccessful2.com | GoDaddy.com, LLC | 23 May 2015 | 23 May 2015 | 23 May 2016 |
| 559 | livingwellwithisabel.com | GoDaddy.com, LLC | 25 May 2015 | 25 May 2015 | 25 May 2016 |
| 560 | livingwellandsuccessful4.com | GoDaddy.com, LLC | 25 May 2015 | 25 May 2015 | 25 May 2016 |
| 561 | livingwell2.com | NameCheap, Inc. | 27 Jul 2021 | - | 27 Jul 2022 |
| 562 | livingwellandsuccessful3.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 563 | livingwellpsych.com | Squarespace Domains LLC | 19 Mar 2025 | 19 Mar 2025 | 19 Mar 2026 |
| 564 | livingwellnessmedicalcenters.com | GoDaddy.com, LLC | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 565 | livingwellnessmedical.com | GoDaddy.com, LLC | 21 Feb 2020 | 21 Feb 2020 | 21 Feb 2021 |
| 566 | livingwellnessmed.com | GoDaddy.com, LLC | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 567 | livingwellnessmedicalcenters.info | GoDaddy.com, LLC | 28 May 2015 | 9 Jul 2017 | 28 May 2018 |
| 568 | livingwellnessmedical.info | GoDaddy.com, LLC | 28 May 2015 | 9 Jul 2017 | 28 May 2018 |
| 569 | livingwellspendless.com | GoDaddy.com, LLC | 2 Jul 2020 | 2 Jul 2020 | 2 Jul 2021 |
| 570 | livingwellnessmedicalcenters.org | GoDaddy.com, LLC | 28 May 2015 | 29 May 2015 | 28 May 2016 |
| 571 | livingwellnessmedicalcenters.net | GoDaddy.com, LLC | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 572 | livingwellnessmedical.org | GoDaddy.com, LLC | 28 May 2015 | 29 May 2015 | 28 May 2016 |
| 573 | livingwellnessmedical.net | GoDaddy.com, LLC | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 574 | livingwellmassage.biz | GoDaddy.com, LLC | 1 Jun 2015 | 1 Jun 2017 | 31 May 2018 |
| 575 | livingwellaby.com | GoDaddy.com, LLC | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2017 |
| 576 | livingwellathomebusiness.com | Wild West Domains, LLC | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2017 |
| 577 | livingwellmassage.org | GoDaddy.com, LLC | 1 Jun 2015 | 16 Jul 2024 | 1 Jun 2025 |
| 578 | livingwellmassage.net | GoDaddy.com, LLC | 1 Jun 2015 | 2 Jun 2024 | 1 Jun 2025 |
| 579 | livingwellmassage.info | GoDaddy.com, LLC | 1 Jun 2015 | 2 Jun 2017 | 1 Jun 2018 |
| 580 | livingwellnesskc.com | Dynadot, LLC | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 581 | livingwellwithsmallfiberneuropathy.com | Wild West Domains, LLC | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 582 | livingwellathomebusiness.biz | Wild West Domains, LLC | 4 Jun 2015 | 4 Jun 2015 | 3 Jun 2016 |
| 583 | livingwellathomebusiness.net | Wild West Domains, LLC | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 584 | livingwellcrestone.us | GoDaddy.com, LLC | 28 Feb 2017 | 7 Mar 2017 | 27 Feb 2018 |
| 585 | livingwelltotally.com | GoDaddy.com, LLC | 6 Jun 2015 | 6 Jun 2015 | 6 Jun 2016 |
| 586 | livingwellinsanmateo.com | GoDaddy.com, LLC | 30 Aug 2019 | 30 Aug 2019 | 30 Aug 2020 |
| 587 | livingwellbeingswell.com | eNom, Inc. | 9 Jun 2015 | 12 Jun 2017 | 9 Jun 2017 |
| 588 | livingwellohio.com | GoDaddy.com, LLC | 18 Aug 2020 | 19 Aug 2024 | 18 Aug 2026 |
| 589 | livingwellmedicalclinic.com | Hostinger, UAB | 18 Sep 2015 | 25 Aug 2024 | 18 Sep 2025 |
| 590 | livingwellmedicalclinic.clinic | Namesilo, LLC | 18 Sep 2015 | 12 Sep 2024 | 18 Sep 2025 |
| 591 | livingwellbox.com | GoDaddy.com, LLC | 10 Jun 2015 | 10 Jun 2015 | 10 Jun 2017 |
| 592 | livingwellwithlena.com | GoDaddy.com, LLC | 11 Jun 2015 | 12 Jun 2015 | 11 Jun 2016 |
| 593 | livingwellbox.us | GoDaddy.com, LLC | 10 Jun 2015 | 10 Jun 2017 | 9 Jun 2019 |
| 594 | livingwellbox.org | GoDaddy.com, LLC | 10 Jun 2015 | 11 Jun 2017 | 10 Jun 2019 |
| 595 | livingwellbox.net | GoDaddy.com, LLC | 10 Jun 2015 | 10 Jun 2015 | 10 Jun 2017 |
| 596 | livingwellbox.info | GoDaddy.com, LLC | 10 Jun 2015 | 11 Jun 2017 | 10 Jun 2019 |
| 597 | livingwellwithdementia.com | GoDaddy.com, LLC | 12 Jun 2015 | 17 Feb 2025 | 12 Jun 2025 |
| 598 | livingwellreport.com | GoDaddy.com, LLC | 17 Oct 2022 | 29 Dec 2024 | 17 Oct 2024 |
| 599 | livingwellmedicalclinic.org | Hostinger, UAB | 18 Sep 2015 | 29 Aug 2024 | 18 Sep 2025 |
| 600 | livingwellwithiris.com | GoDaddy.com, LLC | 29 Sep 2018 | 30 Sep 2024 | 29 Sep 2026 |
| 601 | livingwellwithnancyl.com | GoDaddy.com, LLC | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 602 | livingwellabundantly.com | GoDaddy.com, LLC | 9 Apr 2022 | 9 Apr 2025 | 9 Apr 2026 |
| 603 | livingwellwithmitchell.com | eNom, Inc. | 17 Jun 2015 | 17 Jun 2015 | 17 Jun 2016 |
| 604 | livingwellandprosperous.com | GoDaddy.com, LLC | 20 Sep 2015 | 20 Sep 2015 | 20 Sep 2016 |
| 605 | livingwellwithboyce.com | eNom, Inc. | 18 Jun 2015 | 18 Jun 2015 | 18 Jun 2016 |
| 606 | livingwellmb.com | Network Solutions, LLC | 19 Jun 2015 | 9 Jun 2024 | 19 Jun 2027 |
| 607 | livingwell2day.com | GoDaddy.com, LLC | 5 Mar 2018 | 6 Mar 2024 | 5 Mar 2026 |
| 608 | livingwellwpendingless.com | GoDaddy.com, LLC | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 609 | livingwelltherapypractice.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Sep 2015 | 20 Sep 2016 | 20 Sep 2017 |
| 610 | livingwellcard.com | DreamHost, LLC | 21 Sep 2015 | 21 Sep 2015 | 21 Sep 2016 |
| 611 | livingwellwithhypermobility.com | 1&1 Internet AG | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2016 |
| 612 | livingwellover40.com | GoDaddy.com, LLC | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2017 |
| 613 | livingwellover40.net | GoDaddy.com, LLC | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2017 |
| 614 | livingwellover40.info | GoDaddy.com, LLC | 22 Jun 2015 | 4 Jul 2017 | 22 Jun 2018 |
| 615 | livingwellover40.org | GoDaddy.com, LLC | 22 Jun 2015 | 4 Jul 2017 | 22 Jun 2018 |
| 616 | livingwellwithchronicillness.org | GoDaddy.com, LLC | 23 Jan 2024 | 6 Mar 2025 | 23 Jan 2025 |
| 617 | livingwellwithchronicillness.net | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2017 |
| 618 | livingwellwithbecca.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 26 Jun 2015 | 26 Jun 2015 | 26 Jun 2016 |
| 619 | livingwellwithmypets.com | FastDomain Inc. | 29 Jun 2015 | 29 Jun 2017 | 29 Jun 2018 |
| 620 | livingwellinhouston.com | Tucows Domains Inc. | 29 Jun 2015 | 31 May 2017 | 29 Jun 2018 |
| 621 | livingwellsphotography.com | GoDaddy.com, LLC | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2016 |
| 622 | livingwellme.com | GoDaddy.com, LLC | 2 Aug 2019 | 2 Aug 2019 | 2 Aug 2021 |
| 623 | livingwelldalllas.com | Tucows Domains Inc. | 17 Apr 2016 | 21 Apr 2019 | 17 Apr 2019 |
| 624 | livingwellandbeautifully.com | GoDaddy.com, LLC | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2017 |
| 625 | livingwell-news.com | 1&1 Internet AG | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2016 |
| 626 | livingwelldaily.com | Brandsight, Inc. | 21 Sep 2016 | 21 Aug 2024 | 21 Sep 2025 |
| 627 | livingwellfoundation.org | CloudFlare, Inc. | 6 Feb 2024 | 12 Jan 2025 | 6 Feb 2026 |
| 628 | livingwelloregon.com | Brandsight, Inc. | 24 Sep 2015 | 24 Aug 2024 | 24 Sep 2025 |
| 629 | livingwellbydesign.org | GoDaddy.com, LLC | 25 Sep 2015 | 25 Sep 2015 | 25 Sep 2016 |
| 630 | livingwellbydesign.net | Tucows Domains Inc. | 5 May 2021 | 16 Jul 2023 | 5 May 2023 |
| 631 | livingwellgccc.com | FastDomain Inc. | 7 Jul 2015 | 7 Jul 2017 | 7 Jul 2018 |
| 632 | livingwellhealingarts.com | Tucows Domains Inc. | 5 Jul 2013 | 9 Jul 2015 | 5 Jul 2016 |
| 633 | livingwellprograms.com | GoDaddy.com, LLC | 30 Aug 2023 | 31 Aug 2024 | 30 Aug 2025 |
| 634 | livingwellwithmigraine.org | Dynadot, LLC | 9 Jul 2015 | 10 Jul 2017 | 9 Jul 2018 |
| 635 | livingwellwithmigraine.net | Dynadot, LLC | 9 Jul 2015 | 10 Jul 2017 | 9 Jul 2017 |
| 636 | livingwellresources.info | Crazy Domains FZ-LLC | 12 Jul 2015 | 23 Jul 2017 | 12 Jul 2018 |
| 637 | livingwellphl.com | GoDaddy.com, LLC | 14 Jul 2015 | 14 Jul 2015 | 14 Jul 2016 |
| 638 | livingwellresources.org | GoDaddy.com, LLC | 13 Jul 2020 | 27 Aug 2024 | 13 Jul 2025 |
| 639 | livingwellman.com | Wild West Domains, LLC | 9 Jan 2018 | 10 Jan 2025 | 9 Jan 2026 |
| 640 | livingwellnaturals.net | Crazy Domains FZ-LLC | 14 Jul 2015 | 27 Jun 2017 | 14 Jul 2019 |
| 641 | livingwellre.com | GoDaddy.com, LLC | 23 Jun 2021 | 24 Jun 2024 | 23 Jun 2025 |
| 642 | livingwellkent.org | FastDomain Inc. | 27 Sep 2015 | 17 Sep 2024 | 27 Sep 2025 |
| 643 | livingwellinphoenix.com | NameCheap, Inc. | 17 Jul 2022 | - | 17 Jul 2023 |
| 644 | livingwellaftertrauma.com | Crazy Domains FZ-LLC | 17 Jul 2015 | 17 Jul 2015 | 17 Jul 2017 |
| 645 | livingwellwitheczema.com | GoDaddy.com, LLC | 7 Oct 2021 | 19 Dec 2024 | 7 Oct 2024 |
| 646 | livingwellwitheczema.info | GoDaddy.com, LLC | 18 Jul 2015 | 19 Jul 2017 | 18 Jul 2018 |
| 647 | livingwellsociety.com | GoDaddy.com, LLC | 6 Nov 2023 | 6 Nov 2023 | 6 Nov 2025 |
| 648 | livingwellintoughtimes.com | Tucows Domains Inc. | 16 Jul 2013 | 20 Jul 2015 | 16 Jul 2016 |
| 649 | livingwell-linda.com | Launchpad, Inc. | 19 Jul 2015 | 31 Aug 2024 | 19 Jul 2024 |
| 650 | livingwellwitheczema.org | GoDaddy.com, LLC | 18 Jul 2015 | 19 Jul 2017 | 18 Jul 2018 |
| 651 | livingwellwitheczema.net | GoDaddy.com, LLC | 18 Jul 2015 | 18 Jul 2015 | 18 Jul 2016 |
| 652 | livingwellpruvitnow.com | eNom, Inc. | 28 Sep 2015 | 28 Sep 2015 | 28 Sep 2016 |
| 653 | livingwellinloudoun.com | GoDaddy.com, LLC | 28 Sep 2015 | 28 Sep 2015 | 28 Sep 2017 |
| 654 | livingwellstores.com | Domain.com, LLC | 19 Oct 2011 | 14 Oct 2024 | 19 Oct 2025 |
| 655 | livingwelldementia.com | register.com, Inc. | 22 Jul 2015 | 24 Jul 2017 | 22 Jul 2018 |
| 656 | livingwelliyoga.com | GoDaddy.com, LLC | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2017 |
| 657 | livingwellwithrosibel.com | eNom, Inc. | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 658 | livingwellthejourney.com | Network Solutions, LLC | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 659 | livingwellbeingltd.com | Tucows Domains Inc. | 25 Jul 2011 | 29 Jul 2015 | 25 Jul 2016 |
| 660 | livingwelltherapyarts.com | GoDaddy.com, LLC | 30 Sep 2015 | 30 Sep 2015 | 30 Sep 2017 |
| 661 | livingwellclinicelkgrove.com | GoDaddy.com, LLC | 30 Sep 2015 | 30 Sep 2015 | 30 Sep 2016 |
| 662 | livingwelliseasy.com | NameCheap, Inc. | 30 Jul 2015 | 30 Jun 2024 | 30 Jul 2025 |
| 663 | livingwelloily.net | GoDaddy.com, LLC | 30 Jul 2015 | 30 Jul 2015 | 30 Jul 2016 |
| 664 | livingwelloily.info | GoDaddy.com, LLC | 30 Jul 2015 | 27 Jun 2016 | 30 Jul 2018 |
| 665 | livingwellaftercancer.org | NameCheap, Inc. | 29 Jul 2015 | 4 Jul 2024 | 29 Jul 2025 |
| 666 | livingwellredbrickhealth.com | - | 16 Oct 2016 | 16 Oct 2016 | 16 Oct 2017 |
| 667 | livingwelloily.us | GoDaddy.com, LLC | 30 Jul 2015 | 27 Jun 2016 | 29 Jul 2018 |
| 668 | livingwelloily.org | GoDaddy.com, LLC | 30 Jul 2015 | 10 Jul 2024 | 30 Jul 2025 |
| 669 | livingwelliseasy.net | NameCheap, Inc. | 30 Jul 2015 | 30 Jun 2024 | 30 Jul 2025 |
| 670 | livingwelliseasy.info | NameCheap, Inc. | 30 Jul 2015 | 5 Jul 2024 | 30 Jul 2025 |
| 671 | livingwell19.com | Hefei Juming Network Technology Co., Ltd | 15 May 2021 | 18 May 2021 | 15 May 2022 |
| 672 | livingwellwithcarmen.com | FastDomain Inc. | 17 May 2022 | 18 Jun 2023 | 17 May 2023 |
| 673 | livingwell4younglife.com | Google, Inc. | 7 Nov 2017 | 24 Oct 2024 | 7 Nov 2025 |
| 674 | livingwellwithprostatecancer.com | Wild West Domains, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 675 | livingwellgal.com | eNom, Inc. | 3 Oct 2015 | 3 Oct 2015 | 3 Oct 2016 |
| 676 | livingwelloilynow.com | GoDaddy.com, LLC | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2017 |
| 677 | livingwelloilyforever.com | GoDaddy.com, LLC | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2017 |
| 678 | livingwelloilyfamily.com | GoDaddy.com, LLC | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2017 |
| 679 | livingwelllovingwell.com | GoDaddy.com, LLC | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2017 |
| 680 | livingwellfriends.com | GoDaddy.com, LLC | 2 Nov 2023 | 2 Nov 2023 | 2 Nov 2026 |
| 681 | livingwellmassage.us | GoDaddy.com, LLC | 5 Aug 2015 | 5 Aug 2015 | 4 Aug 2017 |
| 682 | livingwellcompany.us | GoDaddy.com, LLC | 5 Aug 2015 | 27 Jun 2016 | 4 Aug 2018 |
| 683 | livingwells.us | TierraNet Inc. d/b/a DomainDiscover | 3 Oct 2015 | 3 Oct 2015 | 2 Oct 2017 |
| 684 | livingwells.net | Wix.com Ltd. | 22 Oct 2020 | 22 Sep 2024 | 22 Oct 2025 |
| 685 | livingwellrecovery.net | GoDaddy.com, LLC | 3 Oct 2015 | 4 Oct 2024 | 3 Oct 2025 |
| 686 | livingwellapothecary.com | GoDaddy.com, LLC | 30 Jul 2017 | 31 Jul 2024 | 30 Jul 2025 |
| 687 | livingwellwithhiv.org | GoDaddy.com, LLC | 7 Aug 2015 | 7 Aug 2015 | 7 Aug 2016 |
| 688 | livingwellpmha.com | Tucows Domains Inc. | 25 Mar 2024 | 25 Mar 2024 | 25 Mar 2025 |
| 689 | livingwellwithtlc.com | GoDaddy.com, LLC | 4 Oct 2015 | 4 Oct 2015 | 4 Oct 2017 |
| 690 | livingwelltakingjuiceplus.com | GMO Internet Inc. | 22 Dec 2016 | 22 Oct 2017 | 21 Dec 2018 |
| 691 | livingwelltakeout.com | DropCatch.com 846 LLC | 25 Dec 2016 | 26 Dec 2017 | 25 Dec 2018 |
| 692 | livingwellincoppell.net | GoDaddy.com, LLC | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2016 |
| 693 | livingwellhomehc.com | FastDomain Inc. | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2016 |
| 694 | livingwellorlando.com | GoDaddy.com, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 695 | livingwellok.com | GoDaddy.com, LLC | 3 Aug 2011 | 8 Oct 2015 | 3 Aug 2017 |
| 696 | livingwellyleo.net | GoDaddy.com, LLC | 11 Oct 2015 | 11 Oct 2015 | 11 Oct 2016 |
| 697 | livingwellyleo.info | GoDaddy.com, LLC | 11 Oct 2015 | - | 11 Oct 2016 |
| 698 | livingwellessentialoils.com | Dynadot, LLC | 21 Jun 2024 | 9 Sep 2024 | 21 Jun 2025 |
| 699 | livingwellyleo.org | GoDaddy.com, LLC | 11 Oct 2015 | 11 Oct 2015 | 11 Oct 2016 |
| 700 | livingweller.org | GoDaddy.com, LLC | 12 Oct 2015 | 12 Oct 2015 | 12 Oct 2016 |
| 701 | livingwellwithfibromyalgia.com | FastDomain Inc. | 24 Aug 2019 | 24 Aug 2019 | 24 Aug 2020 |
| 702 | livingwellcompanioncare.org | Network Solutions, LLC | 15 Oct 2015 | 21 Aug 2024 | 15 Oct 2027 |
| 703 | livingwellcompanioncare.com | Network Solutions, LLC | 15 Oct 2015 | 16 Aug 2024 | 15 Oct 2027 |
| 704 | livingwellwithmichelle.life | GoDaddy.com, LLC | 19 Oct 2015 | 30 Dec 2024 | 19 Oct 2024 |
| 705 | livingwellandspendingless.com | eNom, Inc. | 18 Jul 2022 | 18 Jul 2022 | 18 Jul 2023 |
| 706 | livingwell-magazine.com | Namebay SAM | 26 Jan 2020 | 28 Dec 2024 | 26 Jan 2026 |
| 707 | livingwellnessgroup.net | 1&1 Internet AG | 28 Oct 2015 | 29 Oct 2016 | 28 Oct 2017 |
| 708 | livingwellnessgroup.info | 1&1 Internet AG | 28 Oct 2015 | 28 Oct 2016 | 28 Oct 2017 |
| 709 | livingwellnessgroup.com | Wild West Domains, LLC | 12 Oct 2023 | 23 Nov 2024 | 12 Oct 2024 |
| 710 | livingwellrewardscenter.com | Key-Systems GmbH | 9 Jun 2022 | 8 May 2023 | 9 Jun 2024 |
| 711 | livingwellrewards.com | GoDaddy.com, LLC | 20 Jan 2018 | 21 Jan 2024 | 20 Jan 2026 |
| 712 | livingwellmiami.com | GoDaddy.com, LLC | 25 Dec 2021 | 26 Dec 2024 | 25 Dec 2025 |
| 713 | livingwellroadshow.com | GoDaddy.com, LLC | 6 Nov 2015 | 6 Nov 2015 | 6 Nov 2017 |
| 714 | livingwellplanner.com | Tucows Domains Inc. | 5 Nov 2015 | 7 Oct 2024 | 5 Nov 2025 |
| 715 | livingwellmi.com | eNom, Inc. | 5 Nov 2015 | 8 Oct 2016 | 5 Nov 2017 |
| 716 | livingwellwithcfrd.com | register.com, Inc. | 8 Nov 2015 | 29 Jul 2017 | 8 Nov 2019 |
| 717 | livingwellbyeder.com | Automattic Inc. | 9 Jul 2023 | 10 Jul 2024 | 9 Jul 2026 |
| 718 | livingwellwithmontell.com | GoDaddy.com, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 719 | livingwellmarbella.com | GoDaddy.com, LLC | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2017 |
| 720 | livingwellcalendars.com | GoDaddy.com, LLC | 13 Nov 2015 | 14 Nov 2015 | 13 Nov 2016 |
| 721 | livingwellrewardcenter.com | Fabulous.com Pty Ltd. | 14 Nov 2015 | 14 Nov 2015 | 14 Nov 2016 |
| 722 | livingwellpbc.info | Key-Systems GmbH | 16 Nov 2015 | 16 Nov 2016 | 16 Nov 2017 |
| 723 | livingwellhealthinsurance.com | GoDaddy.com, LLC | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2017 |
| 724 | livingwellthy.org | GoDaddy.com, LLC | 3 Dec 2019 | 17 Jan 2025 | 3 Dec 2026 |
| 725 | livingwellworkingwellny.com | GoDaddy.com, LLC | 21 Nov 2015 | 21 Nov 2015 | 21 Nov 2017 |
| 726 | livingwellguide.com | TurnCommerce, Inc. DBA NameBright.com | 21 Nov 2015 | 15 Nov 2020 | 21 Nov 2025 |
| 727 | livingwellady.org | eNom, Inc. | 21 Nov 2015 | 21 Nov 2015 | 21 Nov 2016 |
| 728 | livingwellady.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Sep 2022 | 22 Oct 2023 | 10 Sep 2023 |
| 729 | livingwellwithpcos.com | Launchpad, Inc. | 9 May 2022 | 24 Apr 2024 | 9 May 2025 |
| 730 | livingwellat48.com | GoDaddy.com, LLC | 23 Nov 2015 | 23 Nov 2015 | 23 Nov 2017 |
| 731 | livingwellwithmosadi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Nov 2015 | 24 Nov 2015 | 24 Nov 2016 |
| 732 | livingwellinaustin.com | GoDaddy.com, LLC | 24 Nov 2015 | 26 Nov 2023 | 24 Nov 2028 |
| 733 | livingwellandwisely.com | GoDaddy.com, LLC | 24 Nov 2015 | 24 Nov 2015 | 24 Nov 2017 |
| 734 | livingwellwithdrmike.info | Wild West Domains, LLC | 28 Nov 2015 | 27 Jan 2016 | 28 Nov 2017 |
| 735 | livingwelllifestylestore.com | eNom, Inc. | 28 Nov 2015 | 23 Nov 2016 | 28 Nov 2017 |
| 736 | livingwellhealthcenterblog.com | GoDaddy.com, LLC | 29 Nov 2015 | 29 Nov 2015 | 29 Nov 2016 |
| 737 | livingwellcounselingservices.org | GoDaddy.com, LLC | 30 Nov 2015 | 14 Jan 2025 | 30 Nov 2025 |
| 738 | livingwellplr.com | eNom, Inc. | 28 Feb 2017 | 28 Feb 2017 | 28 Feb 2018 |
| 739 | livingwelllifespa.com | Network Solutions, LLC | 1 Dec 2015 | 9 Jun 2024 | 1 Dec 2025 |
| 740 | livingwellpro.com | GoDaddy.com, LLC | 19 May 2020 | 30 Jun 2024 | 19 May 2024 |
| 741 | livingwelllehighvalley.com | GoDaddy.com, LLC | 2 Dec 2015 | 2 Dec 2015 | 2 Dec 2016 |
| 742 | livingwellinthelehighvalley.com | GoDaddy.com, LLC | 2 Dec 2015 | 2 Dec 2015 | 2 Dec 2016 |
| 743 | livingwell-itworks.com | GoDaddy.com, LLC | 3 Dec 2015 | 3 Dec 2015 | 3 Dec 2016 |
| 744 | livingwellprop.com | eNom, Inc. | 3 Dec 2015 | 1 Nov 2016 | 3 Dec 2017 |
| 745 | livingwellmail.com | GoDaddy.com, LLC | 5 Dec 2015 | 28 Nov 2024 | 5 Dec 2025 |
| 746 | livingwellwithgrace.org | GoDaddy.com, LLC | 6 Dec 2015 | 6 Dec 2015 | 6 Dec 2016 |
| 747 | livingwellwithgrace.com | GoDaddy.com, LLC | 12 Jul 2018 | 13 Jul 2024 | 12 Jul 2025 |
| 748 | livingwell24.com | Key-Systems GmbH | 21 Sep 2023 | 4 Nov 2024 | 21 Sep 2024 |
| 749 | livingwellwithlight.com | Domain.com, LLC | 8 Dec 2015 | 8 Dec 2015 | 8 Dec 2016 |
| 750 | livingwellcs.org | Launchpad, Inc. | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2016 |
| 751 | livingwellalkalinewater.com | GoDaddy.com, LLC | 10 Dec 2015 | 10 Dec 2015 | 10 Dec 2017 |
| 752 | livingwell24.life | Mesh Digital Limited | 11 Dec 2015 | 6 Jan 2017 | 11 Dec 2018 |
| 753 | livingwellwomenscoaching.com | Google, Inc. | 13 Dec 2015 | 29 Nov 2024 | 13 Dec 2025 |
| 754 | livingwellnow.net | NameCheap, Inc. | 12 May 2022 | 23 Jun 2023 | 12 May 2023 |
| 755 | livingwellinfinitely.com | GoDaddy.com, LLC | 15 Dec 2015 | 15 Dec 2015 | 15 Dec 2017 |
| 756 | livingwellformula.xyz | NameCheap, Inc. | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2016 |
| 757 | livingwellfm.com | GoDaddy.com, LLC | 16 Dec 2015 | 20 Feb 2025 | 16 Dec 2025 |
| 758 | livingwellglow.com | eNom, Inc. | 17 Dec 2015 | 2 Dec 2016 | 17 Dec 2017 |
| 759 | livingwelldesign1.com | Launchpad, Inc. | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2016 |
| 760 | livingwellwithlisawilson.com | GoDaddy.com, LLC | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2017 |
| 761 | livingwellharingey.com | LCN.COM Ltd. | 17 Dec 2015 | 17 Dec 2015 | 17 Dec 2016 |
| 762 | livingwelleatwell.com | 1&1 Internet AG | 15 May 2017 | 15 May 2017 | 15 May 2018 |
| 763 | livingwellinaz.org | GoDaddy.com, LLC | 18 Dec 2015 | 1 Feb 2025 | 18 Dec 2025 |
| 764 | livingwellinaz.info | GoDaddy.com, LLC | 18 Dec 2015 | 1 Feb 2025 | 18 Dec 2025 |
| 765 | livingwellcommunities.org | GoDaddy.com, LLC | 18 Dec 2015 | 1 Feb 2025 | 18 Dec 2025 |
| 766 | livingwellcomm.org | GoDaddy.com, LLC | 18 Dec 2015 | 1 Feb 2025 | 18 Dec 2025 |
| 767 | livingwellcomm.info | GoDaddy.com, LLC | 18 Dec 2015 | 1 Feb 2025 | 18 Dec 2025 |
| 768 | livingwellarizona.org | GoDaddy.com, LLC | 18 Dec 2015 | 1 Feb 2025 | 18 Dec 2025 |
| 769 | livingwellarizona.info | GoDaddy.com, LLC | 18 Dec 2015 | 1 Feb 2025 | 18 Dec 2025 |
| 770 | livingwellinaz.net | GoDaddy.com, LLC | 18 Dec 2015 | 19 Dec 2024 | 18 Dec 2025 |
| 771 | livingwellinaz.com | GoDaddy.com, LLC | 18 Dec 2015 | 19 Dec 2024 | 18 Dec 2025 |
| 772 | livingwellcommunities.net | GoDaddy.com, LLC | 18 Dec 2015 | 19 Dec 2024 | 18 Dec 2025 |
| 773 | livingwellcomm.net | GoDaddy.com, LLC | 18 Dec 2015 | 19 Dec 2024 | 18 Dec 2025 |
| 774 | livingwellcomm.com | GoDaddy.com, LLC | 18 Dec 2015 | 19 Dec 2024 | 18 Dec 2025 |
| 775 | livingwellarizona.net | GoDaddy.com, LLC | 18 Dec 2015 | 19 Dec 2024 | 18 Dec 2025 |
| 776 | livingwellarizona.com | GoDaddy.com, LLC | 18 Dec 2015 | 19 Dec 2024 | 18 Dec 2025 |
| 777 | livingwellinsideandoutside.net | GoDaddy.com, LLC | 20 Dec 2015 | 20 Dec 2015 | 20 Dec 2016 |
| 778 | livingwellinsideandoutside.info | GoDaddy.com, LLC | 20 Dec 2015 | 18 Mar 2016 | 20 Dec 2017 |
| 779 | livingwellinsideandoutside.com | GoDaddy.com, LLC | 20 Dec 2015 | 18 Mar 2025 | 17 Mar 2027 |
| 780 | livingwellinsideandoutside.org | GoDaddy.com, LLC | 20 Dec 2015 | 18 Mar 2016 | 20 Dec 2017 |
| 781 | livingwellnashville.org | Domain.com, LLC | 22 Dec 2015 | 12 Dec 2024 | 22 Dec 2025 |
| 782 | livingwellnashville.net | Domain.com, LLC | 22 Dec 2015 | 7 Dec 2024 | 22 Dec 2025 |
| 783 | livingwellonearth.com | GoDaddy.com, LLC | 27 Dec 2015 | 27 Dec 2015 | 27 Dec 2016 |
| 784 | livingwellwithhypnosis.com | Webfusion Ltd. | 28 Dec 2015 | 28 Dec 2015 | 28 Dec 2017 |
| 785 | livingwellseniors.org | Web Commerce Communications Limited dba WebNic.cc | 8 Nov 2024 | 13 Nov 2024 | 8 Nov 2025 |
| 786 | livingwelldesign.com | GoDaddy.com, LLC | 29 Dec 2015 | 24 Jan 2024 | 29 Dec 2025 |
| 787 | livingwellwomensexpo.com | Interweb Advertising D.B.A. Profile Builder | 29 Dec 2015 | 29 Dec 2015 | 29 Dec 2016 |
| 788 | livingwellbrandnew.com | Wild West Domains, LLC | 30 Dec 2015 | 30 Dec 2015 | 30 Dec 2016 |
| 789 | livingwellretired.com | GKG.NET, INC. | 1 Jul 2024 | 1 Jul 2024 | 1 Jul 2025 |
| 790 | livingwellmagazine.com | register.com, Inc. | 30 Aug 2005 | 31 Jul 2023 | 30 Aug 2025 |
| 791 | livingwellhearingloss.com | GoDaddy.com, LLC | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2018 |
| 792 | livingwellwithra.com | eNom, Inc. | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 793 | livingwellwithmonica.com | Launchpad, Inc. | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 794 | livingwelllabs.com | - | 2 Apr 2009 | 20 Mar 2025 | 2 Apr 2026 |
| 795 | livingwelldallas.com | FastDomain Inc. | 30 Aug 2004 | 12 Feb 2025 | 30 Aug 2025 |
| 796 | livingwellweekend.com | GoDaddy.com, LLC | 16 Apr 2009 | 16 Apr 2023 | 16 Apr 2028 |
| 797 | livingwellspendingless.xyz | Instra Corporation Pty Ltd. | 24 Oct 2014 | 7 Jan 2016 | 24 Oct 2016 |
| 798 | livingwellwithalana.com | GoDaddy.com, LLC | 7 Jan 2016 | 10 Dec 2024 | 7 Jan 2026 |
| 799 | livingwellrehab.com | GoDaddy.com, LLC | 8 Jan 2016 | 20 Jan 2025 | 8 Jan 2026 |
| 800 | livingwellrehabilitation.com | GoDaddy.com, LLC | 9 Jan 2016 | 21 Jan 2025 | 9 Jan 2026 |
| 801 | livingwellover50.org | eNom, Inc. | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2017 |
| 802 | livingwellhealthservices.com | GoDaddy.com, LLC | 11 Jan 2016 | 11 Jan 2016 | 11 Jan 2019 |
| 803 | livingwellhealthcoaching.com | GoDaddy.com, LLC | 20 Oct 2021 | 21 Oct 2023 | 20 Oct 2025 |
| 804 | livingwellinsideandout.com | - | 4 Jan 2022 | 4 Jan 2022 | 4 Jan 2023 |
| 805 | livingwellbykel.com | GoDaddy.com, LLC | 14 Jan 2016 | 14 Jan 2016 | 14 Jan 2017 |
| 806 | livingwellnessacademy.com | GoDaddy.com, LLC | 16 Jan 2016 | 16 Jan 2016 | 16 Jan 2017 |
| 807 | livingwellnetwork.nyc | GoDaddy.com, LLC | 17 Jan 2016 | 17 Jan 2016 | 16 Jan 2017 |
| 808 | livingwell-today.com | GoDaddy.com, LLC | 16 May 2023 | 16 May 2023 | 16 May 2025 |
| 809 | livingwell-tips.com | eNom, Inc. | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 810 | livingwell-story.com | eNom, Inc. | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 811 | livingwell-report.com | eNom, Inc. | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 812 | livingwell-now.com | GoDaddy.com, LLC | 21 Dec 2022 | 31 Jan 2024 | 21 Dec 2023 |
| 813 | livingwell-lifestyle.com | GoDaddy.com, LLC | 15 Feb 2020 | 15 Feb 2025 | 15 Feb 2026 |
| 814 | livingwell-guides.com | eNom, Inc. | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 815 | livingwell-guide.com | eNom, Inc. | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 816 | livingwell-daily.com | GoDaddy.com, LLC | 9 Feb 2023 | 21 Mar 2024 | 9 Feb 2024 |
| 817 | livingwellnfit.com | FastDomain Inc. | 19 Jan 2016 | 19 Jan 2016 | 19 Jan 2017 |
| 818 | livingwelljuicewell.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Jun 2021 | 30 Jun 2023 | 29 Jun 2024 |
| 819 | livingwellwithdanielle.org | Launchpad, Inc. | 21 Jan 2016 | 21 Jan 2016 | 21 Jan 2017 |
| 820 | livingwellfamilychiropractic.com | GoDaddy.com, LLC | 21 Jan 2016 | 17 Jan 2025 | 21 Jan 2026 |
| 821 | livingwellandwealthy.com | FastDomain Inc. | 5 Jul 2021 | 17 Aug 2024 | 5 Jul 2024 |
| 822 | livingwellaftersixty.com | GoDaddy.com, LLC | 5 Sep 2024 | 5 Sep 2024 | 5 Sep 2026 |
| 823 | livingwelltransitions.info | Network Solutions, LLC | 24 Jan 2016 | 24 Jan 2016 | 24 Jan 2017 |
| 824 | livingwellwithoutgluten.com | Gandi SAS | 22 Jan 2010 | 26 Jan 2016 | 22 Jan 2018 |
| 825 | livingwellprogram.com | TurnCommerce, Inc. DBA NameBright.com | 14 Apr 2018 | 16 May 2024 | 14 Apr 2024 |
| 826 | livingwellmatrix.com | GoDaddy.com, LLC | 25 Jan 2016 | 25 Jan 2016 | 25 Jan 2018 |
| 827 | livingwellwithlyme.com | - | 20 Apr 2022 | 4 Jul 2023 | 20 Apr 2023 |
| 828 | livingwellministries.com | TurnCommerce, Inc. DBA NameBright.com | 1 Feb 2016 | 13 Mar 2025 | 1 Feb 2025 |
| 829 | livingwellfairfax.org | Dynadot, LLC | 17 Mar 2018 | 7 Mar 2025 | 17 Mar 2026 |
| 830 | livingwellwithjanelle.com | GoDaddy.com, LLC | 9 Jul 2020 | 10 Jul 2024 | 9 Jul 2025 |
| 831 | livingwellnessbrevard.us | GoDaddy.com, LLC | 3 Feb 2016 | 3 Feb 2016 | 2 Feb 2017 |
| 832 | livingwellnessbrevard.com | GoDaddy.com, LLC | 3 Feb 2016 | 3 Feb 2016 | 3 Feb 2017 |
| 833 | livingwellwithme.online | NameCheap, Inc. | 10 Mar 2023 | 21 May 2024 | 10 Mar 2024 |
| 834 | livingwellnessbrevard.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Feb 2016 | 4 Feb 2016 | 4 Feb 2017 |
| 835 | livingwellepp.com | 1&1 Internet AG | 4 Feb 2016 | 4 Feb 2016 | 4 Feb 2018 |
| 836 | livingwellrevolution.com | GoDaddy.com, LLC | 6 Feb 2016 | 6 Feb 2016 | 6 Feb 2017 |
| 837 | livingwellsurat.com | GoDaddy.com, LLC | 6 Feb 2016 | 6 Feb 2016 | 6 Feb 2017 |
| 838 | livingwellfed.com | GoDaddy.com, LLC | 9 Jul 2024 | 9 Jul 2024 | 9 Jul 2026 |
| 839 | livingwelltoday.org | - | 11 Sep 2024 | 16 Sep 2024 | 11 Sep 2025 |
| 840 | livingwellindoors.com | Uniregistrar Corp | - | - | - |
| 841 | livingwellpresents.com | DropCatch.com 856 LLC | 4 May 2018 | 4 May 2018 | 4 May 2019 |
| 842 | livingwellwithkim.club | Name.com, Inc. | 15 Feb 2016 | 7 Mar 2017 | 14 Feb 2018 |
| 843 | livingwellonwilkens.org | GoDaddy.com, LLC | 17 Feb 2016 | 18 Apr 2016 | 17 Feb 2019 |
| 844 | livingwellandgood.com | GoDaddy.com, LLC | 17 Apr 2025 | 17 Apr 2025 | 17 Apr 2026 |
| 845 | livingwellucc.org | GoDaddy.com, LLC | 22 Feb 2016 | 22 Feb 2016 | 22 Feb 2017 |
| 846 | livingwellucc.net | GoDaddy.com, LLC | 22 Feb 2016 | 22 Feb 2016 | 22 Feb 2017 |
| 847 | livingwellucc.info | GoDaddy.com, LLC | 22 Feb 2016 | - | 22 Feb 2017 |
| 848 | livingwellucc.com | NameTell.com LLC | 12 May 2017 | 12 May 2017 | 12 May 2018 |
| 849 | livingwellinaustralia.com | Crazy Domains FZ-LLC | 22 Feb 2016 | 5 Mar 2017 | 22 Feb 2017 |
| 850 | livingwellnessdayspa.us | GoDaddy.com, LLC | 22 Feb 2016 | 22 Feb 2017 | 21 Feb 2018 |
| 851 | livingwellbarbados.org | GoDaddy.com, LLC | 23 Feb 2016 | 24 Apr 2016 | 23 Feb 2018 |
| 852 | livingwellbarbados.net | GoDaddy.com, LLC | 23 Feb 2016 | 23 Feb 2016 | 23 Feb 2018 |
| 853 | livingwellbarbados.info | GoDaddy.com, LLC | 23 Feb 2016 | 23 Apr 2016 | 23 Feb 2018 |
| 854 | livingwellbarbados.com | GoDaddy.com, LLC | 23 Feb 2016 | 23 Feb 2016 | 23 Feb 2018 |
| 855 | livingwellcounselingaz.com | Network Solutions, LLC | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 856 | livingwellwithbrit.com | GoDaddy.com, LLC | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 857 | livingwellinflorida.com | Hostinger, UAB | 14 Nov 2023 | 18 Oct 2024 | 14 Nov 2025 |
| 858 | livingwellhealthcare.org | Tucows Domains Inc. | 26 Feb 2016 | 31 May 2017 | 26 Feb 2018 |
| 859 | livingwellwithmigraines.com | Network Solutions, LLC | 29 Feb 2016 | 12 May 2024 | 28 Feb 2024 |
| 860 | livingwellnessnews.com | eNom, Inc. | 1 Mar 2016 | 1 Mar 2016 | 1 Mar 2017 |
| 861 | livingwelltrust.org | eNom, Inc. | 29 Feb 2016 | 3 Feb 2021 | 28 Feb 2030 |
| 862 | livingwellwithjamie.com | GoDaddy.com, LLC | 11 Aug 2023 | 31 Oct 2024 | 11 Aug 2025 |
| 863 | livingwellccllc.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Mar 2016 | 26 Feb 2025 | 1 Mar 2026 |
| 864 | livingwellstyle.com | GoDaddy.com, LLC | 5 Mar 2016 | 5 Mar 2016 | 5 Mar 2017 |
| 865 | livingwellsalem.com | register.com, Inc. | 14 Sep 2007 | 15 Jun 2023 | 14 Sep 2028 |
| 866 | livingwellstl.org | GoDaddy.com, LLC | 22 Jul 2017 | 22 Jul 2017 | 22 Jul 2018 |
| 867 | livingwellstl.net | GoDaddy.com, LLC | 8 Mar 2016 | 8 Mar 2016 | 8 Mar 2017 |
| 868 | livingwellstl.info | GoDaddy.com, LLC | 8 Mar 2016 | 8 Mar 2016 | 8 Mar 2017 |
| 869 | livingwellstl.com | GoDaddy.com, LLC | 8 Mar 2016 | 8 Mar 2016 | 8 Mar 2018 |
| 870 | livingwellhealingspa.com | GoDaddy.com, LLC | 11 Mar 2016 | 11 Mar 2016 | 11 Mar 2018 |
| 871 | livingwellclasses.com | GoDaddy.com, LLC | 11 Mar 2016 | 11 Mar 2016 | 11 Mar 2018 |
| 872 | livingwellwithscleroderma.com | GoDaddy.com, LLC | 13 Mar 2016 | 13 Mar 2016 | 13 Mar 2021 |
| 873 | livingwellprojects.com | Key-Systems GmbH | 18 Apr 2023 | 17 Apr 2025 | 18 Apr 2026 |
| 874 | livingwelln32s.com | eNom, Inc. | 14 Mar 2016 | 14 Mar 2016 | 14 Mar 2017 |
| 875 | livingwellleavingwell.com | GoDaddy.com, LLC | 14 Mar 2016 | 21 Sep 2022 | 14 Mar 2026 |
| 876 | livingwell-leavingwell.com | GoDaddy.com, LLC | 14 Mar 2016 | 21 Sep 2022 | 14 Mar 2026 |
| 877 | livingwellwithscleroderma.org | GoDaddy.com, LLC | 16 Mar 2016 | 13 Jul 2024 | 16 Mar 2026 |
| 878 | livingwellglowcs.com | eNom, Inc. | 16 Mar 2016 | 16 Mar 2016 | 16 Mar 2017 |
| 879 | livingwellwithfibro.com | GoDaddy.com, LLC | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 880 | livingwellgoddess.com | GoDaddy.com, LLC | 29 Mar 2022 | 11 Apr 2025 | 29 Mar 2026 |
| 881 | livingwellhelper.com | GoDaddy.com, LLC | 18 Mar 2016 | 18 Mar 2016 | 18 Mar 2017 |
| 882 | livingwellbuilder.com | GoDaddy.com, LLC | 18 Mar 2016 | 18 Mar 2016 | 18 Mar 2017 |
| 883 | livingwelladu.com | GoDaddy.com, LLC | 18 Mar 2016 | 18 Mar 2016 | 18 Mar 2017 |
| 884 | livingwell-jnjcanada.com | Tucows Domains Inc. | 15 Mar 2005 | 15 Mar 2005 | 15 Mar 2017 |
| 885 | livingwellthy.com | GoDaddy.com, LLC | 11 Jan 2025 | 11 Jan 2025 | 11 Jan 2026 |
| 886 | livingwell4less.net | Tucows Domains Inc. | 16 Mar 2010 | 20 Mar 2025 | 16 Mar 2026 |
| 887 | livingwellfamilymedicine.info | GoDaddy.com, LLC | 21 Mar 2016 | 21 Mar 2016 | 21 Mar 2017 |
| 888 | livingwelllifeisgood.com | Wild West Domains, LLC | 20 Mar 2016 | 20 Mar 2016 | 20 Mar 2017 |
| 889 | livingwellfamilymedicine.net | GoDaddy.com, LLC | 21 Mar 2016 | 21 Mar 2016 | 21 Mar 2017 |
| 890 | livingwellfamilymedicine.com | GoDaddy.com, LLC | 18 Apr 2022 | 11 Sep 2024 | 18 Apr 2026 |
| 891 | livingwell4me.com | GoDaddy.com, LLC | 20 Mar 2016 | 20 Mar 2016 | 20 Mar 2017 |
| 892 | livingwellfamilymedicine.org | GoDaddy.com, LLC | 21 Mar 2016 | 21 Mar 2016 | 21 Mar 2017 |
| 893 | livingwellwithlauren.com | GoDaddy.com, LLC | 21 Mar 2016 | 22 Mar 2025 | 21 Mar 2026 |
| 894 | livingwelldynamics.com | GoDaddy.com, LLC | 22 Mar 2016 | 2 Apr 2024 | 22 Mar 2026 |
| 895 | livingwellrmt.com | Google, Inc. | 9 Jul 2022 | 25 Jun 2024 | 9 Jul 2025 |
| 896 | livingwellhits.com | DomainsAtCost Corporation | 26 Mar 2016 | 26 Mar 2016 | 26 Mar 2017 |
| 897 | livingwellwithillness.com | GoDaddy.com, LLC | 29 Mar 2016 | 30 Mar 2024 | 29 Mar 2026 |
| 898 | livingwellcouncelingcenter.com | eNom, Inc. | 30 Mar 2016 | 30 Mar 2016 | 30 Mar 2017 |
| 899 | livingwellspinal.com | Tucows Domains Inc. | 23 Jan 2014 | 27 Jan 2019 | 23 Jan 2019 |
| 900 | livingwellington.com | GoDaddy.com, LLC | 30 Mar 2016 | 31 Mar 2025 | 30 Mar 2026 |
| 901 | livingwellfinishingstrong.com | Network Solutions, LLC | 30 Mar 2016 | 5 Mar 2017 | 30 Mar 2018 |
| 902 | livingwellichiropractic.com | GoDaddy.com, LLC | 2 Apr 2016 | 2 Apr 2016 | 2 Apr 2017 |
| 903 | livingwellnessfinancialfreedom.com | GoDaddy.com, LLC | 2 Apr 2016 | 2 Apr 2016 | 2 Apr 2021 |
| 904 | livingwellinawarmingworld.com | eNom, Inc. | 3 Apr 2016 | 2 Mar 2017 | 3 Apr 2018 |
| 905 | livingwellpools.com | Tucows Domains Inc. | 18 Jun 2021 | 17 Jun 2024 | 18 Jun 2025 |
| 906 | livingwelllearningcenter.org | Name.com, Inc. | 30 Nov 2021 | 3 Nov 2024 | 30 Nov 2025 |
| 907 | livingwellwithdiabetesonline.com | - | 5 Apr 2016 | 5 Apr 2016 | 5 Apr 2017 |
| 908 | livingwellerwithoutthewhine.com | Wild West Domains, LLC | 5 Apr 2016 | 5 Apr 2016 | 5 Apr 2017 |
| 909 | livingwellrg.com | GoDaddy.com, LLC | 7 Apr 2016 | 21 Sep 2022 | 7 Apr 2026 |
| 910 | livingwelltoday.online | Hostinger, UAB | 1 Jul 2024 | 9 Jul 2024 | 1 Jul 2025 |
| 911 | livingwellandprospering.com | Wild West Domains, LLC | 8 Apr 2016 | 8 Apr 2016 | 8 Apr 2017 |
| 912 | livingwellchiro.com | TurnCommerce, Inc. DBA NameBright.com | 11 Apr 2016 | 5 Apr 2021 | 11 Apr 2025 |
| 913 | livingwellpost.com | eNom, Inc. | 15 Apr 2016 | 15 Apr 2016 | 15 Apr 2017 |
| 914 | livingwellnessjournal.com | NetEarth One Inc. d/b/a NetEarth | 15 Apr 2016 | 15 Apr 2016 | 15 Apr 2017 |
| 915 | livingwellsupportservices.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2016 | 16 Apr 2025 | 16 Apr 2026 |
| 916 | livingwellatina.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 917 | livingwellsacto.com | GoDaddy.com, LLC | 20 Apr 2016 | 20 Apr 2016 | 20 Apr 2018 |
| 918 | livingwellmoms.com | GoDaddy.com, LLC | 21 Apr 2016 | 21 Apr 2016 | 21 Apr 2017 |
| 919 | livingwellelixirs.com | Tucows Domains Inc. | 21 Apr 2016 | 25 Apr 2019 | 21 Apr 2019 |
| 920 | livingwellwithkim.com | Wix.com Ltd. | 16 Aug 2023 | 23 Aug 2023 | 16 Aug 2025 |
| 921 | livingwellhawaii.com | Network Solutions, LLC | 10 Jun 2024 | 15 Oct 2024 | 10 Jun 2027 |
| 922 | livingwellthenaturalway.com | Tucows Domains Inc. | 17 Jan 2020 | 27 Feb 2025 | 17 Jan 2025 |
| 923 | livingwellmoves.com | Tucows Domains Inc. | 25 Apr 2016 | 10 Apr 2025 | 25 Apr 2026 |
| 924 | livingwellthenaturalway.net | GoDaddy.com, LLC | 25 Apr 2016 | 25 Apr 2016 | 25 Apr 2017 |
| 925 | livingwellthenaturalway.org | GoDaddy.com, LLC | 25 Apr 2016 | 25 Apr 2016 | 25 Apr 2017 |
| 926 | livingwellthenaturalway.info | GoDaddy.com, LLC | 25 Apr 2016 | 25 Apr 2016 | 25 Apr 2017 |
| 927 | livingwellthenaturalway.biz | GoDaddy.com, LLC | 25 Apr 2016 | 15 Aug 2016 | 24 Apr 2017 |
| 928 | livingwellindependentliving.com | Name.com, Inc. | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 929 | livingwellbc.com | GMO Internet Inc. | 24 Apr 2018 | 25 Apr 2018 | 24 Apr 2019 |
| 930 | livingwellvillage.org | GoDaddy.com, LLC | 24 Nov 2006 | 29 Jun 2024 | 24 Nov 2027 |
| 931 | livingwelloutdoors.com | eNom, Inc. | 28 Apr 2016 | 27 Mar 2017 | 28 Apr 2018 |
| 932 | livingwellafrica.com | Tucows Domains Inc. | 24 Apr 2014 | 24 Apr 2014 | 24 Apr 2017 |
| 933 | livingwellwithcll.org | GoDaddy.com, LLC | 30 Apr 2016 | 30 Apr 2016 | 30 Apr 2017 |
| 934 | livingwellwithcll.net | Amazon Registrar, Inc. | 20 Sep 2021 | 16 Aug 2024 | 20 Sep 2025 |
| 935 | livingwellwithconniegreen.com | 1&1 Internet AG | 29 Apr 2016 | 29 Apr 2016 | 30 Apr 2018 |
| 936 | livingwellwithcll.com | Amazon Registrar, Inc. | 20 Sep 2021 | 16 Aug 2024 | 20 Sep 2025 |
| 937 | livingwell-livinghealthfully.org | GoDaddy.com, LLC | 29 Apr 2016 | 19 Apr 2025 | 29 Apr 2026 |
| 938 | livingwellmarket.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Apr 2016 | 30 Apr 2024 | 29 Apr 2025 |
| 939 | livingwell-livinghealthfully.net | GoDaddy.com, LLC | 29 Apr 2016 | 14 Apr 2025 | 29 Apr 2026 |
| 940 | livingwellwithcll.info | GoDaddy.com, LLC | 30 Apr 2016 | 30 Apr 2016 | 30 Apr 2017 |
| 941 | livingwell-livinghealthfully.info | GoDaddy.com, LLC | 29 Apr 2016 | 19 Apr 2025 | 29 Apr 2026 |
| 942 | livingwellwithchronicmyelogenousleukemia.com | - | 29 Apr 2016 | 29 Apr 2016 | 29 Apr 2017 |
| 943 | livingwellwithbarb.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 29 Jul 2022 | 14 Aug 2023 | 29 Jul 2023 |
| 944 | livingwell-livinghealthfully.com | GoDaddy.com, LLC | 29 Apr 2016 | 14 Apr 2025 | 29 Apr 2026 |
| 945 | livingwellmd.org | GoDaddy.com, LLC | 4 May 2016 | 5 May 2017 | 4 May 2018 |
| 946 | livingwelltaylorstyle.com | GoDaddy.com, LLC | 4 May 2016 | 4 May 2016 | 4 May 2017 |
| 947 | livingwellstrategies.com | GoDaddy.com, LLC | 24 Aug 2019 | 10 Mar 2025 | 9 Mar 2026 |
| 948 | livingwellseniorcaretx.com | GoDaddy.com, LLC | 10 Jun 2014 | 3 Jul 2024 | 2 Jul 2025 |
| 949 | livingwellsomalia.org | Domain.com, LLC | 9 May 2016 | 21 May 2017 | 9 May 2020 |
| 950 | livingwellincommunities.org | CSC Corporate Domains, Inc. | 9 May 2016 | 10 May 2024 | 9 May 2025 |
| 951 | livingwellnessdesign.com | GoDaddy.com, LLC | 10 May 2016 | 10 May 2016 | 10 May 2017 |
| 952 | livingwellgracefully.com | Automattic Inc. | 5 May 2019 | 5 May 2019 | 5 May 2020 |
| 953 | livingwellbeing.org | Namesilo, LLC | 13 May 2016 | 26 May 2017 | 13 May 2018 |
| 954 | livingwellincommunities.com | Wild West Domains, LLC | 13 May 2016 | 6 Sep 2024 | 13 May 2026 |
| 955 | livingwellfood.com | P.A. Viet Nam Company Limited | 14 May 2016 | 11 May 2023 | 14 May 2024 |
| 956 | livingwellessentialsspashop.com | GoDaddy.com, LLC | 14 May 2016 | 14 Mar 2025 | 14 May 2026 |
| 957 | livingwellessentialsshop.com | GoDaddy.com, LLC | 14 May 2016 | 14 Mar 2025 | 14 May 2026 |
| 958 | livingwelltake2.org | GoDaddy.com, LLC | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 959 | livingwelltake2.net | GoDaddy.com, LLC | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 960 | livingwelltake2.info | GoDaddy.com, LLC | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 961 | livingwelltake2.com | GoDaddy.com, LLC | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 962 | livingwellseminar.com | GoDaddy.com, LLC | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 963 | livingwellevent.com | GoDaddy.com, LLC | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 964 | livingwellwithmaryell.org | register.com, Inc. | 17 May 2016 | 17 May 2016 | 17 May 2017 |
| 965 | livingwellwithlisatyhulski.com | - | 18 May 2016 | 18 May 2016 | 18 May 2017 |
| 966 | livingwellbylaura.com | GoDaddy.com, LLC | 31 May 2023 | 31 May 2023 | 31 May 2025 |
| 967 | livingwelldyingwell.net | Register.it SPA | 15 Apr 2008 | 15 Apr 2025 | 15 Apr 2027 |
| 968 | livingwells.life | GoDaddy.com, LLC | 22 May 2016 | 17 Jul 2024 | 22 May 2025 |
| 969 | livingwellinthailand.org | GoDaddy.com, LLC | 22 May 2016 | 22 May 2016 | 22 May 2017 |
| 970 | livingwellinthailand.net | GoDaddy.com, LLC | 22 May 2016 | 22 May 2016 | 22 May 2017 |
| 971 | livingwellinthailand.info | GoDaddy.com, LLC | 22 May 2016 | 22 May 2016 | 22 May 2017 |
| 972 | livingwellnessnw.com | GoDaddy.com, LLC | 22 May 2016 | 22 May 2016 | 22 May 2017 |
| 973 | livingwellinthailand.com | GoDaddy.com, LLC | 22 May 2016 | 22 May 2016 | 22 May 2017 |
| 974 | livingwellcounseling.life | NameCheap, Inc. | 24 May 2016 | 29 Apr 2024 | 24 May 2025 |
| 975 | livingwelllifestyle.site | - | 10 May 2016 | 10 May 2016 | 10 May 2017 |
| 976 | livingwellwithillness.online | - | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 977 | livingwellmd.live | GoDaddy.com, LLC | 4 May 2016 | 4 May 2016 | 4 May 2017 |
| 978 | livingwellshop.com | eNom, Inc. | 27 May 2016 | 25 May 2024 | 27 May 2025 |
| 979 | livingwellinrockymount.com | - | 27 May 2016 | 27 May 2016 | 27 May 2017 |
| 980 | livingwellafter40.com | eNom, Inc. | 30 Apr 2020 | 30 Apr 2020 | 30 Apr 2021 |
| 981 | livingwellglowinfo.com | eNom, Inc. | 31 May 2016 | 2 May 2017 | 31 May 2018 |
| 982 | livingwellthermography.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 1 Jun 2017 | 2 Jun 2018 |
| 983 | livingwellandinspired.com | eNom, Inc. | 14 Nov 2016 | 14 Nov 2016 | 14 Nov 2017 |
| 984 | livingwellhme.ca | - | 30 Oct 2014 | 6 Nov 2023 | 30 Oct 2025 |
| 985 | livingwellchurch.org | NameCheap, Inc. | 3 Jan 2005 | 9 Dec 2024 | 3 Jan 2026 |
| 986 | livingwellnavigator.org | Instra Corporation Pty Ltd. | 12 Feb 2013 | 12 Jan 2025 | 12 Feb 2026 |
| 987 | livingwellnavigator.net | Instra Corporation Pty Ltd. | 12 Feb 2013 | 15 Jan 2025 | 12 Feb 2026 |
| 988 | livingwellnavigator.com | Instra Corporation Pty Ltd. | 25 Sep 2012 | 15 Jan 2025 | 25 Sep 2025 |
| 989 | livingwellness365.com | GoDaddy.com, LLC | 5 Aug 2023 | 6 Aug 2023 | 5 Aug 2025 |
| 990 | livingwellfr.com | Tucows Domains Inc. | 3 Jun 2014 | 3 Jun 2014 | 3 Jun 2017 |
| 991 | livingwellus.com | GoDaddy.com, LLC | 8 Jun 2016 | 22 Sep 2022 | 8 Jun 2026 |
| 992 | livingwellassistedliving.com | GoDaddy.com, LLC | 7 Feb 2020 | 8 Feb 2025 | 7 Feb 2028 |
| 993 | livingwellsenior.com | GoDaddy.com, LLC | 9 Jun 2016 | 10 Jun 2023 | 9 Jun 2025 |
| 994 | livingwellfamilycare.net | GoDaddy.com, LLC | 12 Jun 2016 | 12 Jun 2016 | 12 Jun 2017 |
| 995 | livingwellfamilycare.info | GoDaddy.com, LLC | 12 Jun 2016 | 12 Jun 2016 | 12 Jun 2017 |
| 996 | livingwellfamilycare.com | TurnCommerce, Inc. DBA NameBright.com | 29 Aug 2017 | 8 Oct 2024 | 29 Aug 2024 |
| 997 | livingwellfamilycare.org | GoDaddy.com, LLC | 12 Jun 2016 | 12 Jun 2016 | 12 Jun 2017 |
| 998 | livingwellbookkeeping.com | Google, Inc. | 13 Jun 2016 | 13 Jun 2024 | 13 Jun 2025 |
| 999 | livingwellnow.biz | Tucows Domains Inc. | 11 Jun 2009 | 14 Jun 2018 | 10 Jun 2018 |
| 1000 | livingwellandsanmiguel.com | Internet Domain Services BS Corp | 21 Dec 2008 | 21 May 2016 | 21 Dec 2017 |
Displaying 1,000 out of 4,418 domains starting with the keyword "LIVINGWELL". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=livingwell
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |