With support for 
Keyword: LEORA
Reverse Whois » KEYWORD [leora ] { 1,276 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | leora.org | eNom, Inc. | 27 May 2009 | 28 May 2025 | 27 May 2026 |
| 2 | leora.hiphop | Uniregistrar Corp | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 3 | leora.nyc | Go Montenegro Domains, LLC | 8 Oct 2014 | 8 Oct 2014 | 7 Oct 2015 |
| 4 | leora.guru | GoDaddy.com, LLC | 23 Mar 2015 | 23 Mar 2015 | 23 Mar 2016 |
| 5 | leora.info | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2015 | 14 Sep 2024 | 9 Sep 2025 |
| 6 | leora.feedback | Reserved for non-billable transactions where Regis… | 15 Oct 2015 | 30 Nov 2024 | 15 Oct 2025 |
| 7 | leora.com | Network Solutions, LLC | 11 Apr 1999 | 30 Mar 2025 | 11 Apr 2027 |
| 8 | leora.fit | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 9 | leora.top | Namesilo, LLC | 8 Aug 2023 | 17 Oct 2024 | 8 Aug 2025 |
| 10 | leora.club | Key-Systems, LLC | 17 Jan 2016 | 28 Mar 2025 | 16 Jan 2026 |
| 11 | leora.tech | - | 12 May 2016 | 12 May 2016 | 12 May 2017 |
| 12 | leora.sexy | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 13 | leora.lol | Uniregistrar Corp | 12 Aug 2015 | 16 Jul 2016 | 12 Aug 2017 |
| 14 | leora.biz | Tucows Domains Inc. | 22 Apr 2010 | 25 Apr 2018 | 21 Apr 2018 |
| 15 | leora.life | CommuniGal Communication Ltd. | 30 Apr 2024 | 30 Apr 2025 | 30 Apr 2026 |
| 16 | leora.vip | Dynadot, LLC | 28 Aug 2022 | 28 Aug 2023 | 28 Aug 2023 |
| 17 | leora.co | BigRock Solutions Ltd. | 8 Dec 2015 | 19 Dec 2024 | 7 Dec 2025 |
| 18 | leora.us | CommuniGal Communication Ltd. | 11 Aug 2024 | 12 May 2025 | 11 Aug 2025 |
| 19 | leora.net | 1&1 Internet AG | 19 Oct 1999 | 20 Oct 2024 | 19 Oct 2025 |
| 20 | leora.xyz | Network Solutions, LLC | 29 Jun 2014 | 14 Aug 2024 | 29 Jun 2025 |
| 21 | leora.online | West263 International Limited | 23 Jan 2017 | 17 Feb 2017 | 23 Jan 2018 |
| 22 | leora.cricket | Namesilo, LLC | 28 Jan 2017 | 5 Apr 2017 | 27 Jan 2018 |
| 23 | leora.me | Domain.com, LLC | 3 Apr 2016 | 18 Apr 2017 | 3 Apr 2018 |
| 24 | leora.fr | - | 27 Jul 2009 | 31 Oct 2024 | 29 Sep 2025 |
| 25 | leora.style | Name.com, Inc. | 10 Feb 2018 | 26 Mar 2025 | 10 Feb 2025 |
| 26 | leora.site | Network Solutions, LLC | 28 Oct 2018 | 28 Oct 2018 | 28 Oct 2019 |
| 27 | leora.lighting | GoDaddy.com, LLC | 27 Aug 2020 | 11 Oct 2024 | 27 Aug 2025 |
| 28 | leora.one | One.com A/S | 20 Jun 2021 | 20 Jul 2023 | 20 Jun 2023 |
| 29 | leora.pro | Regional Network Information Center, JSC dba RU-CE… | 22 Oct 2021 | 19 Oct 2024 | 22 Oct 2025 |
| 30 | leora.group | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 16 Mar 2025 | 12 Apr 2025 | 16 Mar 2026 |
| 31 | leora.world | CommuniGal Communication Ltd. | 16 Aug 2024 | 21 Aug 2024 | 16 Aug 2025 |
| 32 | leora.id | - | 6 Dec 2020 | 6 Dec 2022 | 6 Dec 2023 |
| 33 | leora.co.uk | - | 7 Jan 2025 | 8 Jan 2025 | 7 Jan 2026 |
| 34 | leora.app | GoDaddy.com, LLC | 19 Apr 2022 | 4 May 2025 | 19 Apr 2026 |
| 35 | leora.blog | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Feb 2018 | 27 Mar 2025 | 9 Feb 2026 |
| 36 | leora.ai | - | - | - | - |
| 37 | leora.store | CommuniGal Communication Ltd. | 28 Jun 2024 | 2 Aug 2024 | 28 Jun 2025 |
| 38 | leora.fashion | GoDaddy.com, LLC | 17 Feb 2018 | 23 Feb 2025 | 17 Feb 2026 |
| 39 | leora.ie | - | 11 Jun 2019 | 11 Jun 2023 | 11 Jun 2024 |
| 40 | leora.co.in | Key-Systems GmbH | 19 Jan 2021 | 3 Mar 2025 | 19 Jan 2025 |
| 41 | leora.it | - | 27 Oct 2016 | 8 Nov 2024 | 23 Oct 2025 |
| 42 | leora.nl | - | 11 Jan 2001 | 22 Apr 2020 | - |
| 43 | leora.uk | - | 19 Apr 2022 | 10 Aug 2024 | 19 Apr 2025 |
| 44 | leora.shop | NameCheap, Inc. | 10 May 2023 | 21 Jul 2024 | 10 May 2024 |
| 45 | leora.in | Dynadot, LLC | 15 Feb 2021 | 18 Apr 2025 | 15 Feb 2026 |
| 46 | leora.ae | - | - | - | - |
| 47 | leora.com.au | - | - | 21 Jan 2025 | - |
| 48 | leora.co.nz | - | 2 Mar 2023 | 16 Feb 2025 | - |
| 49 | leora.ru | - | 9 Dec 2009 | - | 9 Dec 2025 |
| 50 | leora.cz | - | 8 May 2023 | 9 May 2023 | 8 May 2024 |
| 51 | leora.legal | GoDaddy.com, LLC | 19 Aug 2024 | 24 Aug 2024 | 19 Aug 2025 |
| 52 | leora.dk | - | 13 May 2024 | - | 12 May 2026 |
| 53 | leora.ltd | Squarespace Domains LLC | 9 Sep 2024 | 14 Sep 2024 | 9 Sep 2025 |
| 54 | leora.gay | Porkbun, LLC | 18 Oct 2024 | 23 Oct 2024 | 18 Oct 2026 |
| 55 | leora.se | - | 20 Mar 2024 | 29 May 2025 | 20 Mar 2025 |
| 56 | leora.digital | GoDaddy.com, LLC | 17 Jan 2025 | 22 Jan 2025 | 17 Jan 2026 |
| 57 | leora.solutions | GoDaddy.com, LLC | 17 Jan 2025 | 22 Jan 2025 | 17 Jan 2026 |
| 58 | leora.cloud | GoDaddy.com, LLC | 17 Jan 2025 | 22 Jan 2025 | 17 Jan 2026 |
| 59 | leora.co.id | - | 28 Sep 2023 | - | 28 Sep 2025 |
| 60 | leora.company | Tucows Domains Inc. | 2 Mar 2025 | 7 Mar 2025 | 2 Mar 2026 |
| 61 | leoraw.com | NameCheap, Inc. | 2 Jun 2001 | 3 May 2025 | 2 Jun 2026 |
| 62 | leoratech.com | One.com A/S | 28 Jul 2024 | 2 Aug 2024 | 28 Jul 2025 |
| 63 | leorangesalon.com | Brandon Gray Internet Services, Inc. (dba NameJuic… | 22 Oct 2014 | 22 Jun 2017 | 22 Oct 2017 |
| 64 | leoramirezphoto.com | Tucows Domains Inc. | 21 Oct 2009 | 13 Nov 2024 | 21 Oct 2025 |
| 65 | leorade.com | GoDaddy.com, LLC | 29 May 2013 | 30 May 2015 | 29 May 2016 |
| 66 | leorabella.com | Domain.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2016 |
| 67 | leoraperfume.com | Tucows Domains Inc. | 31 Oct 2014 | 4 Nov 2015 | 31 Oct 2016 |
| 68 | leoradesigns.com | Domain.com, LLC | 2 Dec 2023 | 2 Dec 2023 | 2 Dec 2025 |
| 69 | leorafashionjewelry.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Nov 2010 | 12 Mar 2015 | 11 Nov 2015 |
| 70 | leorasport.com | Tucows Domains Inc. | 5 Nov 2014 | 9 Nov 2024 | 5 Nov 2025 |
| 71 | leoraellingson.com | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2016 |
| 72 | leoralowenthal.com | GoDaddy.com, LLC | 23 Aug 2014 | 24 Aug 2016 | 23 Aug 2018 |
| 73 | leorange.com | HiChina Zhicheng Technology Limited | 9 Aug 2006 | 12 Dec 2018 | 9 Aug 2025 |
| 74 | leoraclebey.com | Gandi SAS | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 75 | leoramorris.com | Tucows Domains Inc. | 17 Aug 2014 | 19 Jul 2024 | 17 Aug 2025 |
| 76 | leoraul.net | GMO Internet Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 77 | leoraint.info | GoDaddy.com, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 78 | leorajewelery.com | GoDaddy.com, LLC | 15 Nov 2014 | 14 Nov 2022 | 15 Nov 2027 |
| 79 | leorangerie.com | GoDaddy.com, LLC | 7 Sep 2014 | 5 Sep 2016 | 7 Sep 2017 |
| 80 | leorandsarah.com | DreamHost, LLC | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 81 | leoraellingsonfitness.com | GoDaddy.com, LLC | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2016 |
| 82 | leorafarr.info | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 83 | leorafarr.net | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 84 | leorafarr.org | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 85 | leoraonline.com | register.com, Inc. | 11 Oct 2014 | 25 Sep 2016 | 11 Oct 2017 |
| 86 | leoratravels.com | GoDaddy.com, LLC | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2015 |
| 87 | leorage.com | GoDaddy.com, LLC | 19 May 2025 | 20 May 2025 | 19 May 2026 |
| 88 | leoraya.com | 10dencehispahard, S.L. | 25 Nov 2014 | 26 Nov 2020 | 25 Nov 2025 |
| 89 | leoralight.com | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2017 |
| 90 | leoradonavon.com | Google, Inc. | 23 Sep 2016 | 24 Oct 2017 | 23 Sep 2017 |
| 91 | leoraisrael.com | DROPCATCH.COM 810 LLC | 1 Mar 2018 | 1 Mar 2018 | 1 Mar 2019 |
| 92 | leoradappenhealthandwellness.com | GoDaddy.com, LLC | 21 Dec 2014 | 22 Dec 2023 | 21 Dec 2025 |
| 93 | leoraschiff.photography | GoDaddy.com, LLC | 13 Aug 2014 | 4 Jul 2024 | 13 Aug 2026 |
| 94 | leorah.com | TurnCommerce, Inc. DBA NameBright.com | 26 Mar 2016 | 3 Mar 2021 | 26 Mar 2026 |
| 95 | leorapacheco.com | GoDaddy.com, LLC | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2017 |
| 96 | leoracounselling.com | GoDaddy.com, LLC | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2016 |
| 97 | leoradappen.com | GoDaddy.com, LLC | 9 Feb 2015 | 9 Feb 2024 | 9 Feb 2026 |
| 98 | leorayair.com | GoDaddy.com, LLC | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2017 |
| 99 | leoradra.com | Xin Net Technology Corporation | 9 May 2018 | 9 May 2018 | 9 May 2019 |
| 100 | leoraartist.com | GoDaddy.com, LLC | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2017 |
| 101 | leorafragrance.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 102 | leoracabins.com | register.com, Inc. | 23 Mar 2015 | 24 Mar 2025 | 23 Mar 2026 |
| 103 | leorannikko.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Feb 2020 | 6 Feb 2020 | 6 Feb 2021 |
| 104 | leoradore.com | Tucows Domains Inc. | 16 Jul 2015 | 20 Jul 2023 | 16 Jul 2024 |
| 105 | leorafashion.com | Web Commerce Communications Limited dba WebNic.cc | 29 Aug 2015 | 28 Aug 2024 | 29 Aug 2025 |
| 106 | leorain.work | GoDaddy.com, LLC | 4 Sep 2015 | 4 Sep 2015 | 4 Sep 2016 |
| 107 | leorafridman.com | GoDaddy.com, LLC | 14 Apr 2015 | 15 Apr 2025 | 14 Apr 2030 |
| 108 | leoram.com | NameCheap, Inc. | 1 Jul 2024 | 24 Feb 2025 | 1 Jul 2025 |
| 109 | leorasameni.com | Wild West Domains, LLC | 19 Apr 2015 | 24 Apr 2025 | 19 Apr 2026 |
| 110 | leoraarielgross.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 111 | leoramosgroup.com | Interplanet, S.A. De C.V. | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2017 |
| 112 | leorayemarshallcorbin.com | GoDaddy.com, LLC | 11 May 2015 | 11 May 2015 | 11 May 2016 |
| 113 | leoradetox.com | - | - | - | - |
| 114 | leoralikes.com | GoDaddy.com, LLC | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 115 | leorat.com | DOMAIN NAME NETWORK PTY LTD | 24 Oct 2024 | 24 Oct 2024 | 24 Oct 2025 |
| 116 | leoraten.com | GoDaddy.com, LLC | 13 Jan 2017 | 13 Jan 2017 | 13 Jan 2019 |
| 117 | leoramonay.com | GoDaddy.com, LLC | 9 May 2017 | 9 May 2017 | 9 May 2019 |
| 118 | leorabello.net | GoDaddy.com, LLC | 21 Jun 2015 | 21 Jun 2015 | 21 Jun 2016 |
| 119 | leoragal.com | GoDaddy.com, LLC | 22 Sep 2015 | 22 Sep 2015 | 22 Sep 2017 |
| 120 | leoral.com | 1API GmbH | 22 Jan 2024 | 7 Mar 2025 | 22 Jan 2025 |
| 121 | leoraderechin.com | GoDaddy.com, LLC | 6 Jul 2015 | 6 Jul 2015 | 6 Jul 2017 |
| 122 | leoraleum.com | register.com, Inc. | 8 Jul 2015 | 8 Jul 2015 | 8 Jul 2016 |
| 123 | leoraz.com | Google, Inc. | 9 Aug 2021 | 8 Sep 2024 | 9 Aug 2024 |
| 124 | leora2.review | Key-Systems, LLC | 28 Sep 2015 | 29 Sep 2015 | 27 Sep 2016 |
| 125 | leoramsy.com | GoDaddy.com, LLC | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 126 | leoragonzales.com | FastDomain Inc. | 4 Aug 2015 | 19 Jul 2024 | 4 Aug 2025 |
| 127 | leoralane.com | Network Solutions, LLC | 3 Oct 2015 | 15 Aug 2024 | 3 Oct 2025 |
| 128 | leoracle.com | Global Domain Name Trading Center Ltd | 6 Jan 2022 | 6 Jan 2022 | 6 Jan 2023 |
| 129 | leoragusa.com | GoDaddy.com, LLC | 5 Mar 2018 | 15 Mar 2024 | 5 Mar 2026 |
| 130 | leorakatz.com | eNom, Inc. | 9 Oct 2015 | 11 Oct 2016 | 9 Oct 2017 |
| 131 | leorankin.com | Pheenix, Inc. | 22 Oct 2015 | 22 Oct 2015 | 22 Oct 2016 |
| 132 | leoragarments.com | BigRock Solutions Ltd. | 22 Oct 2015 | 22 Oct 2015 | 22 Oct 2016 |
| 133 | leorakatzmarketing.com | GoDaddy.com, LLC | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 134 | leorakatzconsulting.com | GoDaddy.com, LLC | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 135 | leora-software.com | Wild West Domains, LLC | 11 Nov 2015 | 16 Oct 2024 | 11 Nov 2025 |
| 136 | leorabbit.com | eNom, Inc. | 13 Nov 2015 | 13 Nov 2015 | 13 Nov 2020 |
| 137 | leorazera.com | Tucows Domains Inc. | 17 Nov 2015 | 26 Apr 2025 | 17 Nov 2025 |
| 138 | leorahmani.com | Hostinger, UAB | 16 Nov 2015 | 22 Oct 2024 | 16 Nov 2025 |
| 139 | leorade.work | Mesh Digital Limited | 19 Nov 2015 | 19 Nov 2015 | 19 Nov 2016 |
| 140 | leoragoldberg.com | GoDaddy.com, LLC | 29 Nov 2015 | 29 Nov 2015 | 29 Nov 2017 |
| 141 | leoranome.org | Launchpad, Inc. | 30 Nov 2015 | 30 Nov 2015 | 30 Nov 2016 |
| 142 | leorainenterprises.com | GoDaddy.com, LLC | 11 Dec 2015 | 11 Dec 2015 | 11 Dec 2016 |
| 143 | leoralegacy.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 13 Dec 2015 | 13 Dec 2015 | 13 Dec 2016 |
| 144 | leoraled.com | - | 9 Apr 2022 | 10 Apr 2023 | 9 Apr 2024 |
| 145 | leoranetwork.com | GoDaddy.com, LLC | 31 Dec 2015 | 31 Dec 2015 | 31 Dec 2017 |
| 146 | leora-beauty.com | CV. Rumahweb Indonesia | 5 Jan 2016 | - | 5 Jan 2018 |
| 147 | leorabeachmauritius.com | LiquidNet Ltd. | 8 Jan 2016 | 1 Jan 2024 | 8 Jan 2026 |
| 148 | leorasportswear.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 149 | leorasports.com | Tucows Domains Inc. | 23 Nov 2024 | 23 Nov 2024 | 23 Nov 2025 |
| 150 | leoranutrition.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 151 | leoralife.com | GoDaddy.com, LLC | 25 Jan 2021 | 6 Apr 2024 | 25 Jan 2024 |
| 152 | leoraathletica.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 153 | leoraactive.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 154 | leoramcgonigle.xyz | TLD Registrar Solutions Ltd. | 30 Nov 2015 | 6 Jan 2016 | 30 Nov 2017 |
| 155 | leoran.top | Alpnames Limited | 11 Jan 2016 | 11 Jan 2016 | 11 Jan 2017 |
| 156 | leoraha.us | GMO Internet Inc. | 31 Mar 2017 | 9 Apr 2017 | 30 Mar 2018 |
| 157 | leoran.link | Alpnames Limited | 13 Jan 2016 | 23 Feb 2017 | 13 Jan 2017 |
| 158 | leorazzi.info | Network Solutions, LLC | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 159 | leoraems.com | Tucows Domains Inc. | 19 Jan 2016 | 23 Jan 2017 | 19 Jan 2017 |
| 160 | leorakrygier.net | Tucows Domains Inc. | 22 Jan 2016 | 26 Apr 2025 | 22 Jan 2026 |
| 161 | leorasoft.com | Hosting Concepts B.V. dba Openprovider | 22 Jun 2020 | 22 Jun 2020 | 22 Jun 2021 |
| 162 | leoraasa.com | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2025 | 30 Jan 2026 |
| 163 | leoradiadores.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Sep 2020 | 7 Apr 2025 | 7 Sep 2026 |
| 164 | leoralightwoman.com | Webfusion Ltd. | 4 Feb 2016 | 4 Feb 2016 | 4 Feb 2018 |
| 165 | leoramari.com | GoDaddy.com, LLC | 22 Feb 2016 | 22 Feb 2016 | 22 Feb 2017 |
| 166 | leorasurfaces.com | Network Solutions, LLC | 22 Feb 2016 | 23 Jan 2025 | 22 Feb 2026 |
| 167 | leoramichael-dental.com | Tucows Domains Inc. | 22 Feb 2016 | 4 Apr 2023 | 22 Feb 2023 |
| 168 | leorangeavadi.com | Good Domain Registry Pvt Ltd. | 22 May 2017 | 22 Jul 2017 | 22 May 2018 |
| 169 | leorank.com | - | 28 Apr 2023 | 18 Mar 2024 | 28 Apr 2026 |
| 170 | leoram.net | GoDaddy.com, LLC | 28 Feb 2016 | 28 Feb 2016 | 28 Feb 2017 |
| 171 | leoraul.com | Tucows Domains Inc. | 3 Mar 2016 | 2 Mar 2025 | 3 Mar 2026 |
| 172 | leorafhel.com | register.com, Inc. | 8 Mar 2016 | 9 Mar 2016 | 8 Mar 2017 |
| 173 | leoraavidan.net | Tucows Domains Inc. | 11 Mar 2005 | 15 Mar 2021 | 11 Mar 2021 |
| 174 | leoraavidan.com | Tucows Domains Inc. | 11 Mar 2005 | 15 Mar 2021 | 11 Mar 2021 |
| 175 | leoramaynor.xyz | NameCheap, Inc. | 11 Mar 2016 | 30 Mar 2016 | 11 Mar 2017 |
| 176 | leorafurniture.com | Tucows Domains Inc. | 18 Mar 2016 | 22 Mar 2017 | 18 Mar 2017 |
| 177 | leorait.space | GoDaddy.com, LLC | 20 Mar 2016 | 20 Mar 2016 | 20 Mar 2017 |
| 178 | leorangeblossom.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Mar 2016 | 20 Mar 2016 | 20 Mar 2017 |
| 179 | leorait.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Jan 2024 | 4 Mar 2024 | 3 Jan 2026 |
| 180 | leorastarkey.com | eNom, Inc. | 23 Mar 2016 | 23 Mar 2016 | 23 Mar 2017 |
| 181 | leoramt2.com | REALTIME REGISTER BV | 25 Mar 2016 | 25 Mar 2016 | 25 Mar 2017 |
| 182 | leorapaige.com | Tucows Domains Inc. | 4 Apr 2016 | 8 Apr 2017 | 4 Apr 2017 |
| 183 | leorandsmokey.com | GoDaddy.com, LLC | 5 Apr 2016 | 5 Apr 2016 | 5 Apr 2017 |
| 184 | leoragolightly.com | GoDaddy.com, LLC | 6 Apr 2016 | 6 Apr 2016 | 6 Apr 2017 |
| 185 | leoraintl.org | Tucows Domains Inc. | 8 Apr 2016 | 26 Apr 2025 | 8 Apr 2026 |
| 186 | leorap.com | BigRock Solutions Ltd. | 9 Apr 2016 | 15 May 2017 | 9 Apr 2018 |
| 187 | leora-jewelery.com | Regional Network Information Center, JSC dba RU-CE… | 16 Apr 2014 | 16 Apr 2014 | 16 Apr 2017 |
| 188 | leorauch.com | Mesh Digital Limited | 21 Apr 2016 | 20 Apr 2025 | 21 Apr 2026 |
| 189 | leoraleon.com | Domain.com, LLC | 23 Apr 2016 | 8 Apr 2025 | 23 Apr 2026 |
| 190 | leorapumps.com | GoDaddy.com, LLC | 19 May 2016 | 17 May 2017 | 19 May 2018 |
| 191 | leorasoftware.com | eNom659, Inc. | 30 Oct 2021 | 31 Oct 2021 | 30 Oct 2022 |
| 192 | leoralawson.com | GoDaddy.com, LLC | 24 May 2016 | 24 May 2016 | 24 May 2017 |
| 193 | leoraguseo.com | GoDaddy.com, LLC | 22 Feb 2019 | 22 Feb 2019 | 22 Feb 2020 |
| 194 | leoranagtalon.top | - | 29 May 2016 | 29 May 2016 | 29 May 2017 |
| 195 | leoravioleo.com | NameCheap, Inc. | 2 Jun 2016 | 3 Jun 2024 | 2 Jun 2025 |
| 196 | leorasjewelry.com | Tucows Domains Inc. | 3 Jun 2016 | 7 Jun 2017 | 3 Jun 2017 |
| 197 | leoraleelingerie.com | GoDaddy.com, LLC | 3 Jun 2016 | 3 Jun 2016 | 3 Jun 2017 |
| 198 | leoraserini.xyz | - | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 199 | leorahalbach.xyz | Super Registry Inc. | 2 Jun 2016 | 23 Aug 2017 | 2 Jun 2018 |
| 200 | leoravictoria.com | GoDaddy.com, LLC | 10 Jun 2016 | 10 Jun 2016 | 10 Jun 2017 |
| 201 | leoraviercompany.com | OVH sas | 13 Nov 2009 | 14 Nov 2024 | 13 Nov 2024 |
| 202 | leoraitsolutions.com | Good Domain Registry Pvt Ltd. | 23 Apr 2018 | 23 Apr 2018 | 23 Apr 2019 |
| 203 | leoravier.com | OVH sas | 23 Jul 2002 | 24 Jul 2024 | 23 Jul 2025 |
| 204 | leorayos.com | 1&1 Internet AG | 18 Jun 2016 | 18 Jun 2016 | 18 Jun 2025 |
| 205 | leorahartman.com | Google, Inc. | 4 Nov 2020 | 4 Jan 2025 | 4 Nov 2024 |
| 206 | leorajoy.com | Tucows Domains Inc. | 7 Jun 2016 | 23 May 2025 | 7 Jun 2026 |
| 207 | leoratec.org | Tucows Domains Inc. | 11 Jul 2016 | 1 Jul 2024 | 11 Jul 2025 |
| 208 | leoratec.com | Tucows Domains Inc. | 11 Jul 2016 | 26 Jun 2024 | 11 Jul 2025 |
| 209 | leoraandorwedding.com | GoDaddy.com, LLC | 10 Jul 2016 | 10 Jul 2016 | 10 Jul 2017 |
| 210 | leoratech.in | GoDaddy.com, LLC | 10 Dec 2015 | 20 Dec 2024 | 10 Dec 2025 |
| 211 | leora-perlengedanken.com | PSI-USA, Inc. dba Domain Robot | 13 Jul 2016 | 31 Jan 2025 | 13 Jul 2025 |
| 212 | leoraamir.biz | GoDaddy.com, LLC | 15 May 2011 | 13 Aug 2016 | 14 May 2021 |
| 213 | leorakadisha.biz | Network Solutions, LLC | 6 Jun 2012 | 6 Jun 2012 | 5 Jun 2017 |
| 214 | leora-freedman.biz | Tucows Domains Inc. | 8 Jun 2009 | 28 May 2024 | 7 Jun 2026 |
| 215 | leoraelghan.com | GoDaddy.com, LLC | 18 Jul 2016 | 18 Jul 2016 | 18 Jul 2018 |
| 216 | leoraconway.com | Domain.com, LLC | 21 Jul 2016 | 1 Jul 2024 | 21 Jul 2025 |
| 217 | leorazellman.com | Beijing Lanhai Jiye Technology Co., Ltd | 26 Jun 2022 | 28 Aug 2024 | 26 Jun 2024 |
| 218 | leoraa.com | Google, Inc. | 20 Oct 2024 | 4 Nov 2024 | 20 Oct 2025 |
| 219 | leoratissue.com | - | 27 Jul 2016 | 27 Jul 2016 | 27 Jul 2017 |
| 220 | leorarose.com | Launchpad, Inc. | 17 May 2016 | 20 May 2022 | 17 May 2027 |
| 221 | leorastogi.com | GoDaddy.com, LLC | 15 Aug 2016 | 21 Sep 2024 | 15 Aug 2025 |
| 222 | leorama-app.com | - | 17 Aug 2013 | 17 Aug 2013 | 17 Aug 2017 |
| 223 | leoraj.com | GoDaddy.com, LLC | 31 Aug 2010 | 30 Aug 2015 | 31 Aug 2016 |
| 224 | leoramosdt.com | Tucows Domains Inc. | 12 Jul 2021 | 12 Jul 2024 | 12 Jul 2025 |
| 225 | leorasmusic.com | Tucows Domains Inc. | 26 Aug 2016 | 28 Apr 2025 | 26 Aug 2025 |
| 226 | leorado.com | EPAG Domainservices GmbH | 24 Aug 2016 | 25 Aug 2024 | 24 Aug 2025 |
| 227 | leoracle25.com | Beijing Lanhai Jiye Technology Co., Ltd | 15 Nov 2023 | 20 Apr 2025 | 15 Nov 2025 |
| 228 | leorawright.link | Uniregistrar Corp | 2 Sep 2016 | 7 Sep 2017 | 2 Sep 2018 |
| 229 | leoranosko.com | Automattic Inc. | 1 Sep 2011 | 28 Aug 2024 | 1 Sep 2025 |
| 230 | leorapaz.com | GoDaddy.com, LLC | 3 Jul 2007 | 13 Nov 2022 | 3 Jul 2025 |
| 231 | leorahc.com | Corehub, S.R.L. | 6 Feb 2012 | 20 Jun 2023 | 6 Feb 2026 |
| 232 | leorabeauty.com | Moniker Online Services LLC | 22 Jan 2014 | 20 Jan 2025 | 22 Jan 2026 |
| 233 | leorama.com | GoDaddy.com, LLC | 26 Apr 2021 | 11 Mar 2025 | 26 Apr 2026 |
| 234 | leorashemesh.com | GoDaddy.com, LLC | 24 Feb 2009 | 14 Feb 2024 | 24 Feb 2029 |
| 235 | leoraveit.com | GoDaddy.com, LLC | 9 Jan 2014 | 14 Jan 2016 | 9 Jan 2017 |
| 236 | leoradelpacifico.com | eNom, Inc. | 22 Mar 2007 | 22 Mar 2017 | 22 Mar 2018 |
| 237 | leorangel.com | NameCheap, Inc. | 14 Aug 2007 | 14 Aug 2024 | 14 Aug 2025 |
| 238 | leoraglass.com | GoDaddy.com, LLC | 4 Mar 2009 | 1 Feb 2015 | 4 Mar 2018 |
| 239 | leorayart.com | GKG.NET, INC. | 4 Dec 2013 | 10 Dec 2024 | 4 Dec 2025 |
| 240 | leorasolutions.com | NameCheap, Inc. | 17 Oct 2013 | 16 Nov 2024 | 17 Oct 2025 |
| 241 | leorandsamantha.com | GoDaddy.com, LLC | 5 Apr 2011 | 6 Apr 2025 | 5 Apr 2026 |
| 242 | leoraconcept.com | Tucows Domains Inc. | 24 Feb 2014 | 23 Feb 2025 | 24 Feb 2026 |
| 243 | leorafrankel.com | GoDaddy.com, LLC | 24 Jan 2009 | 5 Sep 2022 | 24 Jan 2029 |
| 244 | leorapacifico.com | - | 7 Jun 2023 | 9 Aug 2024 | 7 Jun 2024 |
| 245 | leoraisaacs.com | GoDaddy.com, LLC | 30 Aug 2013 | 31 Aug 2023 | 30 Aug 2025 |
| 246 | leoraworld.com | GoDaddy.com, LLC | 19 Nov 2013 | 19 Nov 2015 | 19 Nov 2016 |
| 247 | leoragoren.com | DreamHost, LLC | 21 Jun 2007 | 21 May 2025 | 22 Jun 2026 |
| 248 | leorace.com | GoDaddy.com, LLC | 6 Jan 2021 | 6 Jan 2021 | 6 Jan 2023 |
| 249 | leora-therapy.com | eNom, Inc. | 22 Sep 2010 | 27 Aug 2016 | 22 Sep 2016 |
| 250 | leorantiaging.com | GoDaddy.com, LLC | 27 Feb 2014 | 20 Mar 2015 | 27 Feb 2017 |
| 251 | leoraye.com | GoDaddy.com, LLC | 14 Jul 2014 | 15 Jul 2024 | 14 Jul 2025 |
| 252 | leorapini.com | GoDaddy.com, LLC | 28 Sep 2024 | 28 Sep 2024 | 28 Sep 2026 |
| 253 | leoraronen.com | GoDaddy.com, LLC | 9 Dec 2009 | 10 Dec 2024 | 9 Dec 2025 |
| 254 | leorasharp.com | 1&1 Internet AG | 16 Mar 2013 | 2 Jan 2024 | 16 Mar 2026 |
| 255 | leoradunz.com | Launchpad, Inc. | 28 Feb 2023 | 28 Dec 2023 | 28 Feb 2026 |
| 256 | leora55.com | Jiangsu Bangning Science and technology Co. Ltd. | 12 Nov 2021 | 12 Nov 2021 | 12 Nov 2022 |
| 257 | leorazzi.com | Dynadot, LLC | 16 Oct 2024 | 26 Feb 2025 | 16 Oct 2025 |
| 258 | leorakrygier.com | - | 6 Oct 2024 | 6 Oct 2024 | 6 Oct 2025 |
| 259 | leoracaylor.com | GoDaddy.com, LLC | 3 Jun 2010 | 3 Jun 2024 | 3 Jun 2026 |
| 260 | leorakeramica.com | NameCheap, Inc. | 28 Sep 2012 | 29 Aug 2024 | 28 Sep 2025 |
| 261 | leoraygroup.com | 1&1 Internet AG | 25 Feb 2025 | 25 Feb 2025 | 25 Feb 2026 |
| 262 | leoracane.com | 1&1 Internet AG | 24 Jun 2011 | 14 Mar 2018 | 24 Jun 2025 |
| 263 | leoranges.com | Shanghai Meicheng Technology Information Co., Ltd | 27 May 2011 | 25 Jun 2018 | 27 May 2019 |
| 264 | leorakstewart.com | Tucows Domains Inc. | 3 Mar 2008 | 3 Feb 2025 | 3 Mar 2026 |
| 265 | leorafilms.com | Wix.com Ltd. | 7 Mar 2023 | 5 Feb 2025 | 7 Mar 2026 |
| 266 | leoramirez.com | Automattic Inc. | 16 Mar 2021 | 24 Feb 2025 | 16 Mar 2026 |
| 267 | leoramusic.com | GoDaddy.com, LLC | 21 May 2014 | 1 Jun 2016 | 21 May 2017 |
| 268 | leorainthorpe.com | GoDaddy.com, LLC | 16 Aug 2018 | 17 Aug 2024 | 16 Aug 2026 |
| 269 | leorafael.com | eNom, Inc. | 14 Jan 2012 | 16 Dec 2022 | 14 Jan 2028 |
| 270 | leora-cheshin.com | GoDaddy.com, LLC | 12 Mar 2003 | 19 Sep 2022 | 12 Mar 2027 |
| 271 | leoragivonimarketing.com | Crazy Domains FZ-LLC | 8 Sep 2010 | 4 Jul 2024 | 8 Sep 2025 |
| 272 | leoralutz.com | eNom, Inc. | 1 Jul 2005 | 1 Jul 2023 | 2 Jul 2026 |
| 273 | leoradeck.com | Cronon AG | 15 Jul 2009 | 3 Sep 2024 | 15 Jul 2025 |
| 274 | leoraarmstrong.com | register.com, Inc. | 24 Jun 2008 | 24 Jun 2024 | 24 Jun 2025 |
| 275 | leoragivoni.com | Crazy Domains FZ-LLC | 8 Sep 2010 | 4 Jul 2024 | 8 Sep 2025 |
| 276 | leoraasaart.com | GoDaddy.com, LLC | 19 Feb 2014 | 19 Feb 2015 | 19 Feb 2017 |
| 277 | leorawise.com | GoDaddy.com, LLC | 16 Mar 2006 | 17 Mar 2025 | 16 Mar 2027 |
| 278 | leoracalmus.com | 1&1 Internet AG | 5 Jun 2013 | 11 Sep 2022 | 5 Jun 2025 |
| 279 | leoraplatte.com | Name.com, Inc. | 27 Feb 2001 | 29 Jan 2025 | 27 Feb 2026 |
| 280 | leoralanz.com | Tucows Domains Inc. | 14 Apr 2014 | 30 Mar 2017 | 14 Apr 2018 |
| 281 | leorangeinfra.com | GoDaddy.com, LLC | 18 Aug 2013 | 30 Oct 2023 | 18 Aug 2023 |
| 282 | leorahalpernlanz.com | Tucows Domains Inc. | 14 Apr 2014 | 30 Mar 2017 | 14 Apr 2018 |
| 283 | leorahospitality.com | Tucows Domains Inc. | 14 Apr 2014 | 30 Mar 2017 | 14 Apr 2018 |
| 284 | leorathegeek.com | Domain.com, LLC | 14 Feb 2021 | 16 Apr 2021 | 14 Feb 2022 |
| 285 | leorahumancapital.com | Corehub, S.R.L. | 6 Feb 2012 | 20 Jun 2023 | 6 Feb 2026 |
| 286 | leorandi.com | Xin Net Technology Corporation | 8 Dec 2017 | 8 Dec 2017 | 8 Dec 2018 |
| 287 | leorajuster.com | Automattic Inc. | 4 Mar 2013 | 12 Feb 2025 | 4 Mar 2026 |
| 288 | leoralaser.com | GoDaddy.com, LLC | 1 Aug 2014 | 2 Aug 2016 | 1 Aug 2018 |
| 289 | leoraconsulting.com | Key-Systems GmbH | 12 Jul 2021 | 12 Jul 2021 | 12 Jul 2022 |
| 290 | leoraveysey.com | GoDaddy.com, LLC | 3 Dec 2009 | 19 Apr 2023 | 3 Dec 2026 |
| 291 | leorafalk.com | Wild West Domains, LLC | 7 Sep 2011 | 8 Aug 2024 | 7 Sep 2025 |
| 292 | leorancour.com | InlandDomains, LLC | 16 Sep 2013 | 4 Jul 2016 | 16 Sep 2016 |
| 293 | leoraweinreich.com | Wild West Domains, LLC | 7 Apr 2008 | 6 Apr 2016 | 7 Apr 2017 |
| 294 | leorasworld.com | GoDaddy.com, LLC | 24 Jun 2022 | 25 Jun 2024 | 24 Jun 2025 |
| 295 | leoracing.com | TurnCommerce, Inc. DBA NameBright.com | 29 Mar 2013 | 23 Mar 2021 | 29 Mar 2026 |
| 296 | leoratannenbaum.com | Tucows Domains Inc. | 10 Jun 2010 | 26 May 2025 | 10 Jun 2026 |
| 297 | leoraetgar.com | Domain.com, LLC | 22 May 2017 | 22 May 2017 | 22 May 2018 |
| 298 | leorafulvio.com | Tucows Domains Inc. | 11 Aug 2009 | 16 Aug 2024 | 11 Aug 2025 |
| 299 | leorashow.com | 1&1 Internet AG | 27 Sep 2012 | 14 Mar 2018 | 27 Sep 2025 |
| 300 | leoraymond.com | Tucows Domains Inc. | 22 Jan 2014 | 23 Apr 2025 | 22 Jan 2026 |
| 301 | leoratner.com | Name.com, Inc. | 17 Dec 2011 | 20 Nov 2024 | 17 Dec 2025 |
| 302 | leorasotto.com | eNom, Inc. | 1 Jul 2012 | 15 Jul 2024 | 1 Jul 2025 |
| 303 | leoray.com | Dynadot, LLC | 18 May 2023 | 21 Apr 2025 | 18 May 2026 |
| 304 | leorajean.com | HiChina Zhicheng Technology Limited | 14 Aug 2019 | 15 Aug 2019 | 14 Aug 2020 |
| 305 | leoradowling.com | GoDaddy.com, LLC | 17 May 2007 | 18 May 2025 | 17 May 2026 |
| 306 | leoralaor.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Feb 2004 | 9 Jan 2024 | 18 Feb 2026 |
| 307 | leorawlings.com | - | 24 Dec 2022 | 25 Jan 2024 | 24 Dec 2023 |
| 308 | leoralynnephotography.com | GoDaddy.com, LLC | 19 May 2014 | 20 May 2025 | 19 May 2026 |
| 309 | leorabello.com | DropCatch.com 1104 LLC | 1 Oct 2018 | 1 Oct 2018 | 1 Oct 2019 |
| 310 | leorafiskgrimes.com | Wild West Domains, LLC | 23 Mar 2010 | 24 Mar 2024 | 23 Mar 2026 |
| 311 | leora-freedman.com | Tucows Domains Inc. | 8 Jun 2009 | 24 May 2025 | 8 Jun 2026 |
| 312 | leorabellocontracting.com | GoDaddy.com, LLC | 5 Mar 2021 | 5 Mar 2021 | 5 Mar 2022 |
| 313 | leorasibony.com | Key-Systems GmbH | 9 Nov 2021 | 30 Jan 2025 | 9 Nov 2025 |
| 314 | leorantiwrinkle.com | GoDaddy.com, LLC | 27 Feb 2014 | 20 Mar 2015 | 27 Feb 2017 |
| 315 | leorahoffman.com | Network Solutions, LLC | 3 Dec 2001 | 4 Dec 2024 | 3 Dec 2027 |
| 316 | leorasatie.com | FastDomain Inc. | 30 Jun 2011 | 2 Aug 2016 | 30 Jun 2016 |
| 317 | leoradio.com | TurnCommerce, Inc. DBA NameBright.com | 21 Dec 2023 | 13 Feb 2025 | 21 Dec 2025 |
| 318 | leorandall.com | GoDaddy.com, LLC | 25 Jan 2012 | 26 Jan 2024 | 25 Jan 2026 |
| 319 | leoragreenburg.com | GoDaddy.com, LLC | 16 Jul 2014 | 17 Jul 2016 | 16 Jul 2018 |
| 320 | leorabrody.com | GoDaddy.com, LLC | 21 Feb 2013 | 21 Feb 2025 | 21 Feb 2026 |
| 321 | leoralee.com | GoDaddy.com, LLC | 4 Mar 2024 | 4 Mar 2024 | 4 Mar 2027 |
| 322 | leoraftopoulos.com | Melbourne IT, Ltd | 17 Feb 2014 | 16 Feb 2025 | 17 Feb 2026 |
| 323 | leoraskolkinsmith.com | Beijing Lanhai Jiye Technology Co., Ltd | 3 Jun 2023 | 14 Apr 2025 | 3 Jun 2025 |
| 324 | leoraskincare.com | Tucows Domains Inc. | 16 May 2014 | 17 Jun 2016 | 16 May 2019 |
| 325 | leoramarketing.com | Cosmotown, Inc. | 28 Mar 2025 | 28 Mar 2025 | 28 Mar 2026 |
| 326 | leora-designs.com | eNom, Inc. | 28 Nov 2010 | 2 Nov 2016 | 28 Nov 2017 |
| 327 | leorasalo.com | GoDaddy.com, LLC | 14 Jan 2004 | 4 Sep 2022 | 1 Jun 2025 |
| 328 | leorato.com | Mesh Digital Limited | 25 Feb 2010 | 26 Jan 2025 | 25 Feb 2026 |
| 329 | leorangery.com | GoDaddy.com, LLC | 7 Feb 2010 | 9 Feb 2025 | 7 Feb 2026 |
| 330 | leorautins.com | Realtime Register B.V. | 4 Nov 2022 | 18 Nov 2023 | 4 Nov 2023 |
| 331 | leoraives.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Feb 2014 | 5 Feb 2025 | 10 Feb 2026 |
| 332 | leorabelloconstruction.com | GoDaddy.com, LLC | 28 Feb 2012 | 30 Nov 2012 | 28 Feb 2017 |
| 333 | leorafarr.com | GoDaddy.com, LLC | 14 Nov 2013 | 24 Sep 2014 | 14 Nov 2016 |
| 334 | leoracanedesign.com | 1&1 Internet AG | 24 Jun 2011 | 14 Mar 2018 | 24 Jun 2025 |
| 335 | leoraperly.com | - | 4 Aug 2022 | 5 Aug 2023 | 4 Aug 2024 |
| 336 | leoramp.com | HiChina Zhicheng Technology Limited | 17 Sep 2013 | 14 Sep 2024 | 17 Sep 2025 |
| 337 | leorashalom.com | GoDaddy.com, LLC | 6 Mar 2012 | 1 Feb 2013 | 1 Feb 2018 |
| 338 | leoraanne.com | GoDaddy.com, LLC | 24 Sep 2011 | 24 Sep 2015 | 24 Sep 2016 |
| 339 | leorahotelhospitality.com | Tucows Domains Inc. | 14 Apr 2014 | 30 Mar 2017 | 14 Apr 2018 |
| 340 | leorabrecher.com | Network Solutions, LLC | 8 Feb 2005 | 10 Dec 2024 | 8 Feb 2026 |
| 341 | leorayeo.com | NameCheap, Inc. | 1 Jan 2013 | 6 Dec 2024 | 1 Jan 2026 |
| 342 | leoradvinsky.com | Brandsight, Inc. | 9 Aug 2005 | 5 Mar 2025 | 9 Aug 2028 |
| 343 | leoramirezg.com | Network Solutions, LLC | 18 Jan 2014 | 19 Dec 2024 | 18 Jan 2026 |
| 344 | leorabellino.com | GoDaddy.com, LLC | 22 Feb 2008 | 23 Feb 2025 | 22 Feb 2026 |
| 345 | leorakadisha.com | Network Solutions, LLC | 10 Jul 2008 | 29 Jan 2015 | 10 Jul 2017 |
| 346 | leoradubrovsky.com | Wild West Domains, LLC | 25 Apr 2000 | 26 Apr 2025 | 25 Apr 2026 |
| 347 | leorayingle.com | Network Solutions, LLC | 28 Feb 2010 | 5 Mar 2017 | 28 Feb 2019 |
| 348 | leoratrust.com | Domainshype.com, Inc. | 27 Feb 2013 | 29 Feb 2024 | 27 Feb 2027 |
| 349 | leoraslist.com | GoDaddy.com, LLC | 12 Aug 2011 | 13 Aug 2015 | 12 Aug 2017 |
| 350 | leoragatto.com | eNom, Inc. | 2 Aug 2012 | 9 Jul 2020 | 2 Aug 2025 |
| 351 | leorakrygierphotography.com | Tucows Domains Inc. | 28 Jan 2013 | 22 Apr 2025 | 28 Jan 2026 |
| 352 | leoragardner.com | GoDaddy.com, LLC | 9 Jul 2006 | 9 Jul 2024 | 9 Jul 2026 |
| 353 | leorabeachdesign.com | Beijing Lanhai Jiye Technology Co., Ltd | 5 Oct 2022 | 7 Dec 2024 | 5 Oct 2024 |
| 354 | leorad.com | Brandsight, Inc. | 14 Apr 2022 | 28 Feb 2025 | 14 Apr 2026 |
| 355 | leorasplett.com | GoDaddy.com, LLC | 3 Apr 2013 | 4 Apr 2025 | 3 Apr 2026 |
| 356 | leoraanderic.com | DreamHost, LLC | 27 Jun 2007 | 27 May 2024 | 27 Jun 2025 |
| 357 | leorahoneyman.com | Webfusion Ltd. | 7 Sep 2011 | 8 Sep 2024 | 7 Sep 2025 |
| 358 | leoramos.com | Internet Domain Services BS Corp | 3 May 1999 | 22 Mar 2025 | 31 Mar 2028 |
| 359 | leorapersonalfitness.com | 1&1 Internet AG | 27 Mar 2012 | 27 Mar 2016 | 27 Mar 2017 |
| 360 | leoracashe.com | Melbourne IT, Ltd | 19 Dec 1998 | 15 Dec 2024 | 19 Dec 2025 |
| 361 | leoraamir.com | GoDaddy.com, LLC | 5 Dec 2003 | 9 Sep 2022 | 5 Dec 2027 |
| 362 | leoramae.com | Domain.com, LLC | 10 Sep 2016 | 10 Sep 2016 | 10 Sep 2018 |
| 363 | leoratanenbaum.com | Tucows Domains Inc. | 20 Nov 2003 | 5 Nov 2024 | 20 Nov 2025 |
| 364 | leoraracca.us | NameCheap, Inc. | 9 Sep 2016 | 9 Sep 2016 | 8 Sep 2017 |
| 365 | leorawalterdds.com | Tucows Domains Inc. | 17 Oct 2018 | 16 Oct 2024 | 17 Oct 2025 |
| 366 | leoraasia.com | - | 16 Sep 2016 | 16 Sep 2016 | 16 Sep 2017 |
| 367 | leorahwood.com | Wix.com Ltd. | 28 Feb 2021 | 29 Jan 2025 | 28 Feb 2026 |
| 368 | leorazzi.space | Network Solutions, LLC | 9 Oct 2016 | 21 Nov 2017 | 9 Oct 2017 |
| 369 | leora-freedman.info | Tucows Domains Inc. | 8 Jun 2009 | 24 May 2025 | 8 Jun 2026 |
| 370 | leorakadisha.info | Network Solutions, LLC | 10 Jul 2008 | 8 Aug 2012 | 10 Jul 2017 |
| 371 | leoraamir.info | GoDaddy.com, LLC | 15 May 2011 | 16 May 2016 | 15 May 2021 |
| 372 | leoraamir.mobi | GoDaddy.com, LLC | 15 May 2011 | 16 May 2016 | 15 May 2021 |
| 373 | leoradi.com | Google, Inc. | 11 Oct 2016 | 26 Sep 2024 | 11 Oct 2025 |
| 374 | leora-freedman.net | Tucows Domains Inc. | 8 Jun 2009 | 24 May 2025 | 8 Jun 2026 |
| 375 | leoragivonimarketing.net | Crazy Domains FZ-LLC | 8 Sep 2010 | 4 Jul 2024 | 8 Sep 2025 |
| 376 | leoraskolkinsmith.net | FastDomain Inc. | 30 Mar 2004 | 18 Mar 2015 | 30 Mar 2018 |
| 377 | leoramos.net | 1API GmbH | 26 Oct 2013 | 21 Sep 2015 | 26 Oct 2016 |
| 378 | leoray.net | Google, Inc. | 26 Aug 2023 | 12 Aug 2024 | 26 Aug 2025 |
| 379 | leoracing.net | 1&1 Internet AG | 10 May 2013 | 11 May 2016 | 10 May 2018 |
| 380 | leorayeo.net | eNom, Inc. | 1 Jan 2013 | 26 Jan 2016 | 1 Jan 2017 |
| 381 | leoraamir.net | GoDaddy.com, LLC | 15 May 2011 | 15 May 2016 | 15 May 2021 |
| 382 | leorakadisha.net | Network Solutions, LLC | 6 Jun 2012 | 29 Jan 2015 | 6 Jun 2017 |
| 383 | leorasanders18gmail.net | GoDaddy.com, LLC | 2 Feb 2014 | 26 Jan 2015 | 2 Feb 2017 |
| 384 | leoraes.net | Tucows Domains Inc. | 22 Jul 2006 | 26 Jul 2021 | 22 Jul 2021 |
| 385 | leoragivoni.net | Crazy Domains FZ-LLC | 8 Sep 2010 | 4 Jul 2024 | 8 Sep 2025 |
| 386 | leorasoftware.co.uk | - | 21 Mar 2016 | 7 Mar 2017 | 21 Mar 2018 |
| 387 | leorankins.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Oct 2016 | 17 Oct 2017 | 18 Oct 2018 |
| 388 | leoradvinsky.org | GoDaddy.com, LLC | 11 Oct 2012 | 9 Jan 2025 | 11 Oct 2026 |
| 389 | leora-freedman.org | Tucows Domains Inc. | 8 Jun 2009 | 24 May 2025 | 8 Jun 2026 |
| 390 | leorama.org | Netowl, Inc. | 11 Oct 2013 | 23 Dec 2024 | 11 Oct 2024 |
| 391 | leoraamir.org | GoDaddy.com, LLC | 15 May 2011 | 16 May 2016 | 15 May 2021 |
| 392 | leorakadisha.org | Network Solutions, LLC | 6 Jun 2012 | 6 Aug 2012 | 6 Jun 2017 |
| 393 | leorahvc.com | Tucows Domains Inc. | 23 Oct 2016 | 27 Oct 2019 | 23 Oct 2019 |
| 394 | leorahcapital.com | Tucows Domains Inc. | 23 Oct 2016 | 27 Oct 2018 | 23 Oct 2018 |
| 395 | leorawilford.xyz | NameCheap, Inc. | 3 Jun 2016 | 27 Jun 2016 | 3 Jun 2017 |
| 396 | leoratoher55.xyz | NameCheap, Inc. | 2 Jun 2016 | 27 Jun 2016 | 2 Jun 2017 |
| 397 | leorajodi.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 398 | leoramaekers.xyz | OnlineNIC, Inc. | 2 Jun 2016 | 29 Jul 2016 | 2 Jun 2017 |
| 399 | leoraclemmie.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 400 | leorapaquette.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 401 | leoragesser.com | Tucows Domains Inc. | 26 Oct 2016 | 12 Oct 2024 | 26 Oct 2025 |
| 402 | leorato.de | - | - | 25 Jun 2012 | - |
| 403 | leoravera.it | - | 12 Feb 2013 | 23 Jan 2025 | 23 Jan 2026 |
| 404 | leoralove.com | GoDaddy.com, LLC | 19 Sep 2017 | 20 Sep 2023 | 19 Sep 2026 |
| 405 | leoragrace.co.uk | - | 24 Jun 2011 | 8 Jun 2015 | 24 Jun 2017 |
| 406 | leorasway.com | GoDaddy.com, LLC | 16 Nov 2016 | 21 Nov 2024 | 16 Nov 2026 |
| 407 | leorabkin.com | GoDaddy.com, LLC | 17 Nov 2016 | 18 Nov 2024 | 17 Nov 2026 |
| 408 | leoraandsam.com | Tucows Domains Inc. | 19 Nov 2016 | 23 Nov 2018 | 19 Nov 2018 |
| 409 | leorasolutions.net | Tucows Domains Inc. | 28 Nov 2016 | 2 Dec 2018 | 28 Nov 2018 |
| 410 | leoramcmahon.com | Synergy Wholesale Pty Ltd | 28 Nov 2016 | 28 Nov 2016 | 28 Nov 2017 |
| 411 | leoramoschaves.com | Network Solutions, LLC | 4 Dec 2016 | 4 Nov 2024 | 4 Dec 2025 |
| 412 | leoramosinsurance.com | Dynadot, LLC | 15 Apr 2021 | 15 Apr 2021 | 15 Apr 2022 |
| 413 | leoraugh.com | GoDaddy.com, LLC | 16 Dec 2016 | 30 Sep 2022 | 16 Dec 2026 |
| 414 | leoratalmor.com | GoDaddy.com, LLC | 4 Apr 2022 | 5 Apr 2025 | 4 Apr 2028 |
| 415 | leoraharmon.com | NameCheap, Inc. | 12 Jan 2017 | 1 Jan 2025 | 12 Jan 2026 |
| 416 | leoracy.com | Hefei Juming Network Technology Co., Ltd | 30 Nov 2022 | 1 Dec 2023 | 30 Nov 2024 |
| 417 | leorafashions.com | BigRock Solutions Ltd. | 2 Feb 2017 | 3 Apr 2017 | 2 Feb 2022 |
| 418 | leoralights.com | Tucows Domains Inc. | 22 Jan 2023 | 26 Jan 2024 | 22 Jan 2025 |
| 419 | leorasarethebomb.com | GoDaddy.com, LLC | 13 Feb 2017 | 13 Feb 2017 | 13 Feb 2018 |
| 420 | leoras.com | DropCatch.com 1126 LLC | 15 Jul 2024 | 1 Nov 2024 | 15 Jul 2025 |
| 421 | leorandallmusic.com | NameCheap, Inc. | 23 Feb 2017 | 23 Feb 2017 | 23 Feb 2018 |
| 422 | leora-bach.com | 1&1 Internet AG | 2 Mar 2017 | 3 Mar 2017 | 2 Mar 2018 |
| 423 | leoranna.com | Tucows Domains Inc. | 24 Jun 2022 | 4 Aug 2023 | 24 Jun 2023 |
| 424 | leorabach.com | 1&1 Internet AG | 2 Mar 2017 | 20 Feb 2025 | 2 Mar 2026 |
| 425 | leoraandjeff.com | GoDaddy.com, LLC | 8 Mar 2017 | 9 Mar 2025 | 8 Mar 2027 |
| 426 | leorangefashion.com | Wild West Domains, LLC | 9 Mar 2017 | 9 Mar 2017 | 9 Mar 2018 |
| 427 | leoraiken.com | GoDaddy.com, LLC | 12 Mar 2017 | 12 Mar 2025 | 12 Mar 2026 |
| 428 | leoraptakis.com | GoDaddy.com, LLC | 22 Mar 2017 | 22 Mar 2025 | 22 Mar 2026 |
| 429 | leorath.com | World4You Internet Services GmbH | 23 Mar 2017 | 12 May 2017 | 23 Mar 2018 |
| 430 | leorattus.com | OVH sas | 24 Mar 2017 | 23 May 2018 | 24 Mar 2018 |
| 431 | leorapinto.com | Name.com, Inc. | 30 Mar 2017 | 4 May 2025 | 30 Mar 2027 |
| 432 | leoranking.com | NameCheap, Inc. | 22 Feb 2025 | 22 Feb 2025 | 22 Feb 2026 |
| 433 | leoralon.xyz | Limited Liability Company "Registrar of domain nam… | 8 Apr 2017 | - | 8 Apr 2018 |
| 434 | leorah.co | GoDaddy.com, LLC | 10 Jun 2016 | 10 Jun 2016 | 9 Jun 2017 |
| 435 | leorahoneyman.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 11 Aug 2011 | 4 Aug 2017 | 11 Aug 2019 |
| 436 | leoraadvani.com | Tucows Domains Inc. | 24 Apr 2017 | 11 May 2021 | 24 Apr 2028 |
| 437 | leoraandgabriel.com | Tucows Domains Inc. | 4 May 2017 | 8 May 2018 | 4 May 2018 |
| 438 | leoraandmatt.com | HiChina Zhicheng Technology Limited | 13 Aug 2018 | 13 Aug 2018 | 13 Aug 2019 |
| 439 | leorahs.com | Ourdomains Limited | 8 Nov 2020 | 8 Nov 2020 | 8 Nov 2021 |
| 440 | leorasfr.com | NameCheap, Inc. | 31 May 2017 | 31 May 2017 | 31 May 2018 |
| 441 | leorazo.com | Network Solutions, LLC | 1 Jun 2017 | 2 Apr 2025 | 1 Jun 2026 |
| 442 | leora-leah.com | FastDomain Inc. | 6 Jun 2017 | 6 Jun 2017 | 6 Jun 2018 |
| 443 | leoranauta.com | Network Solutions, LLC | 8 Jun 2017 | 8 Jun 2017 | 8 Jun 2018 |
| 444 | leoramaya.com | GoDaddy.com, LLC | 10 Jun 2017 | 10 Jun 2017 | 10 Jun 2018 |
| 445 | leorahle.com | GoDaddy.com, LLC | 10 Dec 2021 | 10 Dec 2021 | 10 Dec 2022 |
| 446 | leorambos.com | Google, Inc. | 23 Mar 2021 | 23 Mar 2021 | 23 Mar 2022 |
| 447 | leorazzi.net | Network Solutions, LLC | 29 Jun 2017 | 6 Feb 2018 | 29 Jun 2018 |
| 448 | leoraschocolates.com | Domain.com, LLC | 30 Jun 2017 | 15 Jun 2024 | 30 Jun 2025 |
| 449 | leorailway.com | Automattic Inc. | 1 Jul 2017 | 1 Jul 2017 | 1 Jul 2018 |
| 450 | leorajewellery.com | GoDaddy.com, LLC | 4 Jul 2017 | 4 Oct 2022 | 4 Jul 2025 |
| 451 | leoraanddaniel.com | Google, Inc. | 9 Jul 2017 | 9 Jul 2017 | 9 Jul 2018 |
| 452 | leoraweddings.com | DropCatch.com 707 LLC | 11 Oct 2021 | 11 Oct 2021 | 11 Oct 2022 |
| 453 | leoraandkyle.com | Google, Inc. | 30 Jul 2017 | 30 Jul 2017 | 30 Jul 2018 |
| 454 | leoramutricy.com | Automattic Inc. | 2 Aug 2017 | 13 Jul 2024 | 2 Aug 2025 |
| 455 | leorada.com | Launchpad, Inc. | 4 Aug 2017 | 4 Aug 2017 | 4 Aug 2018 |
| 456 | leorarisemanagement.com | Gandi SAS | 9 Aug 2017 | 9 Aug 2017 | 9 Aug 2018 |
| 457 | leoramaen.com | OVH sas | 10 Aug 2017 | 30 Aug 2023 | 10 Aug 2025 |
| 458 | leorafolt.com | GoDaddy.com, LLC | 20 Sep 2017 | 21 Sep 2024 | 20 Sep 2026 |
| 459 | leoranovick.com | Tucows Domains Inc. | 25 Sep 2017 | 6 Feb 2025 | 25 Sep 2025 |
| 460 | leoraandben.com | Tucows Domains Inc. | 10 Oct 2017 | 14 Oct 2018 | 10 Oct 2018 |
| 461 | leoralerba.com | Tucows Domains Inc. | 20 Feb 2019 | 5 Feb 2025 | 20 Feb 2026 |
| 462 | leorareti.com | DNC Holdings, Inc. | 12 Oct 2017 | 12 Oct 2017 | 12 Oct 2018 |
| 463 | leoralon.com | Tucows Domains Inc. | 16 Oct 2017 | 27 Dec 2023 | 16 Oct 2023 |
| 464 | leoraandbenjamin.com | Tucows Domains Inc. | 18 Oct 2017 | 22 Oct 2018 | 18 Oct 2018 |
| 465 | leoraraivich.com | Tucows Domains Inc. | 23 Oct 2017 | 24 Oct 2024 | 23 Oct 2025 |
| 466 | leorange.net | HiChina Zhicheng Technology Limited | 24 Oct 2017 | 28 Oct 2022 | 24 Oct 2025 |
| 467 | leorandon.com | 1&1 Internet AG | 3 Nov 2017 | 4 Nov 2019 | 3 Nov 2020 |
| 468 | leorandon.biz | 1&1 Internet AG | 3 Nov 2017 | 3 Nov 2019 | 3 Nov 2019 |
| 469 | leoradesign.com | GoDaddy.com, LLC | 14 Mar 2025 | 14 Mar 2025 | 14 Mar 2026 |
| 470 | leorad.de | - | - | 2 Feb 2015 | - |
| 471 | leoravera.com | CloudFlare, Inc. | 26 Nov 2017 | 27 Oct 2024 | 26 Nov 2025 |
| 472 | leorail.info | GoDaddy.com, LLC | 4 Dec 2017 | 4 Dec 2017 | 4 Dec 2018 |
| 473 | leorahartman-realestatewithyouinmind.com | Network Solutions, LLC | 7 Dec 2017 | 7 Dec 2017 | 7 Dec 2018 |
| 474 | leoravrifkin.com | NameCheap, Inc. | 18 Dec 2017 | 18 Dec 2017 | 18 Dec 2018 |
| 475 | leorarich.com | Tucows Domains Inc. | 31 Dec 2020 | 10 Feb 2025 | 31 Dec 2024 |
| 476 | leoraimpex.com | Tucows Domains Inc. | 21 Dec 2016 | 25 Dec 2017 | 21 Dec 2017 |
| 477 | leorayingle.net | Network Solutions, LLC | 26 Dec 2017 | 26 Dec 2017 | 26 Dec 2018 |
| 478 | leoralightwoman.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 4 Feb 2016 | 2 Oct 2017 | 4 Feb 2018 |
| 479 | leorarealestate.com | Tucows Domains Inc. | 8 Jan 2018 | 12 Jan 2019 | 8 Jan 2019 |
| 480 | leorabeachdesign.co.uk | Reserved | 17 Jul 2012 | 15 May 2017 | 17 Jul 2018 |
| 481 | leorahost.co.uk | - | 20 Feb 2016 | 5 Feb 2025 | 20 Feb 2026 |
| 482 | leoratts.com | Binero AB | - | - | - |
| 483 | leoramacdougall3665.men | NameCheap, Inc. | 24 Jan 2018 | 24 Jan 2018 | 24 Jan 2019 |
| 484 | leorafloral.com | Network Solutions, LLC | 13 Feb 2018 | 13 Feb 2018 | 13 Feb 2019 |
| 485 | leoraflora.com | GoDaddy.com, LLC | 27 Jun 2021 | 8 Sep 2024 | 27 Jun 2024 |
| 486 | leorabeauty.life | Name.com, Inc. | 16 Feb 2018 | 16 Feb 2018 | 16 Feb 2019 |
| 487 | leorascatering.co.uk | - | 22 Feb 2018 | 22 Feb 2018 | 22 Feb 2020 |
| 488 | leorascatering.uk | - | 22 Feb 2018 | 22 Feb 2018 | 22 Feb 2020 |
| 489 | leorao.site | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 4 Mar 2018 | 10 Apr 2018 | 4 Mar 2019 |
| 490 | leoramos.design | Porkbun, LLC | 6 Mar 2018 | 6 Mar 2018 | 6 Mar 2019 |
| 491 | leorahan.faith | NameCheap, Inc. | 6 Mar 2018 | 6 Mar 2018 | 6 Mar 2019 |
| 492 | leorabourne.com | Synergy Wholesale Pty Ltd | 9 Mar 2018 | 26 Jan 2025 | 9 Mar 2026 |
| 493 | leorandjordan.com | eNom, Inc. | 11 Mar 2018 | 10 Mar 2018 | 11 Mar 2019 |
| 494 | leoracakeistry.com | Crazy Domains FZ-LLC | 15 Mar 2018 | 15 Mar 2018 | 15 Mar 2019 |
| 495 | leorawellness.com | GoDaddy.com, LLC | 4 Aug 2024 | 4 Aug 2024 | 4 Aug 2025 |
| 496 | leorabouam.com | Ligne Web Services SARL | 4 Apr 2018 | 25 Mar 2023 | 4 Apr 2026 |
| 497 | leoramust.com | register.com, Inc. | 4 Apr 2018 | 4 Apr 2018 | 4 Apr 2019 |
| 498 | leorasoft.info | GoDaddy.com, LLC | 5 Apr 2018 | 5 Apr 2018 | 5 Apr 2019 |
| 499 | leorawien.com | Network Solutions, LLC | 29 Apr 2018 | 8 Jun 2024 | 29 Apr 2026 |
| 500 | leorangemoon.com | Hefei Juming Network Technology Co., Ltd | 9 Jul 2022 | 9 Jul 2023 | 9 Jul 2024 |
| 501 | leoraragones.com | Google, Inc. | 8 May 2018 | 23 Apr 2025 | 8 May 2026 |
| 502 | leoraalida.com | Google, Inc. | 8 May 2018 | 24 Apr 2025 | 8 May 2026 |
| 503 | leorayjes.com | Amazon Registrar, Inc. | 15 May 2018 | 10 Apr 2025 | 15 May 2026 |
| 504 | leoranam.info | Limited Liability Company "Registrar of domain nam… | 23 May 2018 | 23 May 2018 | 23 May 2019 |
| 505 | leorain.com | GoDaddy.com, LLC | 2 Jun 2018 | 3 Jun 2024 | 2 Jun 2026 |
| 506 | leoraoptimalbody.com | Domain.com, LLC | 11 Jul 2021 | 26 Jun 2024 | 11 Jul 2025 |
| 507 | leoraifrailova.com | Automattic Inc. | 13 Jun 2018 | 13 Jun 2018 | 13 Jun 2019 |
| 508 | leorainc.com | NameCheap, Inc. | 20 Jun 2018 | 20 Jun 2018 | 20 Jun 2019 |
| 509 | leorauber.online | Hostinger, UAB | 29 Jun 2018 | 29 Jun 2018 | 29 Jun 2019 |
| 510 | leorajewelry.com | Network Solutions, LLC | 20 Sep 2022 | 10 Apr 2023 | 20 Sep 2025 |
| 511 | leoramosbjj.com | Network Solutions, LLC | 20 Jul 2018 | 20 Jun 2024 | 20 Jul 2025 |
| 512 | leoracornelio.com | Hostinger, UAB | 30 Dec 2024 | 30 Dec 2024 | 30 Dec 2026 |
| 513 | leoraudys.com | Tucows Domains Inc. | 26 Aug 2018 | 12 Aug 2024 | 26 Aug 2025 |
| 514 | leorav.com | Automattic Inc. | 31 Aug 2018 | 31 Aug 2018 | 31 Aug 2019 |
| 515 | leoramsay.com | GoDaddy.com, LLC | 3 Sep 2018 | 4 Sep 2024 | 3 Sep 2026 |
| 516 | leorangesmokeshop.com | GoDaddy.com, LLC | 5 Sep 2018 | 5 Sep 2024 | 5 Sep 2026 |
| 517 | leorajanes.com | eNom, Inc. | 5 Sep 2018 | 5 Sep 2018 | 5 Sep 2019 |
| 518 | leorainternational.com | GoDaddy.com, LLC | 8 Sep 2018 | 8 Sep 2018 | 8 Sep 2019 |
| 519 | leorastudios.com | GoDaddy.com, LLC | 17 Sep 2018 | 29 Oct 2024 | 17 Sep 2024 |
| 520 | leorastudio.com | GoDaddy.com, LLC | 26 Apr 2025 | 26 Apr 2025 | 26 Apr 2026 |
| 521 | leorapublicspeaker.com | Wild West Domains, LLC | 21 Sep 2018 | 22 Sep 2024 | 21 Sep 2025 |
| 522 | leorarempel.ooo | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Aug 2018 | 24 Sep 2018 | 10 Aug 2019 |
| 523 | leoraacademy.com | - | 21 Dec 2024 | 5 Apr 2025 | 21 Dec 2025 |
| 524 | leorabenzev.com | Automattic Inc. | 7 Oct 2018 | 7 Oct 2018 | 7 Oct 2019 |
| 525 | leorawalter.com | Tucows Domains Inc. | 17 Oct 2018 | 16 Oct 2024 | 17 Oct 2025 |
| 526 | leorashop.com | UdomainName.com LLC | 18 Apr 2024 | 23 Apr 2025 | 18 Apr 2026 |
| 527 | leorakimmel.com | Tucows Domains Inc. | 29 Oct 2018 | 14 Oct 2024 | 29 Oct 2025 |
| 528 | leorayshow.com | GoDaddy.com, LLC | 31 Oct 2018 | 1 Nov 2024 | 31 Oct 2026 |
| 529 | leoracosplay.com | EPAG Domainservices GmbH | 30 Nov 2018 | 30 Nov 2018 | 30 Nov 2019 |
| 530 | leorabermeister.com | NameCheap, Inc. | 4 Dec 2018 | 7 Dec 2024 | 4 Dec 2025 |
| 531 | leorascloset.com | Tucows Domains Inc. | 9 Dec 2018 | 13 Dec 2019 | 9 Dec 2019 |
| 532 | leorabrecher.info | Network Solutions, LLC | 27 Dec 2018 | 2 Nov 2024 | 27 Dec 2025 |
| 533 | leorafashionista.com | GoDaddy.com, LLC | 2 Jan 2019 | 14 Jan 2025 | 2 Jan 2026 |
| 534 | leorayon.com | Tucows Domains Inc. | 3 Jan 2019 | 3 Jan 2019 | 3 Jan 2020 |
| 535 | leorachel.com | GoDaddy.com, LLC | 3 Jan 2019 | 18 Mar 2025 | 3 Jan 2026 |
| 536 | leorarae.com | Amazon Registrar, Inc. | 25 Jan 2019 | 25 Jan 2019 | 25 Jan 2020 |
| 537 | leorangesmoke.com | GoDaddy.com, LLC | 4 Feb 2019 | 16 Oct 2022 | 4 Feb 2027 |
| 538 | leoralighting.com | GoDaddy.com, LLC | 6 Feb 2019 | 14 Feb 2025 | 6 Feb 2026 |
| 539 | leoranesweb.com | GoDaddy.com, LLC | 9 Feb 2019 | 9 Feb 2019 | 9 Feb 2020 |
| 540 | leorabendel.com | Wild West Domains, LLC | 10 Feb 2019 | 11 Feb 2025 | 10 Feb 2026 |
| 541 | leoraneman.com | GoDaddy.com, LLC | 14 Feb 2019 | 25 Feb 2025 | 14 Feb 2026 |
| 542 | leorahartphotography.com | GoDaddy.com, LLC | 20 Feb 2019 | 20 Feb 2019 | 20 Feb 2020 |
| 543 | leoralabel.com | GoDaddy.com, LLC | 25 Feb 2019 | 25 Feb 2019 | 25 Feb 2020 |
| 544 | leorau.com | RegistryGate GmbH | 13 Mar 2019 | 17 Apr 2025 | 13 Mar 2026 |
| 545 | leorassi.dev | Google, Inc. | 2 Mar 2019 | 7 Mar 2019 | 2 Mar 2020 |
| 546 | leoraleather.com | Google, Inc. | 5 Aug 2020 | 31 Jul 2024 | 5 Aug 2025 |
| 547 | leoraandandrew.com | eNom, Inc. | 20 Mar 2019 | 19 Mar 2019 | 20 Mar 2020 |
| 548 | leoranyc.com | GoDaddy.com, LLC | 27 Mar 2019 | 28 Mar 2025 | 27 Mar 2027 |
| 549 | leoramoon.com | Google, Inc. | 28 Mar 2019 | 13 Mar 2025 | 28 Mar 2026 |
| 550 | leoraitsolution.com | GoDaddy.com, LLC | 1 Apr 2019 | 1 Apr 2019 | 1 Apr 2020 |
| 551 | leoracks.com | BigRock Solutions Ltd. | 3 Apr 2019 | 4 Apr 2024 | 3 Apr 2025 |
| 552 | leoramalho.com | eNom, Inc. | 12 Apr 2019 | 11 Apr 2019 | 12 Apr 2020 |
| 553 | leorasaflacrenegades.com | GoDaddy.com, LLC | 18 Apr 2019 | 18 Apr 2019 | 18 Apr 2021 |
| 554 | leorayofficialsocks.com | Tucows Domains Inc. | 25 Apr 2019 | 29 Apr 2020 | 25 Apr 2020 |
| 555 | leorabekkartistry.com | GoDaddy.com, LLC | 30 Apr 2019 | 30 Apr 2025 | 30 Apr 2026 |
| 556 | leorainfrasolutions.com | NameCheap, Inc. | 13 May 2025 | 13 May 2025 | 13 May 2026 |
| 557 | leoramansoor.com | GoDaddy.com, LLC | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 558 | leoramglobal.com | GoDaddy.com, LLC | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 559 | leora-indian-henna.com | Hostinger, UAB | 14 May 2019 | 15 May 2025 | 14 May 2026 |
| 560 | leorac.com | GoDaddy.com, LLC | 15 May 2019 | 15 May 2019 | 15 May 2021 |
| 561 | leoraalexander.com | GoDaddy.com, LLC | 22 May 2019 | 23 May 2025 | 22 May 2027 |
| 562 | leoralexander.com | GoDaddy.com, LLC | 22 May 2019 | 23 May 2025 | 22 May 2027 |
| 563 | leorasatamkar.com | Hostinger, UAB | 29 May 2019 | 29 May 2019 | 29 May 2022 |
| 564 | leoraisler.com | Hostinger, UAB | 2 Jun 2019 | 2 Jun 2019 | 2 Jun 2022 |
| 565 | leorayflynn.com | Xin Net Technology Corporation | 23 Aug 2023 | 27 Aug 2024 | 23 Aug 2025 |
| 566 | leoran.com | Key-Systems GmbH | 19 May 2025 | 19 May 2025 | 19 May 2026 |
| 567 | leoramedia.com | Tucows Domains Inc. | 20 Jun 2019 | 9 May 2025 | 20 Jun 2026 |
| 568 | leorabbit-co.com | register.com, Inc. | 28 Jun 2019 | 28 Jun 2019 | 28 Jun 2020 |
| 569 | leorahconcepts.com | Google, Inc. | 7 Jul 2019 | 6 Sep 2024 | 7 Jul 2024 |
| 570 | leorart.com | Wix.com Ltd. | 10 Jul 2019 | 10 Jul 2019 | 10 Jul 2022 |
| 571 | leorate.com | Domainraker.net LLC | 27 Dec 2022 | 30 Dec 2023 | 27 Dec 2024 |
| 572 | leoraellison.com | GoDaddy.com, LLC | 19 Jul 2019 | 20 Jul 2024 | 19 Jul 2025 |
| 573 | leorababycentre.com | Synergy Wholesale Pty Ltd | 22 Jul 2019 | 29 Jun 2023 | 22 Jul 2025 |
| 574 | leoranouriel.com | FastDomain Inc. | 24 Jul 2019 | 24 Jul 2019 | 24 Jul 2020 |
| 575 | leoradoya.com | Wix.com Ltd. | 24 Jul 2019 | 24 Jul 2019 | 24 Jul 2020 |
| 576 | leorackz.com | Tucows Domains Inc. | 6 Aug 2019 | 6 Aug 2019 | 6 Aug 2020 |
| 577 | leoralandress.com | Wix.com Ltd. | 14 Aug 2019 | 14 Aug 2019 | 14 Aug 2020 |
| 578 | leorades.com | Hosting Concepts B.V. dba Openprovider | 23 Aug 2019 | 23 Aug 2019 | 23 Aug 2020 |
| 579 | leorang.com | GoDaddy.com, LLC | 23 Aug 2019 | 29 Oct 2022 | 23 Aug 2031 |
| 580 | leoralemon.com | GoDaddy.com, LLC | 23 Aug 2019 | 3 Aug 2024 | 23 Aug 2025 |
| 581 | leorasoft.net | Google, Inc. | 24 Aug 2019 | 24 Aug 2019 | 24 Aug 2020 |
| 582 | leoratzlaff.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Aug 2019 | 29 Aug 2024 | 27 Aug 2025 |
| 583 | leorabonhart.com | 1API GmbH | 31 Aug 2019 | 31 Aug 2019 | 31 Aug 2020 |
| 584 | leorazuckerman.com | Tucows Domains Inc. | 16 Sep 2019 | 1 Sep 2024 | 16 Sep 2025 |
| 585 | leorakornfeld.com | Wix.com Ltd. | 18 Sep 2019 | 19 Aug 2024 | 18 Sep 2025 |
| 586 | leoralston.com | GoDaddy.com, LLC | 9 Oct 2019 | 10 Oct 2024 | 9 Oct 2025 |
| 587 | leorack.net | Vautron Rechenzentrum AG | 11 Oct 2019 | 13 Oct 2024 | 11 Oct 2025 |
| 588 | leorack.com | Vautron Rechenzentrum AG | 11 Oct 2019 | 31 Jan 2025 | 11 Oct 2025 |
| 589 | leorasanandaji.com | GoDaddy.com, LLC | 15 Oct 2019 | 15 Oct 2019 | 15 Oct 2020 |
| 590 | leoradriver.com | 1&1 Internet AG | 16 Oct 2019 | 16 Oct 2019 | 16 Oct 2020 |
| 591 | leoramoviehouse.com | GoDaddy.com, LLC | 21 Oct 2019 | 21 Oct 2019 | 21 Oct 2020 |
| 592 | leoraroyals.com | NameCheap, Inc. | 30 Oct 2019 | 31 Oct 2024 | 30 Oct 2025 |
| 593 | leoraw.net | 1&1 Internet AG | 3 Nov 2019 | 3 Nov 2019 | 3 Nov 2020 |
| 594 | leoracingteam.com | Tucows Domains Inc. | 6 Nov 2019 | 17 Jan 2025 | 6 Nov 2024 |
| 595 | leoramirezroofing.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 7 Nov 2019 | 7 Nov 2019 | 7 Nov 2020 |
| 596 | leorastc.com | Tucows Domains Inc. | 26 Jul 2019 | 30 Jul 2020 | 26 Jul 2020 |
| 597 | leorajess.com | GoDaddy.com, LLC | 8 Nov 2019 | 8 Nov 2019 | 8 Nov 2020 |
| 598 | leorawilliams.com | 1&1 Internet AG | 11 Nov 2019 | 11 Nov 2019 | 11 Nov 2020 |
| 599 | leoracks.net | Vautron Rechenzentrum AG | 18 Nov 2019 | 19 Nov 2024 | 17 Nov 2025 |
| 600 | leoraweissphoto.com | Wix.com Ltd. | 28 Nov 2019 | 30 Oct 2024 | 28 Nov 2025 |
| 601 | leorasophia.com | Key-Systems GmbH | 3 Dec 2019 | 4 Dec 2019 | 3 Dec 2020 |
| 602 | leoramgut.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Dec 2019 | 6 Dec 2019 | 6 Dec 2020 |
| 603 | leoraguti.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Dec 2019 | 9 Dec 2019 | 9 Dec 2020 |
| 604 | leoradeals.com | GoDaddy.com, LLC | 13 Dec 2019 | 13 Dec 2019 | 13 Dec 2020 |
| 605 | leoralaw.com | Wild West Domains, LLC | 25 Dec 2019 | 25 Dec 2019 | 25 Dec 2020 |
| 606 | leorahomoeoclinic.com | FastDomain Inc. | 28 Dec 2019 | 28 Dec 2019 | 28 Dec 2020 |
| 607 | leoraadigital.com | GoDaddy.com, LLC | 31 Dec 2019 | 15 Oct 2024 | 31 Dec 2025 |
| 608 | leoracoaching.com | OVH sas | 1 Jan 2020 | 2 Jan 2024 | 1 Jan 2025 |
| 609 | leoraspaud.com | Amazon Registrar, Inc. | 2 Jan 2020 | 28 Nov 2024 | 2 Jan 2026 |
| 610 | leoracosmetics.com | Tucows Domains Inc. | 29 Jan 2025 | 29 Jan 2025 | 29 Jan 2026 |
| 611 | leorabiet.com | Google, Inc. | 7 Jan 2020 | 19 Jan 2025 | 7 Jan 2026 |
| 612 | leoranidhi.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jan 2020 | 7 Jan 2025 | 13 Jan 2026 |
| 613 | leoraouf.com | GoDaddy.com, LLC | 2 Feb 2020 | 2 Feb 2020 | 2 Feb 2021 |
| 614 | leorarts.com | GoDaddy.com, LLC | 3 Feb 2020 | 3 Feb 2020 | 3 Feb 2021 |
| 615 | leorandow.com | 1&1 Internet AG | 10 Feb 2020 | 10 Feb 2020 | 10 Feb 2021 |
| 616 | leoramireztips.com | GoDaddy.com, LLC | 14 Feb 2020 | 27 Apr 2024 | 14 Feb 2024 |
| 617 | leoradezign.com | GoDaddy.com, LLC | 19 Feb 2020 | 19 Feb 2020 | 19 Feb 2021 |
| 618 | leoravetta.com | GMO Internet Inc. | 20 Feb 2020 | 3 Apr 2023 | 20 Feb 2023 |
| 619 | leorafavariedades.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Feb 2020 | 24 Feb 2020 | 24 Feb 2021 |
| 620 | leoracolin4ever.com | EuroDNS S.A. | 28 Feb 2020 | 28 Feb 2020 | 27 Feb 2021 |
| 621 | leorakorn.com | Tucows Domains Inc. | 5 Mar 2020 | 19 Feb 2025 | 5 Mar 2026 |
| 622 | leoraabtest.com | GoDaddy.com, LLC | 11 Mar 2020 | 11 Mar 2020 | 11 Mar 2021 |
| 623 | leorademaria.com | Launchpad, Inc. | 15 Mar 2020 | 15 Mar 2020 | 15 Mar 2021 |
| 624 | leoraphotography.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Nov 2024 | 27 Nov 2024 | 27 Nov 2025 |
| 625 | leoraluna.com | Launchpad, Inc. | 16 Mar 2020 | 29 May 2024 | 16 Mar 2024 |
| 626 | leoracollection.com | GoDaddy.com, LLC | 29 Mar 2020 | 30 Mar 2024 | 29 Mar 2026 |
| 627 | leoratogroup.com | Tucows Domains Inc. | 2 Apr 2020 | 6 Apr 2021 | 2 Apr 2021 |
| 628 | leoratoconfort.com | Tucows Domains Inc. | 2 Apr 2020 | 2 Apr 2020 | 2 Apr 2021 |
| 629 | leoratotecnologie.com | Tucows Domains Inc. | 2 Apr 2020 | 2 Apr 2020 | 2 Apr 2021 |
| 630 | leoratocomfort.com | Tucows Domains Inc. | 3 Apr 2020 | 27 Mar 2025 | 3 Apr 2026 |
| 631 | leorattez.com | Online SAS | 24 Apr 2020 | 18 Apr 2025 | 24 Apr 2026 |
| 632 | leoracooks.com | GoDaddy.com, LLC | 29 Apr 2020 | 30 Apr 2025 | 29 Apr 2026 |
| 633 | leoraclinic.com | BigRock Solutions Ltd. | 29 Apr 2020 | 29 Apr 2020 | 29 Apr 2021 |
| 634 | leora-levian.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 May 2020 | 5 May 2020 | 5 May 2021 |
| 635 | leorae.info | NameCheap, Inc. | 13 May 2020 | 13 May 2020 | 13 May 2021 |
| 636 | leorartworld.com | GoDaddy.com, LLC | 18 May 2020 | 18 May 2020 | 18 May 2021 |
| 637 | leorathefriends.com | Cosmotown, Inc. | 23 Jun 2024 | 24 Jun 2024 | 23 Jun 2025 |
| 638 | leoraqlx.club | Chengdu West Dimension Digital Technology Co., Ltd… | 13 Aug 2021 | 13 Aug 2021 | 13 Aug 2022 |
| 639 | leorahross.com | GoDaddy.com, LLC | 21 May 2020 | 21 May 2020 | 21 May 2021 |
| 640 | leoraaniyaluxuryjewelry.com | - | 2 Aug 2023 | 3 Sep 2024 | 2 Aug 2024 |
| 641 | leorabeverly.com | DreamHost, LLC | 31 May 2020 | 31 May 2020 | 31 May 2021 |
| 642 | leoraunspt.com | GoDaddy.com, LLC | 8 Jun 2020 | 20 Jul 2023 | 8 Jun 2023 |
| 643 | leorapard.com | Name.com, Inc. | 19 Jun 2020 | 27 Jul 2020 | 19 Jun 2021 |
| 644 | leorabolger.com | GoDaddy.com, LLC | 3 Jul 2020 | 3 Jul 2020 | 3 Jul 2021 |
| 645 | leoramsey.com | GoDaddy.com, LLC | 7 Jul 2020 | 8 Jul 2024 | 7 Jul 2025 |
| 646 | leoraboutique.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 27 Dec 2024 | 27 Dec 2024 | 27 Dec 2025 |
| 647 | leorafaelshopping.com | GoDaddy.com, LLC | 22 Jul 2020 | 22 Jul 2020 | 22 Jul 2021 |
| 648 | leoraadipisci.xyz | Limited Liability Company "Registrar of domain nam… | 23 Jul 2020 | 23 Jul 2020 | 23 Jul 2021 |
| 649 | leoramogr.xyz | Namesilo, LLC | 6 Dec 2019 | 11 Dec 2019 | 6 Dec 2020 |
| 650 | leorarosebeautycollection.com | 1&1 Internet AG | 31 Jul 2020 | 31 Jul 2020 | 31 Jul 2024 |
| 651 | leora1.com | FastDomain Inc. | 3 Aug 2020 | 19 Jul 2024 | 3 Aug 2025 |
| 652 | leorapictures.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 3 Aug 2020 | 3 Aug 2020 | 3 Aug 2021 |
| 653 | leoralynnphotography.com | GoDaddy.com, LLC | 7 Aug 2020 | 7 Aug 2020 | 7 Aug 2021 |
| 654 | leoramos88.com | Dynadot, LLC | 12 Aug 2020 | 12 Aug 2020 | 12 Aug 2021 |
| 655 | leoraposo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Aug 2020 | 27 Aug 2020 | 27 Aug 2021 |
| 656 | leorasbeauty.com | Tucows Domains Inc. | 13 Sep 2020 | 17 Sep 2021 | 13 Sep 2021 |
| 657 | leorastore.com | Google, Inc. | 5 Jan 2022 | 21 Dec 2024 | 5 Jan 2026 |
| 658 | leora777.com | DreamHost, LLC | 22 Mar 2025 | 22 Mar 2025 | 22 Mar 2026 |
| 659 | leorati.com | Namesilo, LLC | 21 Jul 2023 | 24 Sep 2024 | 21 Jul 2024 |
| 660 | leoraannsmith.com | GoDaddy.com, LLC | 24 Sep 2020 | 5 Nov 2023 | 24 Sep 2023 |
| 661 | leorachocolate.com | Name.com, Inc. | 23 May 2024 | 24 May 2025 | 23 May 2026 |
| 662 | leorafts.com | GoDaddy.com, LLC | 29 Sep 2020 | 29 Sep 2020 | 29 Sep 2021 |
| 663 | leorasevi.com | Webfusion Ltd. | 10 Oct 2020 | 6 Nov 2024 | 10 Oct 2026 |
| 664 | leoraamedia.com | GoDaddy.com, LLC | 17 Oct 2020 | 17 Oct 2020 | 17 Oct 2021 |
| 665 | leorahartmanrealtor.com | Google, Inc. | 21 Oct 2020 | 21 Oct 2020 | 21 Oct 2021 |
| 666 | leoraflowers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 667 | leorasheily.com | Uniregistrar Corp | - | - | - |
| 668 | leorahgavidor.com | GoDaddy.com, LLC | 27 Oct 2020 | 28 Oct 2024 | 27 Oct 2025 |
| 669 | leoralanebooks.com | Automattic Inc. | 29 Oct 2020 | 29 Oct 2020 | 29 Oct 2021 |
| 670 | leoradiok.com | Dattatec.com SRL | 30 Oct 2020 | 30 Oct 2020 | 30 Oct 2021 |
| 671 | leoracrystals.com | GoDaddy.com, LLC | 2 Nov 2020 | 14 Jan 2024 | 2 Nov 2023 |
| 672 | leoraenterprises.com | GoDaddy.com, LLC | 5 Nov 2020 | 5 Nov 2020 | 5 Nov 2021 |
| 673 | leoralewis.com | GoDaddy.com, LLC | 17 Apr 2024 | 17 Apr 2024 | 17 Apr 2027 |
| 674 | leoraandbrandon.com | Tucows Domains Inc. | 18 Nov 2020 | 3 Nov 2024 | 18 Nov 2025 |
| 675 | leoramofsowitz.com | Tucows Domains Inc. | 21 Nov 2020 | 23 Oct 2024 | 21 Nov 2025 |
| 676 | leoraven.xyz | Namesilo, LLC | 1 Dec 2020 | 1 Dec 2020 | 1 Dec 2021 |
| 677 | leoradio.online | Automattic Inc. | 2 Dec 2020 | 2 Dec 2020 | 2 Dec 2021 |
| 678 | leorainfotech.com | GoDaddy.com, LLC | 8 Dec 2020 | 5 Mar 2025 | 8 Dec 2025 |
| 679 | leoramiaka.com | GoDaddy.com, LLC | 8 Dec 2020 | 9 Dec 2024 | 8 Dec 2025 |
| 680 | leorams.com | NameCheap, Inc. | 11 Dec 2020 | 21 Nov 2024 | 11 Dec 2025 |
| 681 | leoraymer.site | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 May 2020 | 7 May 2021 | 6 May 2022 |
| 682 | leorainbath.com | GoDaddy.com, LLC | 24 Dec 2020 | 24 Dec 2020 | 24 Dec 2021 |
| 683 | leorastella.com | GoDaddy.com, LLC | 29 Dec 2020 | 10 Mar 2024 | 29 Dec 2023 |
| 684 | leoraexportsdmcc.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Dec 2020 | 30 Dec 2024 | 30 Dec 2025 |
| 685 | leorarichtherapy.com | PSI-USA, Inc. dba Domain Robot | 26 Apr 2025 | 26 Apr 2025 | 26 Apr 2026 |
| 686 | leoramstories.com | CloudFlare, Inc. | 7 Jan 2021 | 8 Dec 2024 | 7 Jan 2026 |
| 687 | leorallerandi.com | NameCheap, Inc. | 9 Jan 2021 | 12 Jan 2023 | 9 Jan 2024 |
| 688 | leorawexler.net | NameCheap, Inc. | 9 Jan 2021 | 12 Jan 2023 | 9 Jan 2024 |
| 689 | leoralty.com | Tucows Domains Inc. | 16 Jan 2021 | 20 Jan 2023 | 16 Jan 2023 |
| 690 | leoragroups.com | Network Solutions, LLC | 29 Mar 2024 | 29 Mar 2024 | 29 Mar 2025 |
| 691 | leorawrites.com | Automattic Inc. | 26 Jan 2021 | 26 Jan 2021 | 26 Jan 2022 |
| 692 | leoralightcrystals.com | GoDaddy.com, LLC | 29 Jan 2021 | 11 Apr 2025 | 29 Jan 2025 |
| 693 | leoramall.com | Moniker Online Services LLC | 4 Feb 2021 | 2 Feb 2025 | 4 Feb 2026 |
| 694 | leoralondon.com | Tucows Domains Inc. | 19 Sep 2023 | 19 Sep 2023 | 19 Sep 2025 |
| 695 | leoradiology.net | Japan Registry Services Co., Ltd. | 10 Feb 2021 | 10 Feb 2021 | 10 Feb 2022 |
| 696 | leoraltysalchemy.com | Tucows Domains Inc. | 16 Jan 2021 | 20 Jan 2022 | 16 Jan 2022 |
| 697 | leorapco.space | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Feb 2021 | 28 Feb 2021 | 28 Feb 2022 |
| 698 | leorabodytreats.com | GoDaddy.com, LLC | 12 Mar 2021 | 12 Mar 2021 | 12 Mar 2022 |
| 699 | leoracrafts.com | GoDaddy.com, LLC | 15 Mar 2021 | 15 Mar 2021 | 15 Mar 2022 |
| 700 | leoralsurgery.com | Google, Inc. | 16 Mar 2021 | 1 Mar 2025 | 16 Mar 2026 |
| 701 | leoraslamour.com | GoDaddy.com, LLC | 18 Mar 2021 | 18 Mar 2021 | 18 Mar 2022 |
| 702 | leoranews.com | GoDaddy.com, LLC | 25 Nov 2017 | 6 Dec 2024 | 25 Nov 2025 |
| 703 | leorapajamas.com | Crazy Domains FZ-LLC | 13 Apr 2021 | 14 Apr 2021 | 13 Apr 2022 |
| 704 | leoraphaelli.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2021 | 17 Apr 2025 | 16 Apr 2026 |
| 705 | leoramblas.com | GMO Internet Inc. | 16 Apr 2021 | 7 Mar 2025 | 16 Apr 2026 |
| 706 | leoraart.com | InterNetworX Ltd. & Co. KG | 12 Sep 2024 | 1 Apr 2025 | 12 Sep 2025 |
| 707 | leoraimanuel.com | 1&1 Internet AG | 27 Apr 2021 | 28 Apr 2025 | 27 Apr 2026 |
| 708 | leoramosdj.com | Infomaniak Network SA | 1 May 2021 | 17 Apr 2025 | 1 May 2026 |
| 709 | leoramos.co | GoDaddy.com, LLC | 29 Sep 2020 | 4 Oct 2020 | 29 Sep 2021 |
| 710 | leoraclothing.com | Web Commerce Communications Limited dba WebNic.cc | 7 May 2021 | 7 May 2021 | 7 May 2022 |
| 711 | leoraf.com | Launchpad, Inc. | 14 May 2021 | 12 May 2025 | 14 May 2026 |
| 712 | leoracramer.com | Automattic Inc. | 17 May 2021 | 27 Apr 2025 | 17 May 2026 |
| 713 | leorafoundation.com | GoDaddy.com, LLC | 19 May 2021 | 18 May 2025 | 19 May 2026 |
| 714 | leorapromo.com | Namesilo, LLC | 20 May 2021 | 21 May 2023 | 20 May 2024 |
| 715 | leoradeflumere.com | FastDomain Inc. | 20 May 2021 | 5 May 2025 | 20 May 2026 |
| 716 | leoratings.com | GoDaddy.com, LLC | 20 May 2021 | 17 Oct 2022 | 20 May 2026 |
| 717 | leoraplc.com | Dynadot, LLC | 3 Jun 2021 | 1 Jul 2024 | 3 Jun 2025 |
| 718 | leoramdillow.com | register.com, Inc. | 13 Jun 2021 | 13 Jun 2021 | 13 Jun 2022 |
| 719 | leorainers.com | Tucows Domains Inc. | 15 Jun 2021 | 26 Aug 2024 | 15 Jun 2024 |
| 720 | leoramessinger.com | GoDaddy.com, LLC | 17 Jun 2021 | 18 Jun 2024 | 17 Jun 2025 |
| 721 | leoralifestyle.com | GoDaddy.com, LLC | 17 Jun 2021 | 18 Jun 2024 | 17 Jun 2025 |
| 722 | leoraliving.com | GoDaddy.com, LLC | 17 Jun 2021 | 18 Jun 2024 | 17 Jun 2025 |
| 723 | leoramess.com | GoDaddy.com, LLC | 17 Jun 2021 | 18 Jun 2024 | 17 Jun 2025 |
| 724 | leorabbitandco.com | NameCheap, Inc. | 11 Aug 2022 | 22 Sep 2023 | 11 Aug 2023 |
| 725 | leoralevy.com | DNC Holdings, Inc. | 28 May 2025 | 28 May 2025 | 28 May 2026 |
| 726 | leoramrrisgfile.com | Tucows Domains Inc. | 9 Jul 2020 | 13 Jul 2021 | 9 Jul 2021 |
| 727 | leorays.com | Tucows Domains Inc. | 5 Apr 2025 | 6 Apr 2025 | 5 Apr 2026 |
| 728 | leorahman.com | Tucows Domains Inc. | 30 Jul 2021 | 30 Jun 2023 | 30 Jul 2025 |
| 729 | leoraandco.com | Tucows Domains Inc. | 7 Aug 2021 | 18 Oct 2023 | 7 Aug 2023 |
| 730 | leoraz.net | Google, Inc. | 9 Aug 2021 | 8 Sep 2024 | 9 Aug 2024 |
| 731 | leorajoves.com | DreamHost, LLC | 16 Aug 2021 | 29 Oct 2023 | 16 Aug 2023 |
| 732 | leorancho.xyz | Limited Liability Company "Registrar of domain nam… | 31 Aug 2021 | 31 Aug 2021 | 31 Aug 2022 |
| 733 | leoraasa-fineart.com | Tucows Domains Inc. | 2 Sep 2021 | 6 Sep 2022 | 2 Sep 2022 |
| 734 | leoraglan.top | Namesilo, LLC | 15 Sep 2021 | 15 Sep 2021 | 15 Sep 2022 |
| 735 | leoragutti.com | Hostinger, UAB | 19 Sep 2021 | 23 Oct 2024 | 19 Sep 2025 |
| 736 | leorango.store | NameCheap, Inc. | 23 Sep 2021 | 23 Sep 2021 | 23 Sep 2022 |
| 737 | leoras.info | NameCheap, Inc. | 30 Sep 2021 | 30 Sep 2021 | 30 Sep 2022 |
| 738 | leoraycelebrations.info | Tucows Domains Inc. | 4 Oct 2021 | 14 Nov 2024 | 4 Oct 2024 |
| 739 | leorahmx.com | Google, Inc. | 5 Oct 2021 | 6 Oct 2023 | 5 Oct 2024 |
| 740 | leoramalka.com | FastDomain Inc. | 15 Oct 2021 | 30 Sep 2023 | 15 Oct 2024 |
| 741 | leorabell.com | Domain.com, LLC | 21 Oct 2021 | 6 Oct 2024 | 21 Oct 2025 |
| 742 | leorainproject.online | Hostinger, UAB | 17 Nov 2021 | 17 Nov 2021 | 17 Nov 2022 |
| 743 | leoranicole.com | GoDaddy.com, LLC | 20 Nov 2021 | 20 Nov 2023 | 20 Nov 2025 |
| 744 | leoramsden.top | Namesilo, LLC | 25 Nov 2021 | 25 Nov 2021 | 25 Nov 2022 |
| 745 | leorautomation.com | GoDaddy.com, LLC | 26 Oct 2023 | 7 Dec 2024 | 26 Oct 2024 |
| 746 | leoraatelier.com | Google, Inc. | 12 Dec 2021 | 27 Nov 2024 | 12 Dec 2025 |
| 747 | leorafarber.com | Tucows Domains Inc. | 14 Dec 2021 | 15 Nov 2024 | 14 Dec 2025 |
| 748 | leorabridal.com | Google, Inc. | 24 Sep 2021 | 9 Sep 2024 | 24 Sep 2025 |
| 749 | leoranger.com | EvoPlus Ltd. | 24 Dec 2021 | 24 Apr 2025 | 24 Dec 2025 |
| 750 | leorapido.com | Beijing Lanhai Jiye Technology Co., Ltd | 8 Jan 2022 | 9 Jan 2024 | 8 Jan 2025 |
| 751 | leoraldn.com | Google, Inc. | 14 Sep 2023 | 30 Aug 2024 | 14 Sep 2025 |
| 752 | leoranger.net | CloudFlare, Inc. | 22 Jan 2022 | 2 Apr 2025 | 22 Jan 2025 |
| 753 | leoraebooks.com | Wild West Domains, LLC | 24 Jan 2022 | 5 Apr 2024 | 24 Jan 2024 |
| 754 | leorahanddinana.com | Google, Inc. | 29 Jan 2022 | 29 Jan 2022 | 29 Jan 2023 |
| 755 | leoralevyforct.com | GoDaddy.com, LLC | 31 Jan 2022 | 1 Feb 2024 | 31 Jan 2026 |
| 756 | leoralevyforsenate.com | GoDaddy.com, LLC | 31 Jan 2022 | 1 Feb 2024 | 31 Jan 2026 |
| 757 | leorabelo.com | GoDaddy.com, LLC | 31 Jan 2022 | 13 Mar 2024 | 31 Jan 2024 |
| 758 | leoraapparel.com | Web Commerce Communications Limited dba WebNic.cc | 31 Jan 2022 | 31 Jan 2022 | 31 Jan 2023 |
| 759 | leoraoz.com | Hosting Concepts B.V. dba Openprovider | 31 Jan 2022 | 3 Feb 2025 | 31 Jan 2026 |
| 760 | leorahughes.com | Porkbun, LLC | 6 Sep 2024 | 6 Sep 2024 | 6 Sep 2025 |
| 761 | leora4senate.com | GoDaddy.com, LLC | 8 Feb 2022 | 8 Feb 2022 | 8 Feb 2023 |
| 762 | leoralevy4senate.com | GoDaddy.com, LLC | 8 Feb 2022 | 8 Feb 2022 | 8 Feb 2023 |
| 763 | leoraleecandy.com | Domain.com, LLC | 10 Feb 2022 | 11 Mar 2025 | 10 Feb 2026 |
| 764 | leoratx.com | Beijing Lanhai Jiye Technology Co., Ltd | 3 Jun 2024 | 4 May 2025 | 3 Jun 2026 |
| 765 | leoratherapeutics.com | Wild West Domains, LLC | 14 Feb 2022 | 15 Feb 2025 | 14 Feb 2026 |
| 766 | leorainvestments.com | 1&1 Internet AG | 16 Feb 2022 | 17 Feb 2025 | 16 Feb 2026 |
| 767 | leoraxesy.xyz | NameCheap, Inc. | 21 Feb 2022 | 4 Apr 2023 | 21 Feb 2023 |
| 768 | leoramirezlawnmaintenance.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Feb 2022 | 4 Apr 2023 | 21 Feb 2023 |
| 769 | leorabiz.com | 1&1 Internet AG | 24 Feb 2022 | 25 Feb 2025 | 24 Feb 2026 |
| 770 | leoracompany.com | 1&1 Internet AG | 24 Feb 2022 | 25 Feb 2025 | 24 Feb 2026 |
| 771 | leoralearn.com | 1&1 Internet AG | 24 Feb 2022 | 24 Feb 2022 | 24 Feb 2026 |
| 772 | leorahealth.com | 1&1 Internet AG | 26 Feb 2022 | 26 Feb 2022 | 26 Feb 2026 |
| 773 | leoraseelenwelten.com | Automattic Inc. | 28 Feb 2022 | 8 Feb 2025 | 28 Feb 2026 |
| 774 | leoraventures.com | NameCheap, Inc. | 28 Aug 2023 | 28 Aug 2023 | 28 Aug 2025 |
| 775 | leorajewels.com | Google, Inc. | 10 Jul 2024 | 13 Aug 2024 | 10 Jul 2025 |
| 776 | leoraofficial.com | Tucows Domains Inc. | 12 Nov 2024 | 12 Nov 2024 | 12 Nov 2025 |
| 777 | leoraleadership.com | Tucows Domains Inc. | 10 Mar 2022 | 22 Feb 2025 | 10 Mar 2026 |
| 778 | leoracoffee.xyz | Hostinger, UAB | 20 Mar 2022 | 26 Apr 2023 | 20 Mar 2023 |
| 779 | leorachack.space | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Mar 2022 | 27 Apr 2023 | 21 Mar 2023 |
| 780 | leoramosaic.com | Namesilo, LLC | 28 Mar 2022 | 1 Jun 2023 | 28 Mar 2023 |
| 781 | leorabbi.com | Japan Registry Services Co., Ltd. | 2 Apr 2022 | 2 Jun 2023 | 2 Apr 2023 |
| 782 | leoraunkey.space | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Apr 2022 | 23 May 2022 | 8 Apr 2024 |
| 783 | leorad.xyz | Uniregistrar Corp | 14 Apr 2022 | 19 Apr 2025 | 14 Apr 2026 |
| 784 | leorahoffman.site | Network Solutions, LLC | 1 May 2022 | 13 Jul 2023 | 1 May 2023 |
| 785 | leorash.com | Google, Inc. | 2 May 2022 | 17 Apr 2025 | 2 May 2026 |
| 786 | leoraember.com | Namesilo, LLC | 6 May 2022 | 10 Jul 2023 | 6 May 2023 |
| 787 | leorayleign.site | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 May 2022 | 17 Jul 2023 | 11 May 2023 |
| 788 | leorano.com | 1&1 Internet AG | 17 May 2022 | 20 May 2025 | 17 May 2026 |
| 789 | leorassidedoorhairstudio.com | Google, Inc. | 18 May 2022 | 24 May 2025 | 18 May 2026 |
| 790 | leoralightsandinterior.com | GoDaddy.com, LLC | 18 May 2022 | 23 May 2023 | 18 May 2024 |
| 791 | leorahemlock.sbs | NameCheap, Inc. | 20 May 2022 | 14 Jun 2022 | 20 May 2024 |
| 792 | leoramarket.com | Google, Inc. | 31 May 2022 | 1 Jun 2023 | 31 May 2024 |
| 793 | leoraurimsung.com | Wix.com Ltd. | 8 Jun 2022 | 9 May 2024 | 8 Jun 2025 |
| 794 | leorarecovery.org | Google, Inc. | 13 Jun 2022 | 3 Jun 2024 | 13 Jun 2025 |
| 795 | leorarecovery.com | Google, Inc. | 13 Jun 2022 | 29 May 2024 | 13 Jun 2025 |
| 796 | leoragidesigns.com | Tucows Domains Inc. | 16 Jun 2022 | 3 Jun 2024 | 16 Jun 2025 |
| 797 | leorator.com | NameCheap, Inc. | 21 Jun 2022 | 22 May 2024 | 21 Jun 2025 |
| 798 | leorabark.com | URL Solutions, Inc. | 22 Jun 2022 | 30 Aug 2023 | 22 Jun 2023 |
| 799 | leoracare.com | GoDaddy.com, LLC | 29 Mar 2018 | 10 May 2025 | 29 Mar 2025 |
| 800 | leoracouture.store | Tucows Domains Inc. | 12 Jul 2022 | 21 Sep 2023 | 12 Jul 2023 |
| 801 | leoracouture.com | Network Solutions, LLC | 28 Sep 2023 | 10 Nov 2024 | 28 Sep 2024 |
| 802 | leorachits.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Jul 2022 | 3 Oct 2024 | 22 Jul 2024 |
| 803 | leoracafe.com | GoDaddy.com, LLC | 23 Jul 2022 | 28 Jul 2024 | 23 Jul 2026 |
| 804 | leoraweb.com | Internet Domain Services BS Corp | 24 Jul 2022 | 23 Jan 2025 | 24 Jul 2025 |
| 805 | leorandyangelinakyky.com | Media Elite Holdings Limited | 27 Jul 2022 | 28 Jul 2023 | 27 Jul 2023 |
| 806 | leorasalas.com | Register.it SPA | 1 Aug 2022 | 3 Oct 2023 | 1 Aug 2023 |
| 807 | leorabh.com | GoDaddy.com, LLC | 5 Aug 2022 | 6 Aug 2024 | 5 Aug 2026 |
| 808 | leoralashandbrows.com | Google, Inc. | 11 Aug 2022 | 28 Jul 2024 | 11 Aug 2025 |
| 809 | leorastepankovskysingingandweddingplanning.com | Media Elite Holdings Limited | 18 Aug 2022 | 21 Aug 2023 | 18 Aug 2023 |
| 810 | leorawalters.com | NameCheap, Inc. | 24 Aug 2022 | 25 Jul 2024 | 24 Aug 2025 |
| 811 | leora-store.com | CV. Jogjacamp | 27 Aug 2022 | 3 Nov 2023 | 27 Aug 2023 |
| 812 | leorazimmerman.com | Realtime Register B.V. | 6 Sep 2022 | 18 Nov 2024 | 6 Sep 2024 |
| 813 | leoraspitzer.com | Wix.com Ltd. | 19 Sep 2022 | 21 Aug 2024 | 19 Sep 2025 |
| 814 | leoratulia.com | Tucows Domains Inc. | 1 Oct 2022 | 12 Dec 2023 | 1 Oct 2023 |
| 815 | leoracoronel.com | Squarespace Domains LLC | 6 Oct 2022 | 21 Sep 2024 | 6 Oct 2025 |
| 816 | leorabrecher.online | Network Solutions, LLC | 15 Oct 2022 | 15 Oct 2022 | 15 Oct 2023 |
| 817 | leorank.top | P.A. Viet Nam Company Limited | 2 Jun 2022 | 7 Jul 2024 | 2 Jun 2024 |
| 818 | leoraandyonatan.com | Squarespace Domains LLC | 21 Oct 2022 | 12 Nov 2024 | 21 Oct 2025 |
| 819 | leorabtransport.com | Google, Inc. | 1 Nov 2022 | 2 Nov 2023 | 1 Nov 2024 |
| 820 | leorabusse.com | Google, Inc. | 3 Nov 2022 | 6 Nov 2024 | 3 Nov 2025 |
| 821 | leorafragnance.com | GoDaddy.com, LLC | 3 Nov 2022 | 15 Jan 2024 | 3 Nov 2023 |
| 822 | leorapid.com | Tucows Domains Inc. | 8 Nov 2022 | 8 Oct 2024 | 8 Nov 2025 |
| 823 | leorakalili.com | GoDaddy.com, LLC | 10 Nov 2022 | 11 Nov 2024 | 10 Nov 2026 |
| 824 | leorawarnes.com | Google, Inc. | 10 Nov 2022 | 27 Oct 2024 | 10 Nov 2025 |
| 825 | leorain123.xyz | Namesilo, LLC | 30 Nov 2022 | 18 Nov 2024 | 30 Nov 2026 |
| 826 | leoratobenatosezionali.it | - | 26 Mar 2021 | 7 Apr 2024 | 26 Mar 2024 |
| 827 | leorazzak.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 5 Nov 2009 | 29 Nov 2022 | 5 Nov 2025 |
| 828 | leoratrading.com | GoDaddy.com, LLC | 4 Dec 2022 | 15 Feb 2024 | 4 Dec 2023 |
| 829 | leoragroupofcompanies.com | GoDaddy.com, LLC | 9 Dec 2022 | 20 Jan 2024 | 9 Dec 2023 |
| 830 | leorarivlin.com | Wix.com Ltd. | 9 Dec 2022 | 9 Nov 2024 | 9 Dec 2025 |
| 831 | leoraker.com | Amazon Registrar, Inc. | 10 Dec 2022 | 2 Jan 2024 | 10 Dec 2025 |
| 832 | leorabagofficial.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 10 Dec 2022 | 19 Feb 2024 | 10 Dec 2023 |
| 833 | leoran.art | Dynadot, LLC | 15 Dec 2022 | 24 Feb 2024 | 15 Dec 2023 |
| 834 | leoralowy.org | GoDaddy.com, LLC | 19 Dec 2022 | 22 Sep 2024 | 19 Dec 2027 |
| 835 | leoralowy.info | GoDaddy.com, LLC | 19 Dec 2022 | 22 Sep 2024 | 19 Dec 2027 |
| 836 | leoralowy.net | GoDaddy.com, LLC | 19 Dec 2022 | 17 Sep 2024 | 19 Dec 2027 |
| 837 | leoralowy.com | GoDaddy.com, LLC | 19 Dec 2022 | 17 Sep 2024 | 19 Dec 2027 |
| 838 | leoramollieri.cyou | - | 23 Dec 2022 | 7 Mar 2024 | 23 Dec 2023 |
| 839 | leorareneeta.cyou | - | 23 Dec 2022 | 7 Mar 2024 | 23 Dec 2023 |
| 840 | leorafelipaje.cyou | - | 24 Dec 2022 | 8 Mar 2024 | 24 Dec 2023 |
| 841 | leoraardenvy.cyou | - | 25 Dec 2022 | 9 Mar 2024 | 25 Dec 2023 |
| 842 | leorafaelafo.cyou | - | 25 Dec 2022 | 9 Mar 2024 | 25 Dec 2023 |
| 843 | leoramikelru.cyou | - | 25 Dec 2022 | 9 Mar 2024 | 25 Dec 2023 |
| 844 | leora-ai.click | Amazon Registrar, Inc. | 13 Jun 2022 | 14 May 2025 | 13 Jun 2026 |
| 845 | leoragruen.com | NameCheap, Inc. | 27 Dec 2022 | 22 Dec 2024 | 27 Dec 2025 |
| 846 | leorabertale.cyou | - | 29 Dec 2022 | 13 Mar 2024 | 29 Dec 2023 |
| 847 | leoraedwinmo.cyou | - | 29 Dec 2022 | 13 Mar 2024 | 29 Dec 2023 |
| 848 | leorakhalilfi.cyou | - | 29 Dec 2022 | 13 Mar 2024 | 29 Dec 2023 |
| 849 | leoraalessandracu.cyou | - | 30 Dec 2022 | 14 Mar 2024 | 30 Dec 2023 |
| 850 | leoraantwonky.cyou | - | 30 Dec 2022 | 14 Mar 2024 | 30 Dec 2023 |
| 851 | leoralitzyju.cyou | - | 30 Dec 2022 | 14 Mar 2024 | 30 Dec 2023 |
| 852 | leorakaydenxo.cyou | - | 31 Dec 2022 | 14 Feb 2024 | 31 Dec 2023 |
| 853 | leorabeulahhy.cyou | - | 2 Jan 2023 | 16 Feb 2024 | 2 Jan 2024 |
| 854 | leoraclaudinewe.cyou | - | 2 Jan 2023 | 16 Feb 2024 | 2 Jan 2024 |
| 855 | leoraemmittte.cyou | - | 2 Jan 2023 | 16 Feb 2024 | 2 Jan 2024 |
| 856 | leoradejuanve.cyou | - | 3 Jan 2023 | 17 Feb 2024 | 3 Jan 2024 |
| 857 | leoraalexandrena.cyou | - | 3 Jan 2023 | 23 Mar 2024 | 3 Jan 2024 |
| 858 | leoragaragedoorforless.org | NameCheap, Inc. | 4 Jan 2023 | 10 Dec 2024 | 4 Jan 2026 |
| 859 | leoratillmanga.cyou | - | 4 Jan 2023 | 19 Mar 2024 | 4 Jan 2024 |
| 860 | leoranickolaswe.cyou | - | 4 Jan 2023 | 19 Mar 2024 | 4 Jan 2024 |
| 861 | leoragwenzi.cyou | - | 4 Jan 2023 | 19 Mar 2024 | 4 Jan 2024 |
| 862 | leoraalbapo.cyou | - | 5 Jan 2023 | 20 Mar 2024 | 5 Jan 2024 |
| 863 | leoraannabelleho.cyou | - | 5 Jan 2023 | 20 Mar 2024 | 5 Jan 2024 |
| 864 | leoradaishala.cyou | NameKing.com Inc. | 5 Jan 2023 | 20 Mar 2024 | 5 Jan 2024 |
| 865 | leoramirezcyber.com | CloudFlare, Inc. | 5 Jan 2023 | 6 Dec 2024 | 5 Jan 2026 |
| 866 | leoraheidihy.cyou | - | 9 Jan 2023 | 23 Feb 2024 | 9 Jan 2024 |
| 867 | leorabeacht.click | NameCheap, Inc. | 10 Jan 2023 | 21 Feb 2024 | 10 Jan 2024 |
| 868 | leoracarlisleq.click | NameCheap, Inc. | 11 Jan 2023 | 22 Feb 2024 | 11 Jan 2024 |
| 869 | leoravgfgcervantes.click | NameCheap, Inc. | 14 Jan 2023 | 25 Feb 2024 | 14 Jan 2024 |
| 870 | leorahenryma.cyou | - | 14 Jan 2023 | 29 Mar 2024 | 14 Jan 2024 |
| 871 | leoracarleeke.cyou | - | 14 Jan 2023 | 29 Mar 2024 | 14 Jan 2024 |
| 872 | leorahershelsi.cyou | - | 16 Jan 2023 | 31 Mar 2024 | 16 Jan 2024 |
| 873 | leorabransonlu.cyou | - | 17 Jan 2023 | 2 Mar 2024 | 17 Jan 2024 |
| 874 | leoravgrfarriaga.click | NameCheap, Inc. | 19 Jan 2023 | 1 Mar 2024 | 19 Jan 2024 |
| 875 | leoraemilymo.cyou | - | 19 Jan 2023 | 4 Mar 2024 | 19 Jan 2024 |
| 876 | leoratrystante.cyou | - | 21 Jan 2023 | 6 Mar 2024 | 21 Jan 2024 |
| 877 | leoravgrflovelace.click | NameCheap, Inc. | 22 Jan 2023 | 4 Mar 2024 | 22 Jan 2024 |
| 878 | leorafinedesign.com | Hostinger, UAB | 22 Jan 2023 | 26 Dec 2024 | 22 Jan 2026 |
| 879 | leoranzolin.com.br | - | 11 Jan 2011 | 13 Dec 2016 | 11 Jan 2027 |
| 880 | leoramos.com.br | - | 19 Oct 2021 | 27 Sep 2024 | 19 Oct 2025 |
| 881 | leorad.com.br | - | 23 Feb 2019 | 12 Mar 2024 | 23 Feb 2026 |
| 882 | leorah-home.com | Hosting Concepts B.V. dba Openprovider | 29 Jan 2023 | 9 Apr 2024 | 29 Jan 2024 |
| 883 | leora-topketosupplement.buzz | Porkbun, LLC | 20 Jun 2022 | 31 Jul 2023 | 20 Jun 2023 |
| 884 | leorabarak.ca | - | 13 Nov 2019 | 14 Nov 2023 | 13 Nov 2025 |
| 885 | leoralynn.com | Google, Inc. | 31 Jan 2023 | 31 Jan 2023 | 31 Jan 2024 |
| 886 | leorarubin.com | GoDaddy.com, LLC | 1 Feb 2023 | 6 May 2025 | 1 Feb 2026 |
| 887 | leorastg.click | Amazon Registrar, Inc. | 22 Jul 2022 | 22 Jun 2024 | 22 Jul 2025 |
| 888 | leorawatsica.click | NameCheap, Inc. | 16 Aug 2022 | 16 Aug 2023 | 16 Aug 2024 |
| 889 | leoracandles.com | Key-Systems GmbH | 7 Feb 2023 | 22 Apr 2025 | 7 Feb 2025 |
| 890 | leorajapompa.com | Web Commerce Communications Limited dba WebNic.cc | 8 Feb 2023 | 8 Feb 2023 | 8 Feb 2026 |
| 891 | leorain.cn | - | 24 Aug 2019 | - | 24 Aug 2027 |
| 892 | leoraaileen.com | Cronon AG | 15 Feb 2023 | 6 Apr 2025 | 15 Feb 2026 |
| 893 | leoraileen.com | Wix.com Ltd. | 15 Feb 2023 | 16 Jan 2025 | 15 Feb 2027 |
| 894 | leora-movers.com | GoDaddy.com, LLC | 17 Feb 2023 | 30 Apr 2024 | 17 Feb 2024 |
| 895 | leoratmontage.com | Network Solutions, LLC | 6 Feb 2017 | 8 Jun 2024 | 6 Feb 2026 |
| 896 | leoralph.dev | CloudFlare, Inc. | 26 Feb 2023 | 27 Jan 2025 | 26 Feb 2026 |
| 897 | leorallye.com | Cronon AG | 23 Feb 2023 | 14 Apr 2025 | 23 Feb 2026 |
| 898 | leorae.com | Wild West Domains, LLC | 15 Oct 2017 | 17 Oct 2024 | 15 Oct 2025 |
| 899 | leorarlevy.com | GoDaddy.com, LLC | 14 Nov 2017 | 15 Nov 2024 | 14 Nov 2025 |
| 900 | leorafurniture.pl | - | 7 Feb 2022 | 28 Feb 2023 | - |
| 901 | leoralorrainephotography.com | Network Solutions, LLC | 8 Dec 2017 | 20 Jan 2025 | 8 Dec 2024 |
| 902 | leoraberman.com | GoDaddy.com, LLC | 25 Dec 2017 | 6 Mar 2024 | 25 Dec 2023 |
| 903 | leoraabgwstest.com | Google, Inc. | 3 Mar 2023 | 3 Mar 2023 | 3 Mar 2024 |
| 904 | leoraecollections.com | Wild West Domains, LLC | 14 Jan 2018 | 26 Jan 2024 | 14 Jan 2025 |
| 905 | leorahome.com | Realtime Register B.V. | 6 Mar 2023 | 11 Mar 2025 | 6 Mar 2026 |
| 906 | leoraweiner.com | GoDaddy.com, LLC | 5 Feb 2018 | 5 Feb 2025 | 5 Feb 2026 |
| 907 | leorabridal.info | Key-Systems GmbH | 8 Mar 2023 | 21 Apr 2024 | 8 Mar 2024 |
| 908 | leoragemini.com | Google, Inc. | 8 Mar 2023 | 8 May 2024 | 8 Mar 2024 |
| 909 | leoralau.com | GoDaddy.com, LLC | 19 Mar 2018 | 20 Mar 2023 | 19 Mar 2028 |
| 910 | leorafa.com | NameCheap, Inc. | 10 Mar 2023 | 8 Feb 2025 | 10 Mar 2026 |
| 911 | leorascottiewy.best | NameKing.com Inc. | 12 Mar 2023 | 26 Apr 2024 | 12 Mar 2024 |
| 912 | leorasambu.buzz | NameKing.com Inc. | 12 Mar 2023 | 1 Apr 2024 | 12 Mar 2024 |
| 913 | leorapublicspeaking.com | Wild West Domains, LLC | 26 Apr 2018 | 27 Apr 2025 | 26 Apr 2026 |
| 914 | leorapaigek.com | GoDaddy.com, LLC | 13 Mar 2023 | 24 Apr 2025 | 13 Mar 2025 |
| 915 | leoraet.com | Wix.com Ltd. | 29 Feb 2020 | 10 May 2023 | 28 Feb 2023 |
| 916 | leorakrowitz.com | Tucows Domains Inc. | 26 Mar 2020 | 11 Mar 2025 | 26 Mar 2026 |
| 917 | leoraines.com | eNom, Inc. | 17 Mar 2023 | 16 Feb 2025 | 17 Mar 2026 |
| 918 | leorazimiles.com | NameCheap, Inc. | 14 May 2020 | 14 Apr 2025 | 14 May 2026 |
| 919 | leorachid.com | NameCheap, Inc. | 31 May 2020 | 7 May 2024 | 31 May 2025 |
| 920 | leorasanchez.com | Google, Inc. | 23 Jun 2020 | 8 Jun 2024 | 23 Jun 2025 |
| 921 | leorasteiner.com | Google, Inc. | 20 Jul 2020 | 5 Jul 2024 | 20 Jul 2025 |
| 922 | leoraiboutique.com | Wix.com Ltd. | 11 Aug 2020 | 12 Jul 2024 | 11 Aug 2026 |
| 923 | leoragilgur.com | Wix.com Ltd. | 12 Aug 2020 | 8 Aug 2024 | 12 Aug 2026 |
| 924 | leoraluxe.com | Hostinger, UAB | 26 May 2025 | 26 May 2025 | 26 May 2026 |
| 925 | leoramirezfitness.com | Wix.com Ltd. | 20 Mar 2023 | 30 May 2024 | 20 Mar 2024 |
| 926 | leoramakes.com | Wix.com Ltd. | 23 Sep 2020 | 24 Aug 2024 | 23 Sep 2025 |
| 927 | leoramartin.com | Wix.com Ltd. | 7 Oct 2020 | 10 Sep 2024 | 7 Oct 2025 |
| 928 | leoragluck.com | NameCheap, Inc. | 24 Dec 2020 | 24 Nov 2024 | 24 Dec 2025 |
| 929 | leoralondy.com | GoDaddy.com, LLC | 22 Mar 2023 | 23 Mar 2025 | 22 Mar 2027 |
| 930 | leoralondy.net | GoDaddy.com, LLC | 22 Mar 2023 | 23 Mar 2025 | 22 Mar 2027 |
| 931 | leorawexler.com | NameCheap, Inc. | 9 Jan 2021 | 20 Feb 2024 | 9 Jan 2024 |
| 932 | leoratwexler.com | NameCheap, Inc. | 9 Jan 2021 | 12 Jan 2023 | 9 Jan 2024 |
| 933 | leoracle.us | GoDaddy.com, LLC | 2 Aug 2022 | 13 Sep 2024 | 2 Aug 2024 |
| 934 | leoradiance.com | Namesilo, LLC | 28 Mar 2021 | 1 Jun 2023 | 28 Mar 2023 |
| 935 | leoranorbertobu.best | NameKing.com Inc. | 26 Mar 2023 | 10 May 2024 | 26 Mar 2024 |
| 936 | leora1realty.com | Wix.com Ltd. | 30 Mar 2021 | 10 May 2025 | 30 Mar 2025 |
| 937 | leorapo.com | NameCheap, Inc. | 8 Apr 2021 | 8 Apr 2023 | 8 Apr 2024 |
| 938 | leoraknits.com | GoDaddy.com, LLC | 8 May 2021 | 20 Jul 2023 | 8 May 2023 |
| 939 | leoramnl.com | Tucows Domains Inc. | 20 May 2021 | 31 Jul 2023 | 20 May 2023 |
| 940 | leorarooms.com | NameCheap, Inc. | 29 Mar 2023 | 1 Mar 2025 | 29 Mar 2026 |
| 941 | leoracewear.com | NameKing.com Inc. | 21 May 2021 | 4 Aug 2023 | 21 May 2023 |
| 942 | leoracharisma.com | Namesilo, LLC | 22 May 2021 | 23 May 2023 | 22 May 2024 |
| 943 | leoranautaarts.com | Wix.com Ltd. | 3 Oct 2021 | 13 Dec 2023 | 3 Oct 2023 |
| 944 | leorahclinical.com | GoDaddy.com, LLC | 1 Nov 2021 | 3 Nov 2023 | 1 Nov 2025 |
| 945 | leorakalish.com | eNom, Inc. | 17 Nov 2021 | 18 Oct 2024 | 17 Nov 2025 |
| 946 | leoraforct.com | GoDaddy.com, LLC | 31 Jan 2022 | 1 Feb 2024 | 31 Jan 2026 |
| 947 | leorajobs.com | GoDaddy.com, LLC | 9 Apr 2023 | 21 May 2024 | 9 Apr 2024 |
| 948 | leora4connecticut.com | GoDaddy.com, LLC | 8 Feb 2022 | 22 Mar 2023 | 8 Feb 2023 |
| 949 | leoraforconnecticut.com | GoDaddy.com, LLC | 8 Feb 2022 | 22 Mar 2023 | 8 Feb 2023 |
| 950 | leoraforsenate.com | GoDaddy.com, LLC | 8 Feb 2022 | 22 Mar 2023 | 8 Feb 2023 |
| 951 | leora-lighting.com | Webfusion Ltd. | 9 Feb 2022 | 10 Feb 2025 | 9 Feb 2027 |
| 952 | leoraskids.com | GoDaddy.com, LLC | 1 Mar 2022 | 12 Apr 2025 | 1 Mar 2025 |
| 953 | leoravisual.com | Namesilo, LLC | 6 Apr 2022 | 10 Jun 2023 | 6 Apr 2023 |
| 954 | leoralea.com | 1&1 Internet AG | 12 Apr 2023 | 12 Apr 2024 | 12 Apr 2025 |
| 955 | leoraeproperties.com | Wild West Domains, LLC | 20 Apr 2022 | 1 May 2024 | 20 Apr 2025 |
| 956 | leorapilevar.com | GoDaddy.com, LLC | 20 Apr 2022 | 6 Apr 2025 | 20 Apr 2026 |
| 957 | leorarosenwald.com | GoDaddy.com, LLC | 2 May 2022 | 2 May 2024 | 2 May 2026 |
| 958 | leoraenglard.com | GoDaddy.com, LLC | 2 May 2022 | 2 May 2024 | 2 May 2026 |
| 959 | leoraslife.com | GoDaddy.com, LLC | 8 May 2022 | 9 May 2025 | 8 May 2026 |
| 960 | leoraresortsandspa.com | GoDaddy.com, LLC | 17 May 2022 | 28 Jun 2023 | 17 May 2023 |
| 961 | leorafreund.com | GoDaddy.com, LLC | 9 Jun 2022 | 21 Jul 2024 | 9 Jun 2024 |
| 962 | leoraestorage.com | Wild West Domains, LLC | 13 Jun 2022 | 25 Aug 2024 | 13 Jun 2024 |
| 963 | leorangeco.com | GoDaddy.com, LLC | 14 Jun 2022 | 22 May 2024 | 14 Jun 2026 |
| 964 | leorabehavioralhealth.com | GoDaddy.com, LLC | 16 Jun 2022 | 17 Jun 2024 | 16 Jun 2026 |
| 965 | leoragroup.com | GoDaddy.com, LLC | 16 Jun 2022 | 17 Jun 2024 | 16 Jun 2026 |
| 966 | leoratherapy.com | GoDaddy.com, LLC | 16 Jun 2022 | 17 Jun 2024 | 16 Jun 2026 |
| 967 | leoraesterra.com | NameCheap, Inc. | 28 Jun 2022 | 27 Jun 2024 | 28 Jun 2025 |
| 968 | leoraesterramd.com | NameCheap, Inc. | 28 Jun 2022 | 9 Sep 2024 | 28 Jun 2024 |
| 969 | leoramon.com | GoDaddy.com, LLC | 28 Jun 2022 | 7 Sep 2022 | 28 Jun 2032 |
| 970 | leoragreen.com | Squarespace Domains LLC | 30 Jun 2022 | 16 Jun 2024 | 30 Jun 2025 |
| 971 | leorainbow.cyou | Namesilo, LLC | 24 Apr 2022 | 10 Jun 2022 | 24 Apr 2024 |
| 972 | leorah.design | Network Solutions, LLC | 2 May 2019 | 8 Apr 2025 | 2 May 2026 |
| 973 | leorachack.fun | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Mar 2022 | 30 Apr 2022 | 21 Mar 2024 |
| 974 | leoraunkey.fun | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Apr 2022 | 23 May 2022 | 8 Apr 2024 |
| 975 | leorainfotech.in | GoDaddy.com, LLC | 8 Dec 2020 | 13 Dec 2024 | 8 Dec 2025 |
| 976 | leoraa.in | GoDaddy.com, LLC | 11 Dec 2019 | 20 Oct 2024 | 11 Dec 2025 |
| 977 | leoramoviehouse.in | GoDaddy.com, LLC | 4 Dec 2020 | 15 Jan 2025 | 4 Dec 2024 |
| 978 | leorato.it | - | 26 Dec 2018 | 20 Dec 2023 | 26 Dec 2023 |
| 979 | leoralevy.net | DNC Holdings, Inc. | 17 Apr 2023 | 29 May 2025 | 17 Apr 2025 |
| 980 | leoratocomfort.it | - | 3 Apr 2020 | 19 Apr 2025 | 3 Apr 2026 |
| 981 | leorarlevy.net | DNC Holdings, Inc. | 18 Apr 2023 | 28 May 2025 | 18 Apr 2026 |
| 982 | leorahoffman.net | Network Solutions, LLC | 29 Dec 2017 | 4 Dec 2024 | 29 Dec 2027 |
| 983 | leorae.net | Wild West Domains, LLC | 14 Jan 2018 | 15 Jan 2025 | 14 Jan 2026 |
| 984 | leorasarahcockrell.net | Squarespace Domains LLC | 20 Feb 2021 | 5 Feb 2025 | 20 Feb 2026 |
| 985 | leorarecovery.net | Google, Inc. | 13 Jun 2022 | 29 May 2024 | 13 Jun 2025 |
| 986 | leoravensbergen.nl | One.com A/S | 28 Jan 2013 | 27 Jan 2025 | - |
| 987 | leorally.nl | - | 6 Apr 2024 | 3 Jun 2024 | - |
| 988 | leorakannekens.nl | - | 7 Oct 2017 | 11 Nov 2024 | - |
| 989 | leorapolyplast.com | Wild West Domains, LLC | 26 Apr 2023 | 26 Apr 2023 | 26 Apr 2026 |
| 990 | leorasquiltingandmore.com | GoDaddy.com, LLC | 26 Apr 2023 | 5 May 2023 | 26 Apr 2028 |
| 991 | leorahoffman.org | Network Solutions, LLC | 3 Jan 2019 | 9 Dec 2024 | 3 Jan 2028 |
| 992 | leoraiken.org | GoDaddy.com, LLC | 1 Aug 2019 | 31 Jul 2024 | 1 Aug 2025 |
| 993 | leorafael.org | Wild West Domains, LLC | 8 Oct 2019 | 22 Nov 2024 | 8 Oct 2025 |
| 994 | leorastogi.org | GoDaddy.com, LLC | 23 Oct 2019 | 7 Aug 2024 | 23 Oct 2025 |
| 995 | leorasmiracleworkinghands.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Jan 2021 | 16 Feb 2024 | 5 Jan 2024 |
| 996 | leoralabs.com | Network Solutions, LLC | 6 May 2023 | 19 Jul 2024 | 6 May 2024 |
| 997 | leoraswayinc.com | GoDaddy.com, LLC | 6 May 2023 | 19 May 2025 | 6 May 2026 |
| 998 | leoravus.co.uk | - | 15 Feb 2022 | 15 Feb 2022 | 15 Feb 2023 |
| 999 | leoraluxurylodges.co.uk | - | 24 May 2021 | 24 May 2024 | 24 May 2024 |
| 1000 | leorahoneyman.studio | eNom, Inc. | 20 May 2024 | 10 May 2025 | 20 May 2026 |
Displaying 1,000 out of 1,276 domains starting with the keyword "LEORA". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=leora
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |