Our database now contains whois records of 633 Million (633,634,414) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [633 Million Domains] $10,000 Details

Keyword: LEH

Reverse Whois » KEYWORD [leh ]  { 42,570 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1leh.nic.in----
2leh.coGoDaddy.com, LLC22 Jul 201021 Jul 201721 Jul 2018
3leh.meGoDaddy.com, LLC7 Feb 200919 Feb 20177 Feb 2018
4leh.bizNameCheap, Inc.6 Jun 202121 Jun 20246 Jun 2024
5leh.blackfridayUniregistrar Corp23 Sep 201423 Sep 201423 Sep 2015
6leh.christmasUniregistrar Corp30 Sep 20141 Oct 201430 Sep 2015
7leh.xyzDynadot, LLC24 Oct 20207 Jan 202524 Oct 2025
8leh.helpUniregistrar Corp31 Jan 201531 Jan 201531 Jan 2016
9leh.dietUniregistrar Corp31 Jan 201531 Jan 201531 Jan 2016
10leh.propertyUniregistrar Corp31 Jan 20154 Feb 201531 Jan 2016
11leh.hostingUniregistrar Corp31 Jan 201531 Jan 201531 Jan 2016
12leh.coach1&1 Internet AG11 Mar 201511 Mar 201511 Mar 2016
13leh.partyCronon AG3 Apr 2015-2 Apr 2016
14leh.flowersUniregistrar Corp7 Apr 20157 Apr 20157 Apr 2016
15leh.men1&1 Internet AG16 Sep 201531 Oct 201616 Sep 2017
16leh.asiaAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…4 Dec 20249 Dec 20244 Dec 2025
17leh.winChengdu West Dimension Digital Technology Co., Ltd…25 Sep 20153 Apr 201724 Sep 2017
18leh.walesMesh Digital Limited13 Oct 201513 Oct 201513 Oct 2016
19leh.siteKey-Systems GmbH7 Jun 20187 Jun 20187 Jun 2019
20leh.netUniregistrar Corp19 Jun 199814 May 202518 Jun 2027
21leh.orgGoDaddy.com, LLC8 Sep 19976 Jul 20247 Sep 2031
22leh.comGoDaddy.com, LLC5 Mar 199930 May 20255 Mar 2027
23leh.xinAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…9 Nov 2015-9 Nov 2016
24leh.bidChengdu West Dimension Digital Technology Co., Ltd…20 Nov 201522 Oct 201619 Nov 2017
25leh.emailMesh Digital Limited26 Nov 20151 Nov 202426 Nov 2025
26leh.com.br-7 Feb 20057 Feb 20257 Feb 2030
27leh.redWest263 International Limited11 Dec 201511 Dec 201511 Dec 2016
28leh.kimWest263 International Limited13 Dec 201513 Dec 201513 Dec 2016
29leh.loanTodaynic.com Inc.16 Dec 201516 Dec 201515 Dec 2016
30leh.clubEJEE Group Holdings Limited28 Dec 201528 Jan 202027 Dec 2020
31leh.mobi-10 Aug 202510 Aug 202510 Aug 2026
32leh.onlineWest263 International Limited20 Apr 201720 Apr 201720 Apr 2018
33leh.techWest263 International Limited24 Apr 201718 Jun 201724 Apr 2018
34leh.dateNameCheap, Inc.26 Apr 201826 Apr 201826 Apr 2019
35leh.newsName.com, Inc.12 Sep 201824 Nov 202412 Sep 2024
36leh.pinkWest263 International Limited29 Feb 2016-28 Feb 2017
37leh.blueWest263 International Limited4 Mar 2016-4 Mar 2017
38leh.oooChengdu West Dimension Digital Technology Co., Ltd…17 Apr 201617 Apr 201617 Apr 2017
39leh.schoolGoDaddy.com, LLC12 Sep 201913 Aug 202412 Sep 2025
40leh.trade-25 May 201625 May 201624 May 2017
41leh.pub-31 May 201631 May 201631 May 2017
42leh.spaceTLD Registrar Solutions Ltd.17 Jun 201617 Jun 201617 Jun 2017
43leh.forsaleeNom, Inc.19 Jan 201515 Sep 201719 Jan 2018
44leh.scienceAlpnames Limited25 Feb 201521 May 201624 Feb 2017
45leh.ind.in-31 May 201228 Jul 201731 May 2018
46leh.in-22 Apr 200914 Apr 201622 Apr 2018
47leh.lolUniregistrar Corp12 Aug 201512 May 201612 Aug 2016
48leh.wangeName Technology Co., Ltd.8 Jan 201511 Sep 20178 Jan 2019
49leh.linkUniregistrar Corp15 Apr 201411 May 201615 Apr 2017
50leh.hostNameCheap, Inc.2 Aug 20167 Sep 20172 Aug 2017
51leh.infoPSI-USA, Inc. dba Domain Robot30 Mar 20044 Jul 202530 Mar 2026
52leh.usKey-Systems GmbH5 Jun 200413 Sep 20174 Jun 2018
53leh.telName.com, Inc.27 Jun 201025 Nov 201626 Jun 2018
54leh.ch----
55leh.de--24 Aug 2010-
56leh.dk-18 Mar 1999-31 Mar 2018
57leh.frOVH sas26 Jul 200426 Jul 202526 Jul 2026
58leh.li----
59leh.kr-20 May 201116 Oct 201720 May 2018
60leh.it-7 Feb 20089 Sep 202424 Aug 2025
61leh.pl-21 Sep 201319 Oct 202422 Oct 2025
62leh.co.uk-9 Sep 19999 Sep 20249 Sep 2025
63leh.websiteAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…2 Nov 20162 Nov 20162 Nov 2017
64leh.networkNameCheap, Inc.18 Dec 202018 Dec 202018 Dec 2021
65leh.co.in-17 Jan 201015 Feb 201617 Jan 2019
66leh.lifeGandi SAS22 Jun 202322 Jun 202522 Jun 2026
67leh.guideGoDaddy.com, LLC3 Aug 20173 Aug 20173 Aug 2018
68leh.org.uk-8 Jun 20179 May 20238 Jun 2026
69leh.toursDynadot, LLC7 Feb 202128 Jan 20257 Feb 2026
70leh.travelDynadot, LLC3 Jan 20222 Mar 20253 Jan 2026
71leh.tipsNamesilo, LLC5 Dec 20194 Mar 20205 Dec 2020
72leh.onlCronon AG13 Dec 201922 Mar 202313 Dec 2023
73leh.ccGoDaddy.com, LLC12 Dec 200613 Dec 202412 Dec 2025
74leh.rentalsDynadot, LLC7 Feb 202128 Jan 20257 Feb 2026
75leh.inkAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 Mar 202125 Mar 202125 Mar 2022
76leh.servicesKey-Systems, LLC5 Feb 202222 Mar 20255 Feb 2026
77leh.tvOVH sas22 Oct 20196 Dec 202422 Oct 2025
78leh.berlinRegistryGate GmbH21 Jul 201720 Dec 202421 Jul 2026
79leh.one-11 Jan 202526 Jun 202511 Jan 2026
80leh.mnReserved for Internal Registry Use9 Nov 201028 Oct 20229 Nov 2023
81leh.bikeGoDaddy.com, LLC30 Apr 202211 Jun 202330 Apr 2023
82leh.appDynadot, LLC14 Jul 201924 Jul 202514 Jul 2025
83leh.be-27 Nov 2015--
84leh.com.cn-4 Apr 2006-4 Apr 2026
85leh.ht-27 Jan 202228 Jan 202227 Jan 2024
86leh.charityName.net, Inc.19 Sep 201819 Sep 202319 Sep 2024
87leh.countryNameCheap, Inc.13 Apr 202323 Mar 202513 Apr 2026
88leh.consultingCronon AG16 Sep 202131 Oct 202416 Sep 2025
89leh.icuKey-Systems, LLC29 May 201830 Jan 202529 May 2028
90leh.jp-13 Aug 20081 Sep 202431 Aug 2025
91leh.worksGabia, Inc.3 May 202311 Jul 20243 May 2024
92leh.vipGoDaddy.com, LLC16 Jun 201728 Jul 202316 Jun 2023
93leh.saleNamesilo, LLC8 May 202311 Jul 20248 May 2024
94leh.devOVH sas12 May 20231 May 202512 May 2026
95leh.ro-15 Nov 2018-7 Nov 2025
96leh.studioNameCheap, Inc.29 Jul 202210 Oct 202329 Jul 2023
97leh.uk-30 Oct 201721 May 202530 Oct 2025
98leh.holidayDynadot, LLC6 Jul 202324 Jul 20256 Jul 2026
99leh.za.comNameKing.com Inc.13 Sep 202311 Jun 202413 Sep 2024
100leh.worldNameKing.com Inc.4 Feb 202529 May 20254 Feb 2026
101leh.todayCommuniGal Communication Ltd.25 Feb 20252 Mar 202525 Feb 2026
102leh.groupOVH sas15 Dec 202316 Dec 202415 Dec 2025
103leh.brokerNameCheap, Inc.21 Feb 20244 Apr 202521 Feb 2025
104leh.ru-2 Oct 2005-2 Oct 2025
105leh.hu-18 Nov 2010--
106leh.coolAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…17 May 202418 May 202517 May 2026
107leh.nl-17 Feb 200019 Nov 2021-
108leh.rocksGoDaddy.com, LLC17 Aug 202422 Aug 202417 Aug 2025
109leh.sa.comNameKing.com Inc.13 Sep 202314 Sep 202413 Sep 2025
110leh.se-12 Feb 201826 Jun 202512 Feb 2026
111leh.ioTucows Domains Inc.19 Jan 201112 May 202419 Jan 2026
112lehtml.comNameCheap, Inc.10 Apr 202311 Mar 202510 Apr 2026
113lehrerweb.at--27 Dec 2012-
114lehmanns.de--26 Oct 2011-
115lehrerforen.de--3 Jan 2017-
116lehighvalleyupdates.comeNom, Inc.3 May 20123 May 20123 May 2013
117lehrbuch.pl-1 Jan 20251 Jan 20251 Jan 2026
118lehecai.comInternet Domain Name System Beijing Engineering Re…19 May 201018 Jan 202519 May 2026
119lehanka.de--18 Mar 2017-
120lehmiller.comGoDaddy.com, LLC22 Dec 201123 Dec 202022 Dec 2025
121lehren.tvGoDaddy.com, LLC7 Apr 200613 Jun 20247 Apr 2026
122lehighcounty.orgGoDaddy.com, LLC29 Oct 199621 Jul 202428 Oct 2027
123lehollandaisvolant.netOnline SAS27 Jun 200913 Jan 202527 Jun 2026
124lehool.comDynadot9 LLC7 Jan 202511 Jan 20257 Jan 2026
125lehrer-online.de--20 Dec 2018-
126lehrerfortbildung-bw.de--13 Nov 2007-
127lehrerfreund.de--30 Oct 2020-
128lehost.netBeijing Lanhai Jiye Technology Co., Ltd1 Dec 202410 Jul 20251 Dec 2025
129lehigh.edu-29 Mar 19886 Jul 201631 Jul 2018
130lehman.edu-6 Jun 20026 Apr 201731 Jul 2018
131lehrershop.comEPAG Domainservices GmbH15 Jul 200916 Jul 202515 Jul 2026
132lehrmeister.jp-1 Aug 20011 Sep 202431 Aug 2025
133lehs.org.uk-5 Sep 20026 Aug 20245 Sep 2025
134lehangart.comOnline SAS27 Nov 200110 Mar 202427 Nov 2026
135lehe.comeName Technology Co., Ltd.15 Feb 200012 Mar 202515 Feb 2026
136lehighsports.comGoDaddy.com, LLC4 Jun 20022 Jun 20254 Jun 2026
137lehighvalleylive.comCSC Corporate Domains, Inc.25 Oct 200422 Oct 202325 Oct 2025
138lehman.comCSC Corporate Domains, Inc.26 Mar 199323 Mar 202527 Mar 2026
139lehmbauer.com1&1 Internet AG10 Jul 200930 Apr 202510 Jul 2026
140lehner-versand.ch----
141leho.comHiChina Zhicheng Technology Limited14 Feb 200130 Mar 202214 Feb 2029
142lehrmittelverlag-zuerich.ch----
143lehsys.comTurnCommerce, Inc. DBA NameBright.com19 Sep 200427 Apr 202519 Sep 2025
144leh-ladakh.comGoDaddy.com, LLC5 Mar 20255 Mar 20255 Mar 2026
145leha.comGoDaddy.com, LLC29 Mar 200025 Jan 202329 Mar 2026
146lehadegustateur.comKey-Systems GmbH11 Oct 201924 Dec 202411 Oct 2024
147lehavina.comNameKing.com Inc.17 Jul 20142 Jul 202517 Jul 2026
148lehc.ca-16 Oct 20071 Oct 202416 Oct 2025
149lehenga.pk-21 Jan 2014-21 Jan 2016
150lehighdefense.comGoDaddy.com, LLC27 Aug 201017 Mar 202327 Aug 2029
151lehighvalleyhomesearching.comGoDaddy.com, LLC24 Feb 201324 Feb 201424 Feb 2016
152lehili.infoGoDaddy.com, LLC4 Feb 20135 Feb 20174 Feb 2018
153lehladakhhotels.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Aug 200725 Aug 202425 Aug 2025
154lehladakhindia.comOnlineNIC, Inc.10 Sep 200331 Mar 202530 Apr 2026
155lehladakhtours.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Feb 200210 Feb 20251 Feb 2026
156lehladakhtours.inGoDaddy.com, LLC18 Jun 201930 Jul 202418 Jun 2024
157lehladakhtoursindia.comInternet Domain Services BS Corp14 Nov 202014 Nov 202014 Nov 2021
158lehlel.comDropCatch.com 385 LLC3 May 20244 May 20243 May 2026
159lehmann-it.de--22 Apr 2025-
160lehmannaviation.comInfomaniak Network SA7 Feb 20024 Feb 20257 Feb 2026
161lehmannmaupin.comregister.com, Inc.25 Jan 199927 Jan 202125 Jan 2031
162lehmanns.ch-17 Sep 2004--
163lehmannsbio.de--11 Dec 2020-
164lehmans.comGoDaddy.com, LLC28 Mar 199612 Sep 202215 Jul 2027
165lehning.comIP Twins SAS13 Nov 199623 Jun 202212 Nov 2025
166lehoicaphe.comNameCheap, Inc.6 Jan 201116 Dec 20246 Jan 2026
167leholt.dk-6 Jun 2001-30 Jun 2026
168lehrberuf.infoKey-Systems GmbH13 Mar 200627 Apr 202513 Mar 2026
169lehrcint.com.auMelbourne IT, Ltd-15 May 2013-
170lehrer-online-bw.de--26 Jan 2024-
171lehrer-werden.de--5 Feb 2015-
172lehrer.bizMesh Digital Limited4 Oct 200110 Nov 20246 Nov 2025
173lehrerbuero.de--18 Dec 2024-
174lehrermaterial.de--9 Aug 2018-
175lehrerservice.at--10 Apr 2013-
176lehrmittelperlen.netPSI-USA, Inc. dba Domain Robot9 Feb 201110 Feb 202512 Dec 2025
177lehtikuningas.fiAcens Technologies, S.L.U.14 Nov 20098 May 201721 Oct 2017
178lehtiluukku.fi-13 Jan 20097 Jul 201713 Jan 2018
179lehu.pt-18 May 2012-17 May 2016
180lehumall.comBeijing Lanhai Jiye Technology Co., Ltd7 Jun 201324 Oct 20247 Jun 2026
181lehuobao.comeName Technology Co., Ltd.16 Dec 200927 Jul 202516 Dec 2029
182lehuodichan.com-25 May 202526 May 202525 May 2026
183lehvoss.de--9 Jan 2023-
184lehuotimes.comNamesilo, LLC13 Nov 202114 Nov 202113 Nov 2022
185lehuoqingnian.comeName Technology Co., Ltd.21 Oct 201417 Nov 201721 Oct 2018
186lehuopanjin.com-31 Mar 20221 Apr 202331 Mar 2024
187lehmanfraud.comPheenix, Inc.21 Oct 201421 Oct 201421 Oct 2015
188lehlandestates.comGoDaddy.com, LLC21 Oct 201421 Oct 201421 Oct 2015
189lehighvalleywellnessguide.comKey-Systems GmbH22 Jun 20234 Sep 202422 Jun 2024
190lehanetax.comeNom, Inc.21 Oct 201422 Sep 202421 Oct 2025
191lehecai.infoName.com, Inc.22 Oct 201422 Oct 201422 Oct 2015
192lehuynh-env.comGMO Internet Inc.16 Apr 202427 May 202516 Apr 2025
193lehuoyuan.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…17 Mar 20231 Jul 202417 Mar 2026
194leht-gtc.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Oct 201423 Oct 201423 Oct 2015
195lehsg86.comGMO Internet Inc.22 Oct 201422 Oct 201422 Oct 2015
196lehnenconcretecontractors.comTucows Domains Inc.22 Oct 201426 Oct 201722 Oct 2017
197lehighges.comTucows Domains Inc.22 Oct 201426 Oct 201522 Oct 2016
198lehaha234.comBeijing Innovative Linkage Technology Ltd. dba dns…22 Oct 201422 Oct 201422 Oct 2016
199lehdentilaus.fi----
200lehi-ut.gov----
201lehockey.ca-25 Oct 20239 Dec 202425 Oct 2025
202lehtiapaja.fiAcens Technologies, S.L.U.3 Mar 20035 May 201731 Aug 2017
203lehtilehti.fi----
204lehtipiste.fi----
205lehmanndesign.pl-24 Feb 200719 Feb 202523 Feb 2026
206lehuo.ca----
207lehlandestates.netGoDaddy.com, LLC21 Oct 201421 Oct 201421 Oct 2015
208lehavre.fr-29 Aug 20014 Jun 20241 Oct 2025
209lehihi.comHangzhou AiMing Network Co., LTD8 Mar 201214 Aug 20238 Mar 2026
210lehuiso.comHiChina Zhicheng Technology Limited23 Apr 201324 Mar 202523 Apr 2027
211lehuoguo.comBeijing Lanhai Jiye Technology Co., Ltd24 Mar 202127 Jul 202524 Mar 2026
212lehuichao.comHiChina Zhicheng Technology Limited24 Mar 201824 Mar 201824 Mar 2019
213lehuajiaju.comBeijing Lanhai Jiye Technology Co., Ltd3 Jul 201526 Jul 20253 Jul 2026
214lehriis.comregister.com, Inc.17 Sep 201423 Oct 201417 Sep 2015
215lehoizaloapp.comFirstserver, Inc.24 Oct 201424 Oct 201424 Oct 2015
216lehoaianh.comTurnCommerce, Inc. DBA NameBright.com8 Jan 201917 Feb 20258 Jan 2025
217lehitparade.comOVH sas31 May 202131 May 202131 May 2022
218lehighvalleyrc.comregister.com, Inc.23 Oct 201423 Oct 201423 Oct 2015
219lehighvalleyproductions.comGoDaddy.com, LLC23 Oct 201424 Oct 202423 Oct 2025
220lehighphotobooth.comGoDaddy.com, LLC23 Oct 201424 Oct 202423 Oct 2025
221lehenrylluch.comGoDaddy.com, LLC23 Oct 201423 Oct 201423 Oct 2016
222lehahayx.comNetwork Solutions, LLC20 Nov 201920 Nov 201920 Nov 2020
223lehrlingsportal.at--7 Oct 2024-
224lehtimaailma.netCSL Computer Service Langenbach GmbH d/b/a joker.c…3 Oct 20175 Sep 20243 Oct 2025
225lehser.kzHostserver GmbH2 Jul 2014--
226lehighvalleyhomevalue.infoGoDaddy.com, LLC23 Oct 201423 Oct 201423 Oct 2015
227lehner-shop.comMesh Digital Limited2 Feb 20121 Feb 20252 Feb 2026
228leh4c.comGoDaddy.com, LLC23 Jul 202311 Mar 202523 Jul 2028
229lehrcare.de--8 Sep 2018-
230lehighoutfitters.comNom-iq Ltd. dba COM LAUDE8 Jun 200527 Jun 20258 Jun 2026
231lehuaduo.comXin Net Technology Corporation24 Oct 201424 Oct 201424 Oct 2015
232lehnnandme.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Oct 201422 Dec 201625 Oct 2017
233lehmanteamaz.comGoDaddy.com, LLC24 Oct 201424 Oct 201424 Oct 2019
234lehmannkreativ.comeNom, Inc.24 Oct 201417 Oct 202424 Oct 2025
235lehfvrc.comregister.com, Inc.26 Aug 201424 Oct 201426 Aug 2015
236leharmonies.comNetEarth One Inc. d/b/a NetEarth24 Oct 201425 Oct 201424 Oct 2015
237lehaiw.comNamesilo, LLC19 Mar 202119 May 202419 Mar 2024
238lehabitue.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
239lehavretourisme.comOVH sas23 Feb 200022 Feb 202423 Feb 2025
240lehaichau.vn----
241lehrklaenge.de--16 Aug 2018-
242lehub-impactradius.comGoDaddy.com, LLC10 Apr 201910 Apr 201910 Apr 2020
243lehighvalleylaseraesthetics.comGoDaddy.com, LLC24 May 201025 May 201524 May 2016
244lehu365.netEranet International Limited26 Feb 20226 Mar 202426 Feb 2024
245lehoczferi.infoGoDaddy.com, LLC24 May 201424 May 201524 May 2016
246lehologram.comGoDaddy.com, LLC26 May 201426 May 201526 May 2016
247lehrwerk.info1&1 Internet AG24 Oct 20146 Dec 202424 Oct 2024
248lehighvalleylaseresthetics.comGoDaddy.com, LLC25 May 201026 May 201525 May 2016
249lehmanspecialist.comGoDaddy.com, LLC26 May 201327 May 201526 May 2016
250lehuo789.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED27 May 20214 Jul 202327 May 2023
251lehmuslehto.comGoDaddy.com, LLC25 Oct 201422 Oct 202425 Oct 2025
252lehighvalleywebs.comDropCatch.com 887 LLC27 May 201827 May 201827 May 2019
253lehmanssupperclub.comHostinger, UAB16 Sep 202228 Oct 202416 Sep 2025
254lehanpartners.orgGoDaddy.com, LLC30 May 200911 Jun 201530 May 2016
255leharboutique.comGoDaddy.com, LLC26 Feb 201826 Feb 201826 Feb 2021
256lehair.netMat Bao Trading & Service Company Limited d/b/a Ma…28 Aug 201917 Sep 202428 Aug 2025
257lehanpartners.com-13 Dec 202113 Dec 202113 Dec 2022
258lehanpartners.netGoDaddy.com, LLC30 May 200931 May 201530 May 2016
259lehan.bizNameCheap, Inc.3 Aug 20219 Jul 20243 Aug 2025
260lehd.netGoDaddy.com, LLC25 Oct 20144 Nov 202125 Oct 2022
261lehan.us-22 Aug 201622 Aug 201621 Aug 2017
262lehan.orgNameCheap, Inc.27 Aug 20152 Aug 202527 Aug 2026
263lehighvalleydistillers.usGoDaddy.com, LLC3 Jun 20143 Jun 20142 Jun 2015
264lehighdistillers.usGoDaddy.com, LLC3 Jun 20143 Jun 20142 Jun 2015
265lehighdistillery.usGoDaddy.com, LLC3 Jun 20143 Jun 20142 Jun 2015
266lehighwebdesign.comGoDaddy.com, LLC26 Feb 202526 Feb 202526 Feb 2026
267lehighvalleyaffordable.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
268lehighvalleymechanic.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
269lehighvalleybethlehem.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
270lehighvalleybestwebsites.netGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
271lehighvalleybestlocal.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
272lehighvalleywebsite.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
273lehighdistillers.comGoDaddy.com, LLC3 Jun 20144 Jun 20153 Jun 2016
274lehighvalleycommunity.comGoogle, Inc.24 Mar 20205 Jun 202524 Mar 2025
275lehighvalleybestwebdesign.netGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
276lehighvalleyhair.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
277lehighvalleypaattorneys.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
278lehzpd.comGoDaddy.com, LLC27 Oct 201427 Oct 201427 Oct 2015
279lehuotz.comHiChina Zhicheng Technology Limited26 Oct 20148 Jan 201826 Oct 2018
280lehuiwu.com-19 Jun 202221 Aug 202319 Jun 2023
281lehui56.comChengdu West Dimension Digital Technology Co., Ltd…27 Oct 201427 Oct 201427 Oct 2015
282lehighvalleyinabox.comGoDaddy.com, LLC7 Jul 20167 Jul 20167 Jul 2017
283lehighvalleyboxes.comeNom, Inc.26 Oct 201426 Oct 201426 Oct 2015
284lehtolaagency.comGoDaddy.com, LLC3 Jun 20144 Jun 20153 Jun 2016
285lehighvalleyentertainment.com-21 Oct 201621 Oct 201621 Oct 2017
286lehighvalleyautorepairs.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
287lehighacresflhomes.comGoDaddy.com, LLC4 Jun 20144 Jun 20154 Jun 2016
288lehighvalleysalons.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
289lehighvalleyveterinarians.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
290lehighvalleydiscover.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
291lehighvalleyguns.comGoDaddy.com, LLC19 Aug 201620 Aug 202419 Aug 2025
292lehighvalleyenter.netGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
293lehighvalleymalls.comGoDaddy.com, LLC5 Sep 202217 Nov 20235 Sep 2023
294lehighvalleylegal.netGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
295lehighvalleywebdeveloper.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
296lehighacres-homes.comGoDaddy.com, LLC28 May 202528 May 202528 May 2027
297lehighvalleyfuneral.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
298lehighvalleynewslive.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
299lehighvalleydining.com1&1 Internet AG8 Mar 202311 Oct 20248 Mar 2026
300lehighvalleyrepair.comNetwork Solutions, LLC14 Jan 202011 Feb 202014 Jan 2030
301lehighvalleydeals.netNamesilo, LLC7 Jan 20198 Jan 20197 Jan 2020
302lehighvalleysbest.comGoDaddy.com, LLC18 Oct 201519 Oct 202418 Oct 2025
303lehighvalleypizza.netGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
304lehighvalleybestmobile.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
305lehighvalleypalawyers.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
306lehighvalleyautomobile.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
307lehighvalleylawyer.netGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
308lehighvalleybeauty.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
309lehighvalleybest.netGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
310lehighvalleycoupons.netGoDaddy.com, LLC11 Dec 201511 Dec 201511 Dec 2016
311lehighvalleyphysician.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
312lehighvalleyhunting.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
313lehighvalleystore.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
314lehighvalleyallentown.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
315lehighvalleybestwebsitedesign.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
316lehighvalleyplumbing.netGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
317lehighvalleywebsiterescue.comWild West Domains, LLC3 Jun 20134 Jun 20153 Jun 2016
318lehighvalleyspas.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
319lehighvalleyeaston.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
320lehisummerswim.comGoDaddy.com, LLC4 Jun 20124 Jun 20154 Jun 2016
321lehighvalleyenter.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
322lehighvalleybestapps.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
323lehighvalleymorningcall.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
324lehighvalleycheap.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
325lehighvalleybanks.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
326lehighvalleybethlehemlive.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
327lehighvalleymedical.com1&1 Internet AG19 Mar 201819 Mar 201819 Mar 2019
328lehighvalleylive.netGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
329lehighvalleydistillers.comGoDaddy.com, LLC3 Jun 20144 Jun 20153 Jun 2016
330lehighvalleysteelhawks.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Apr 201720 Apr 201720 Apr 2018
331lehighvalleytop.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
332lehighvalleyallentownlive.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
333lehighvalleybusinesssearch.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
334lehighdistillery.comGoogle, Inc.2 May 20212 May 20212 May 2022
335lehighvalleybestwebsite.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
336lehighvalleypharmacies.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
337lehighvalleyyellowpages.comeNom, Inc.14 Jan 201715 Jan 201814 Jan 2018
338lehighvalleybestwebdesign.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
339lehighvalleytransportation.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
340lehighvalleybestweb.comGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
341lehighvalleystore.orgGoDaddy.com, LLC4 Jun 201316 Jun 20154 Jun 2016
342lehighvalleypalive.org----
343lehighvalleybestwebsite.orgGoDaddy.com, LLC4 Jun 201316 Jun 20154 Jun 2016
344lehighvalleythemorningcall.orgGoDaddy.com, LLC4 Jun 201316 Jun 20154 Jun 2016
345lehighvalleywebsites.org----
346lehighvalleypadeveloper.orgGoDaddy.com, LLC4 Jun 201316 Jun 20154 Jun 2016
347lehighvalleylawyers.org----
348lehighvalleywebdevelopers.meGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
349lehighvalleypawebdeveloper.org----
350lehighvalleydevelopers.meGoDaddy.com, LLC4 Jun 20134 Jun 20154 Jun 2016
351lehighvalleybestwebsitedesign.orgGoDaddy.com, LLC4 Jun 201316 Jun 20154 Jun 2016
352lehighvalleybestwebsites.org----
353lehighvalleybestwebdesign.orgGoDaddy.com, LLC4 Jun 201316 Jun 20154 Jun 2016
354lehighvalleymarketing.orgGoDaddy.com, LLC4 Jun 201316 Jun 20154 Jun 2016
355lehighvalleymobile.orgGoDaddy.com, LLC4 Jun 201316 Jun 20154 Jun 2016
356lehighvalleymorningcall.orgGoDaddy.com, LLC4 Jun 201316 Jun 20154 Jun 2016
357lehacemoswebs.comGoDaddy.com, LLC21 May 201422 May 201521 May 2016
358lehighed.comWild West Domains, LLC23 May 201324 May 201523 May 2016
359lehwefundit.comGoDaddy.com, LLC23 May 201324 May 201523 May 2016
360lehahabj.comGMO Internet Inc.11 Apr 202322 May 202411 Apr 2024
361lehengafactory.comGoDaddy.com, LLC3 Sep 20243 Sep 20243 Sep 2025
362lehighacrespropertymanagement.comFastDomain Inc.18 Apr 20183 Apr 202518 Apr 2026
363lehbikerental.comWix.com Ltd.14 Apr 202124 Jun 202514 Apr 2025
364lehengafactory.usGoDaddy.com, LLC22 May 201422 May 201421 May 2015
365lehighcountypools.comGoDaddy.com, LLC4 Jun 20135 Jun 20154 Jun 2016
366lehenga.usUniregistrar Corp26 Nov 20166 Jan 201725 Nov 2017
367lehighvalleyfreefamilyfun.comGoDaddy.com, LLC4 Jun 20145 Jun 20154 Jun 2016
368lehighpropertybuyers.comNetwork Solutions, LLC31 Dec 201931 Dec 201931 Dec 2020
369lehighcountycarpetcleaning.comGoDaddy.com, LLC22 Mar 20125 Oct 201417 Oct 2016
370lehunted.comeNom, Inc.27 Oct 201427 Oct 201427 Oct 2016
371lehtone.comCSL Computer Service Langenbach GmbH d/b/a joker.c…27 Oct 20144 Oct 202427 Oct 2025
372lehighvalleyadultservices.comregister.com, Inc.28 Oct 201430 Oct 202328 Oct 2028
373lehighlegends.comGoDaddy.com, LLC27 Oct 201428 Oct 201627 Oct 2017
374lehighlegend.comGoDaddy.com, LLC27 Oct 201428 Oct 201627 Oct 2017
375lehighasa.comGoDaddy.com, LLC28 Oct 201428 Oct 201428 Oct 2015
376lehigh-acres-fl.comTucows Domains Inc.27 Oct 201431 Oct 201527 Oct 2016
377lehaoxifu.comJiangsu Bangning Science and technology Co. Ltd.28 Oct 201429 Oct 202228 Oct 2025
378lehaojituan.comJiangsu Bangning Science and technology Co. Ltd.28 Oct 201429 Oct 202228 Oct 2025
379lehaofushi.comJiangsu Bangning Science and technology Co. Ltd.28 Oct 201429 Oct 202228 Oct 2025
380lehighvalleyadvocates.comGoDaddy.com, LLC12 Feb 201330 Apr 201512 Feb 2017
381lehla.comEpik Inc.17 Dec 200531 Dec 202217 Dec 2025
382lehmanmail.comGoogle, Inc.2 Nov 202218 Oct 20242 Nov 2025
383lehrberuf.comeNom, Inc.10 Nov 20118 Nov 202410 Nov 2025
384lehta.com1API GmbH12 Sep 202012 Sep 202012 Sep 2021
385lehngacholis.comeNom, Inc.27 Dec 200921 Dec 201627 Dec 2017
386lehnt.comeNom, Inc.6 Jun 201113 Jun 20256 Jun 2026
387lehighvalleytaxes.comGoDaddy.com, LLC27 Nov 20082 Jan 20252 Jan 2026
388lehighvalleytax.comGoDaddy.com, LLC27 Nov 20082 Jan 20252 Jan 2026
389lehraif.comDropCatch.com 1413 LLC23 May 201923 May 201923 May 2020
390lehoobang.comHiChina Zhicheng Technology Limited29 Oct 20142 Dec 201629 Oct 2019
391lehoizalo.comDropCatch.com 1018 LLC14 Apr 201914 Apr 201914 Apr 2020
392lehmanstudio.comTitanic Hosting, Inc.28 Oct 201429 Oct 202428 Oct 2025
393lehighcleanpro.comGoDaddy.com, LLC20 Mar 20231 May 202420 Mar 2024
394lehieaststakeprepare.comTucows Domains Inc.28 Oct 20141 Nov 201728 Oct 2017
395lehengaa.comBigRock Solutions Ltd.28 Oct 201421 Jul 202528 Oct 2026
396lehuos.comHangzhou Dianshang Internet Technology Co., Ltd3 Dec 20203 Dec 20203 Dec 2021
397lehnerd.comGoDaddy.com, LLC23 Nov 201419 Feb 202523 Nov 2025
398lehmanbros.comGoDaddy.com, LLC8 Jun 20041 Jul 20248 Jun 2026
399lehenga.orgDynadot, LLC15 May 202126 Apr 202415 May 2026
400lehighvalleyhockey.comGoDaddy.com, LLC19 Feb 202019 Feb 202019 Feb 2021
401lehameau.comGoDaddy.com, LLC19 Apr 20163 Jun 202519 Apr 2026
402lehmancapital.comGoDaddy.com, LLC4 Nov 202014 Jan 20254 Nov 2026
403lehetetlen.comeNom, Inc.4 Jan 201210 Jan 20254 Jan 2026
404lehighcsb.orgGoDaddy.com, LLC27 Oct 201427 Oct 201427 Oct 2015
405lehaoxifu.netJiangsu Bangning Science and technology Co. Ltd.28 Oct 201429 Oct 202228 Oct 2025
406lehaojituan.netJiangsu Bangning Science and technology Co. Ltd.28 Oct 201429 Oct 202228 Oct 2025
407lehaofushi.netJiangsu Bangning Science and technology Co. Ltd.28 Oct 201429 Oct 202228 Oct 2025
408lehr.info-7 Jul 20247 Jul 20257 Jul 2026
409lehighvalleyslots.comGoDaddy.com, LLC10 Feb 200511 Feb 202510 Feb 2026
410lehighvalleyimports.comGoDaddy.com, LLC11 Jun 200912 Jun 202511 Jun 2027
411lehighpennsylvania.comGoDaddy.com, LLC31 Jul 20074 Jun 201431 Jul 2015
412lehno.comUniregistrar Corp3 Feb 20189 Dec 20243 Feb 2026
413lehuotuan.com-14 Jan 202514 Jan 202514 Jan 2026
414lehrte.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Aug 200129 May 20256 Aug 2026
415lehuazu.comHiChina Zhicheng Technology Limited29 Oct 201429 Oct 201429 Oct 2015
416lehuahui.comBeijing Lanhai Jiye Technology Co., Ltd14 Jan 201626 Jun 202514 Jan 2026
417lehongxianlan.comHiChina Zhicheng Technology Limited29 Oct 201429 Oct 201429 Oct 2015
418lehoimuasam.comeNom, Inc.29 Oct 201429 Oct 201429 Oct 2015
419lehitrail.com1&1 Internet AG30 Oct 201430 Oct 201430 Oct 2015
420lehighacreschiro.comGoDaddy.com, LLC29 Oct 201411 Oct 201629 Oct 2017
421lehce69.comWild West Domains, LLC6 Aug 201429 Jan 20156 Aug 2015
422lehne.infoRegistryGate GmbH26 Aug 201910 Oct 202426 Aug 2025
423lehippo.comBeijing Lanhai Jiye Technology Co., Ltd31 May 202528 Jul 202531 May 2026
424lehighgrads.comGoDaddy.com, LLC13 Sep 200725 Nov 202413 Sep 2024
425lehighvalleybridals.comGoDaddy.com, LLC22 Aug 20071 Mar 201722 Aug 2017
426lehighvalleylimo.com-3 Nov 202217 Jan 20243 Nov 2023
427lehighvalleytravel.comGoDaddy.com, LLC18 Feb 20184 Mar 202318 Feb 2026
428lehog.comPSI-USA, Inc. dba Domain Robot23 Dec 200811 Feb 202523 Dec 2025
429lehig.comPSI-USA, Inc. dba Domain Robot12 May 20081 Jul 202512 May 2026
430lehon.comPSI-USA, Inc. dba Domain Robot8 May 200227 Jun 20258 May 2026
431lehighvalleyramblings.comGoDaddy.com, LLC7 Dec 20187 Dec 20187 Dec 2019
432lehighacresfl.comGoDaddy.com, LLC25 Aug 199923 Jul 20251 Jan 2028
433lehoo.comPSI-USA, Inc. dba Domain Robot25 Jul 200216 Jul 202525 Jul 2026
434lehuoguan.neteName Technology Co., Ltd.28 Oct 201428 Oct 201428 Oct 2015
435lehad.comPSI-USA, Inc. dba Domain Robot25 Jun 200927 Jun 202525 Jun 2026
436lehus.comPSI-USA, Inc. dba Domain Robot10 May 201029 Jun 202510 May 2026
437lehlo.comPSI-USA, Inc. dba Domain Robot27 Apr 201016 Jun 202527 Apr 2026
438lehitv.comHiChina Zhicheng Technology Limited3 Jun 20173 Jun 20173 Jun 2018
439lehighvalleyindependent.comGoDaddy.com, LLC26 Dec 20208 Mar 202426 Dec 2023
440lehokomapress.comRegister.it SPA30 Oct 201430 Oct 201430 Oct 2015
441lehoibia.comMat Bao Trading & Service Company Limited d/b/a Ma…5 Oct 20245 Oct 20245 Oct 2025
442lehoibeer.comeNom, Inc.30 Oct 201430 Oct 201430 Oct 2015
443lehler.comHiChina Zhicheng Technology Limited31 Oct 201431 Dec 202031 Oct 2028
444lehisliving.comCrazy Domains FZ-LLC30 Oct 20142 Sep 202430 Oct 2025
445lehighvalleymakerspace.comGoogle, Inc.30 Oct 201431 Oct 201430 Oct 2015
446lehejia.netXiamen Nawang Technology Co., Ltd29 Oct 201422 Aug 201729 Oct 2018
447lehighvalleyattorney.comGoDaddy.com, LLC23 Dec 201824 Dec 202423 Dec 2026
448lehaha.name----
449lehighvalleypaparazzi.comGoDaddy.com, LLC12 Sep 200818 Apr 201512 Sep 2015
450lehrealty.comTucows Domains Inc.8 Dec 20167 Dec 20248 Dec 2025
451lehhotels.comGoDaddy.com, LLC20 Jul 201230 Jun 202520 Jul 2026
452lehuey.comGoDaddy.com, LLC7 Mar 201521 May 20157 Mar 2016
453lehs1964.orgTucows Domains Inc.12 Jun 20122 Jun 202512 Jun 2026
454lehighvalleyyoungrepublicans.comFastDomain Inc.31 Oct 201424 Oct 201631 Oct 2017
455lehgihhanson.comWild West Domains, LLC15 Jan 202311 May 202415 Jan 2025
456leherb.comGoDaddy.com, LLC17 Jan 201614 Aug 202417 Jan 2027
457leham.comGoDaddy.com, LLC4 Feb 200514 Mar 20254 Aug 2026
458lehighvalleywithlove.comGoDaddy.com, LLC17 Jul 200917 Jul 202517 Jul 2026
459lehongphong.comGoDaddy.com, LLC4 Apr 200215 Mar 20254 Apr 2026
460lehuaorchids.comeNom, Inc.26 Mar 19994 Mar 20252 Apr 2026
461lehighgear.comGoDaddy.com, LLC22 Oct 200723 Oct 202422 Oct 2026
462lehighchurches.orgLaunchpad, Inc.23 Sep 200830 Jan 202423 Sep 2025
463lehightechnical.comeNom, Inc.4 Sep 20036 Aug 20244 Sep 2025
464lehighhotel.comGoDaddy.com, LLC28 Jan 200629 Jan 202528 Jan 2026
465lehiinsurance.comGoDaddy.com, LLC22 Jul 200823 Jul 202522 Jul 2026
466lehighvalleyelitenetwork.comGoDaddy.com, LLC11 Nov 201312 Nov 202311 Nov 2025
467lehighlandscaping.comNetwork Solutions, LLC1 Jun 20002 Apr 20251 Jun 2026
468lehamac.orgPDR Ltd. d/b/a PublicDomainRegistry.com1 Sep 200523 Aug 20171 Sep 2018
469lehighvalleyrealestateinstitute.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED23 Mar 202330 Apr 202423 Mar 2024
470lehel-krisztina.hu-20 Feb 2013--
471lehi.bizBigRock Solutions Ltd.9 Oct 20159 Oct 20158 Oct 2016
472lehua.infoGoogle, Inc.3 Sep 20243 Jun 20253 Sep 2025
473lehighvalleybusiness.org-11 Apr 202516 Apr 202511 Apr 2026
474lehrke-alpers.de----
475lehighvalleysportsmanshow.comNameCheap, Inc.14 Jul 202015 Jul 202514 Jul 2026
476lehighdems.orgGoDaddy.com, LLC30 Apr 200315 Apr 202530 Apr 2026
477lehighvalleycityguide.com1&1 Internet AG29 Jun 201030 Jun 202529 Jun 2026
478lehicity.orgGoDaddy.com, LLC7 Aug 202221 Sep 20247 Aug 2025
479lehmanbookstore.comGoDaddy.com, LLC7 Jun 199912 Jun 20257 Jun 2026
480lehighhumane.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Feb 200712 Mar 20157 Feb 2016
481lehunnet.comBeijing Lanhai Jiye Technology Co., Ltd19 Jan 202424 Jun 202519 Jan 2026
482lehnsrichbloggs.comGoDaddy.com, LLC1 Nov 20142 Nov 20161 Nov 2017
483lehnhardts.comeNom, Inc.2 Nov 20142 Nov 20142 Nov 2015
484lehmanhomeinteriors.comGoDaddy.com, LLC1 Nov 201428 Feb 20171 Nov 2019
485lehmanfamilyinteriors.comGoDaddy.com, LLC1 Nov 20141 Nov 20141 Nov 2015
486lehao88.comBeijing Lanhai Jiye Technology Co., Ltd30 Jul 202231 Jul 202530 Jul 2026
487lehotclub.comGoDaddy.com, LLC10 Apr 200610 Apr 202510 Apr 2026
488lehighgroup.comGoDaddy.com, LLC24 Feb 199626 Feb 202425 Feb 2026
489lehighvalleyjustlisted.comNameCheap, Inc.2 Aug 200921 Jul 20222 Aug 2028
490lehighvalleykids.comeNom, Inc.6 Dec 20017 Nov 20246 Dec 2025
491lehighvalleydrymasters.comTucows Domains Inc.18 Jan 201122 Jan 201918 Jan 2019
492lehmanhyundai.comWild West Domains, LLC27 Sep 200118 Jun 202527 Sep 2025
493lehmanvolvo.comNetwork Solutions, LLC27 Aug 199928 Jun 202427 Aug 2026
494lehuahets.comeNom, Inc.15 May 201426 Jun 201515 May 2015
495lehighvallymls.com-4 Sep 20164 Sep 20164 Sep 2017
496leht.comeNom, Inc.3 Jul 199727 Jun 20252 Jul 2026
497lehavretv.com----
498lehighacres.netGoDaddy.com, LLC18 Dec 201719 Dec 202418 Dec 2025
499lehighrealestate.comGoDaddy.com, LLC6 Feb 200024 Jul 20256 Feb 2026
500lehigh.tvFabulous.com Pty Ltd.20 Jun 201621 Jun 201720 Jun 2017
501lehightv.comNameCheap, Inc.23 Apr 202024 Apr 202523 Apr 2026
502lehj.comNameCheap, Inc.11 Feb 200712 Jan 202511 Feb 2026
503lehx.comGoDaddy.com, LLC25 Apr 200626 Apr 202525 Apr 2026
504lehostingsolutions.comGoDaddy.com, LLC7 Feb 201414 Apr 20157 Feb 2016
505lehmannundpartner.comWild West Domains, LLC13 Jun 202113 Jun 202113 Jun 2022
506lehighinternationalairport.comEuroDNS S.A.6 Dec 20058 Jul 20156 Jun 2017
507lehumall.mobiBeijing Innovative Linkage Technology Ltd. dba dns…31 Oct 201431 Oct 201431 Oct 2016
508lehmd.com-5 Jul 20165 Jul 20165 Jul 2017
509lehtveebi.eu----
510lehighacappella.comFastDomain Inc.9 Jun 201011 Jul 20159 Jun 2016
511lehnsrichbloggs.infoGoDaddy.com, LLC1 Nov 20142 Nov 20161 Nov 2017
512lehavre.infoPorkbun, LLC23 Sep 20235 Oct 202423 Sep 2025
513lehat.comDynadot, LLC15 Apr 200426 May 202515 Apr 2026
514leho6.comWest263 International Limited19 Feb 202219 Feb 202219 Feb 2023
515lehoitrian.comDomainContext, Inc.11 Oct 201711 Oct 201711 Oct 2018
516lehmanndesigns.comTucows Domains Inc.18 Jun 20245 Jun 202518 Jun 2026
517lehigh-acresmoneymethod.comeNom, Inc.11 Jun 201411 Jun 201511 Jun 2016
518lehuipv.comBeijing Lanhai Jiye Technology Co., Ltd9 Jun 202110 Jun 20239 Jun 2024
519lehtiruhtinas.comeNom, Inc.12 Jun 201413 Jun 201512 Jun 2016
520lehaidao.comGoDaddy.com, LLC7 Jun 20148 Jun 20157 Jun 2016
521lehighvalleychamber.orgGoDaddy.com, LLC28 Sep 200012 Nov 202428 Sep 2025
522lehrerllc.comNameCheap, Inc.10 Nov 200615 Mar 202410 Nov 2025
523lehdsc.comChengdu West Dimension Digital Technology Co., Ltd…3 Nov 20143 Nov 20143 Nov 2015
524lehighvalleyapartment.comGoDaddy.com, LLC8 Jun 201413 Jun 20258 Jun 2026
525lehighhanson.comCSC Corporate Domains, Inc.15 Jan 200812 Jan 202516 Jan 2026
526lehighacrescitizen.comGoDaddy.com, LLC22 Feb 20063 Jan 202522 Feb 2026
527lehighcenter.comCloudFlare, Inc.4 Jun 200723 Jan 202531 Mar 2026
528lehc.infoGoDaddy.com, LLC7 Jun 20148 Jun 20157 Jun 2016
529lehighvalleymagazine.comGoDaddy.com, LLC4 May 20005 May 20254 May 2026
530lehmanreen.comGoDaddy.com, LLC2 Nov 200517 Sep 20242 Nov 2029
531lehighsportsforum.com1&1 Internet AG16 Feb 200914 Mar 201816 Feb 2026
532lehighacresfl.usGoDaddy.com, LLC1 Nov 20141 Nov 201431 Oct 2015
533lehighvalleymusicawards.org-7 Jul 20257 Jul 20257 Jul 2026
534lehighvalleyhonda.comregister.com, Inc.1 May 200121 Feb 20251 May 2030
535lehaleha.comTurnCommerce, Inc. DBA NameBright.com17 Mar 202128 May 202517 Mar 2025
536lehighsafetyshoes.comNom-iq Ltd. dba COM LAUDE28 May 199727 Jun 202527 May 2026
537lehara.comMoniker Online Services LLC10 Jun 200830 Jan 202510 Jun 2026
538lehoangthanhbinh.infoUK-2 Limited2 Nov 20142 Nov 20142 Nov 2015
539lehs1963.comBrandon Gray Internet Services, Inc. (dba NameJuic…23 May 201418 Nov 202415 Sep 2024
540lehmannstrings.comCloudFlare, Inc.12 Jan 20005 Nov 202312 Jan 2029
541lehistree.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Apr 201524 Apr 201524 Apr 2016
542lehmanumc.orgGoDaddy.com, LLC4 May 200718 Jun 20254 May 2027
543lehighanthracite.comGoDaddy.com, LLC20 Jul 20107 Sep 202220 Jul 2027
544lehightonfordlm.comNetwork Solutions, LLC10 Jul 202412 Jul 202510 Jul 2026
545lehighvalleyhomesonline.comBeijing Lanhai Jiye Technology Co., Ltd7 Jun 200515 Apr 20257 Jun 2026
546lehmannspowerequipment.comeNom, Inc.21 Mar 201420 Feb 202521 Mar 2026
547lehle.com1&1 Internet AG9 Aug 199614 Mar 20188 Aug 2025
548lehrergibilisco.comGoDaddy.com, LLC22 Dec 201113 Aug 202522 Dec 2025
549lehighvalleyhomelisting.comWild West Domains, LLC13 Nov 20134 May 201513 Nov 2015
550lehrklaenge.com1&1 Internet AG25 Jan 201714 Mar 201825 Jan 2026
551lehighvalleyregion.comregister.com, Inc.3 Nov 20143 Nov 20143 Nov 2018
552lehcollection.comBigRock Solutions Ltd.3 Nov 20143 Nov 20143 Nov 2015
553leharbour.comNamesilo, LLC3 Nov 20143 Nov 20143 Nov 2015
554lehaipi.comBeijing Lanhai Jiye Technology Co., Ltd30 Jun 20251 Jul 202530 Jun 2026
555lehmantheatredance.orgNakazawa Trading Co., Ltd.30 Nov 201623 Nov 201730 Nov 2018
556lehmansecuritieslitigation.comBeijing Lanhai Jiye Technology Co., Ltd4 Feb 202511 Jul 20254 Feb 2026
557lehirollermills.comGoDaddy.com, LLC21 Dec 200322 Dec 202421 Dec 2025
558lehnardt.comGoDaddy.com, LLC27 Jun 200928 Jun 202527 Jun 2026
559leherlimousine.com-8 Oct 20138 Oct 20138 Oct 2017
560lehighvalleyrabbit.comeNom, Inc.23 Jan 201123 Jan 201123 Jan 2016
561lehighacresgazette.infoCommuniGal Communication Ltd.3 Sep 20244 Dec 20243 Sep 2025
562lehighacresseniorcitizenscenter.comFastDomain Inc.20 Jul 201124 Jul 202520 Jul 2026
563lehighvaleylive.comGoDaddy.com, LLC4 Jan 20194 Jan 20194 Jan 2020
564lehighvalleyhyundai.net1&1 Internet AG6 Nov 20095 Dec 20176 Nov 2025
565lehighvalleyfoodandwine.comGoDaddy.com, LLC23 Jan 201324 Jan 202523 Jan 2026
566lehtospasties.comTucows Domains Inc.25 Dec 200426 Nov 202425 Dec 2025
567lehighvalleybeerweek.comenom459, Incorporated22 Nov 202424 Nov 202422 Nov 2025
568lehighvalleyzombies.comGoDaddy.com, LLC18 Jun 201419 Jun 202518 Jun 2028
569lehighagency.comGoDaddy.com, LLC16 Feb 200217 Feb 202416 Feb 2026
570lehmancenter.orgFastDomain Inc.24 Oct 200216 Apr 202524 Oct 2027
571lehighvalleyfamilyfun.com1&1 Internet AG12 Sep 201912 Sep 201912 Sep 2020
572lehmers.comMarkMonitor Inc.17 Aug 199820 Mar 202516 Aug 2025
573lehighvalleyaletrail.comGoDaddy.com, LLC12 Dec 201313 Dec 202312 Dec 2025
574lehighvalleypaonline.comHostinger, UAB18 Aug 202418 Aug 202418 Aug 2025
575lehuodingshi.comBeijing Lanhai Jiye Technology Co., Ltd25 Jun 20245 Jun 202525 Jun 2026
576lehuigan.comHiChina Zhicheng Technology Limited4 Nov 20144 Nov 20144 Nov 2015
577lehuangwan.comHiChina Zhicheng Technology Limited4 Nov 20144 Nov 20144 Nov 2016
578lehloo.comGoDaddy.com, LLC20 Jun 202220 Jun 202520 Jun 2026
579lehe18.comName.com, Inc.24 Mar 201824 Mar 201824 Mar 2019
580lehayes.comMetaregistrar BV Applications22 Jan 202523 Mar 202522 Jan 2026
581lehanchina.comBizcn.com, Inc.5 Apr 20176 Apr 20175 Apr 2018
582lehvoss.netDropCatch.com 951 LLC23 Sep 202111 Apr 202523 Sep 2025
583lehmanhardware.comGoDaddy.com, LLC10 May 199916 Jul 202515 Jul 2026
584lehrconstruction.comGoogle, Inc.25 Aug 200510 Aug 202525 Aug 2026
585lehuowuhan.comeName Technology Co., Ltd.29 Oct 201729 Oct 201729 Oct 2018
586lehipets.comGoDaddy.com, LLC13 Jun 200813 Jun 201513 Jun 2016
587lehendakarigroup.comGoDaddy.com, LLC31 Jul 202431 Jul 202431 Jul 2025
588lehgems.comGandi SAS17 Aug 201417 Aug 201417 Aug 2015
589lehighcssa.com! #1 Host Japan, Inc.10 Nov 202111 Nov 202110 Nov 2022
590lehinger.usGoDaddy.com, LLC17 Aug 201417 Aug 201416 Aug 2015
591lehmansscriptorium.comDreamHost, LLC17 Aug 201419 Aug 201717 Aug 2018
592lehondies.comHiChina Zhicheng Technology Limited4 Jan 20164 Jan 20164 Jan 2017
593lehui69.com35 Technology Co., Ltd.18 Aug 201418 Aug 201418 Aug 2015
594lehuodu.comHangzhou AiMing Network Co., LTD17 Aug 201417 Aug 201417 Aug 2015
595lehirentals.comeNom, Inc.27 Jan 20233 Jan 202527 Jan 2026
596lehicars.comGoDaddy.com, LLC12 Mar 201612 Mar 201612 Mar 2017
597lehaimgriffin.comGoDaddy.com, LLC13 Jun 201413 Jun 201513 Jun 2016
598lehievents.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Jul 20166 Jul 20176 Jul 2018
599lehiclassifieds.comGoDaddy.com, LLC13 Jun 200813 Jun 201513 Jun 2016
600lehnerchiropractic.com-4 Aug 20164 Aug 20164 Aug 2017
601lehighvalleyreosales.comGoDaddy.com, LLC14 Jun 201215 Jun 201514 Jun 2016
602lehotdog.comGoDaddy.com, LLC14 Jun 200725 May 202514 Jun 2026
603lehighvalleyheros.comWild West Domains, LLC14 Jun 201315 Jun 201514 Jun 2016
604lehighcssa.orgFastDomain Inc.2 Jun 20163 May 20172 Jun 2018
605lehmanbrotherst.comGoDaddy.com, LLC16 Jun 201417 Jun 201516 Jun 2016
606lehaogou.comHiChina Zhicheng Technology Limited19 Aug 201426 Sep 202419 Aug 2024
607lehappylife.comTurnCommerce, Inc. DBA NameBright.com18 Aug 201429 Sep 202418 Aug 2024
608lehcreative.comGoogle, Inc.2 Sep 20222 Oct 20242 Sep 2024
609leheyinji.comeName Technology Co., Ltd.19 Aug 20145 Aug 202419 Aug 2025
610leheyj.comeName Technology Co., Ltd.19 Aug 20145 Aug 202419 Aug 2025
611lehia.comGoDaddy.com, LLC15 Jul 200716 Jul 202515 Jul 2026
612lehigh-acres-technical-solutions.comGoDaddy.com, LLC18 Aug 201418 Aug 201418 Aug 2015
613lehighaccident.comGoDaddy.com, LLC18 Aug 201419 Aug 202418 Aug 2029
614lehighacres239locksmith.comGoDaddy.com, LLC18 Aug 201418 Aug 201418 Aug 2015
615lehighvalleypublicadjuster.comNameCheap, Inc.21 Feb 2020-21 Feb 2021
616lehobbit-labatailledescinqarmees.comMarkMonitor Inc.18 Aug 20142 Aug 202418 Aug 2026
617lehobbit3-lefilm.comMarkMonitor Inc.18 Aug 20142 Aug 202418 Aug 2026
618lehobbit3.comMarkMonitor Inc.18 Aug 201417 Jul 202418 Aug 2026
619lehobbitlabatailledescinqarmees.comMarkMonitor Inc.18 Aug 20142 Aug 202418 Aug 2026
620lehrerecke.comRegistryGate GmbH18 Aug 201418 Aug 201418 Aug 2015
621lehua100.comHiChina Zhicheng Technology Limited18 Aug 201418 Aug 201418 Aug 2017
622lehubservices.comDropCatch.com 1134 LLC23 Oct 201724 Oct 201723 Oct 2018
623lehuihome.comTurnCommerce, Inc. DBA NameBright.com21 Jan 20186 May 202521 Jan 2026
624lehuijiayuan.comNamearsenal.com LLC4 Mar 20194 Mar 20194 Mar 2020
625lehuilives.comeName Technology Co., Ltd.1 Mar 202517 Aug 20251 Mar 2026
626lehuojs.comHiChina Zhicheng Technology Limited14 May 201719 May 201714 May 2018
627lehmanndesign.comTurnCommerce, Inc. DBA NameBright.com5 Nov 20141 Jan 20255 Nov 2025
628lehladakharrivals.comName.com, Inc.5 Nov 20147 Oct 20245 Nov 2025
629leheadcoach.comGoDaddy.com, LLC5 Nov 20145 Nov 20145 Nov 2015
630leharrivals.comName.com, Inc.5 Nov 20147 Oct 20245 Nov 2025
631lehavot.infoGoDaddy.com, LLC16 Jun 201417 Jun 201516 Jun 2016
632lehobaby.comCloud Yuqu LLC23 Mar 202123 Mar 202123 Mar 2022
633lehuochina.comHiChina Zhicheng Technology Limited30 Dec 20167 Jun 202530 Dec 2025
634lehautparleur.org----
635lehighacrespoolservice.orgGoDaddy.com, LLC20 Jun 20132 Jul 201520 Jun 2016
636lehavin.comTurnCommerce, Inc. DBA NameBright.com8 Aug 20202 Aug 20218 Aug 2025
637lehilo.comPorkbun, LLC7 Nov 20216 Nov 20247 Nov 2025
638lehighacreshomesforsale.comGoDaddy.com, LLC13 Jul 201523 Aug 202413 Jul 2024
639leh4ty5.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Aug 201419 Aug 201419 Aug 2015
640lehuayeya.comXin Net Technology Corporation19 Aug 201419 Aug 201419 Aug 2015
641lehayes.orgeNom, Inc.4 Nov 20144 Nov 20144 Nov 2015
642leh888.comBizcn.com, Inc.24 Jun 201524 Jun 201524 Jun 2016
643lehavre-normandie.comGandi SAS11 Jan 202111 Dec 202411 Jan 2026
644lehdesflorist.comGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
645lehengbao.comHefei Juming Network Technology Co., Ltd21 Nov 202428 Jul 202521 Nov 2025
646lehman-consulting-llc.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Jun 201524 Jun 201524 Jun 2016
647lehmanconsultingllc.comTucows Domains Inc.25 Aug 202029 Aug 202225 Aug 2022
648lehoanguyenvy.comNhan Hoa Software Company Ltd16 Jan 201817 Jan 201816 Jan 2019
649lehee.comPSI-USA, Inc. dba Domain Robot29 Jul 200816 Jul 202529 Jul 2026
650lehehew.comXin Net Technology Corporation16 Aug 201320 Aug 201416 Aug 2015
651lehighcountyhouses.com1&1 Internet AG21 Aug 201421 Aug 201621 Aug 2018
652lehoangtrung.com-4 Jul 20236 Jul 20244 Jul 2025
653lehommetranquille.com1&1 Internet AG20 Aug 201420 Aug 201420 Aug 2015
654lehrgaenge.info-25 Aug 202421 Apr 202525 Aug 2025
655lehuokeji.netALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED9 Sep 20249 Sep 20249 Sep 2025
656lehatbirgin.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
657lehavreducapitaine.comPSI-USA, Inc. dba Domain Robot12 Jan 201529 Jan 202512 Jan 2026
658lehcam.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
659lehighvalleyalfaromeo.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2020
660lehighvalleyrailing.comTucows Domains Inc.20 Mar 200419 Feb 202520 Mar 2026
661lehighvalleyweichert.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
662lehmanartcenter.comGMO Internet Inc.12 Jan 201512 Jan 201512 Jan 2016
663lehmanbrothersbankrupt.comGoDaddy.com, LLC8 Apr 20168 Apr 20168 Apr 2017
664lehmanntechnologies.comPDR Ltd. d/b/a PublicDomainRegistry.com22 May 20193 Jul 202322 May 2023
665lehoichuahuong.comTurnCommerce, Inc. DBA NameBright.com12 Jan 201521 Feb 202512 Jan 2025
666lehrercheck.comMesh Digital Limited12 Jan 201511 Jan 202512 Jan 2026
667lehrnmentor.comGoDaddy.com, LLC12 Jan 20159 Jan 202512 Jan 2026
668lehui188.comXin Net Technology Corporation13 Jan 201513 Jan 201513 Jan 2016
669lehuohe.comHiChina Zhicheng Technology Limited7 Nov 20147 Nov 20147 Nov 2015
670lehui360.comGoDaddy.com, LLC3 Apr 20172 Apr 20253 Apr 2026
671lehtimaailma.comCSL Computer Service Langenbach GmbH d/b/a joker.c…6 Nov 20149 Oct 20246 Nov 2025
672lehrbuch-wirtschaftsinformatik.comGoDaddy.com, LLC6 Nov 20146 Nov 20146 Nov 2016
673lehouxsport.comSitefrenzy.com LLC11 May 202214 May 202311 May 2024
674lehoidienthoai.comMat Bao Trading & Service Company Limited d/b/a Ma…6 Nov 20146 Nov 20146 Nov 2015
675lehighvalleyhyundaiservice.com1&1 Internet AG6 Nov 201414 Mar 20186 Nov 2025
676lehighvalleyhondaservice.com1&1 Internet AG6 Nov 201414 Mar 20186 Nov 2025
677lehighvalleyacuraservice.com1&1 Internet AG6 Nov 201414 Mar 20186 Nov 2025
678lehavredemaquietude.comAcens Technologies, S.L.U.21 Aug 201421 Aug 201421 Aug 2015
679lehcy.comHiChina Zhicheng Technology Limited21 Aug 201422 Aug 202421 Aug 2025
680lehobl.comGoDaddy.com, LLC21 Aug 201421 Aug 201421 Aug 2015
681lehsportstherapy.comInterweb Advertising D.B.A. Profile Builder21 Aug 201421 Aug 201421 Aug 2015
682lehui555.comPSI-USA, Inc. dba Domain Robot16 Mar 202116 Mar 202116 Mar 2022
683lehul.comPSI-USA, Inc. dba Domain Robot21 Jul 202320 Jul 202421 Jul 2024
684lehighvalleybasementwatercleanup.comWild West Domains, LLC7 Feb 20157 Feb 20157 Feb 2016
685lehighvalleybasementwaterdamagerepair.comWild West Domains, LLC7 Feb 20157 Feb 20157 Feb 2016
686lehighvalleyemergencywatercleanup.comWild West Domains, LLC7 Feb 20157 Feb 20157 Feb 2016
687lehighvalleypaintingsite.comGoDaddy.com, LLC6 Feb 20157 Feb 20256 Feb 2035
688lehighvalleywaterdamagecleanup.comWild West Domains, LLC7 Feb 20157 Feb 20197 Feb 2020
689lehker.org1&1 Internet AG6 Feb 2015-6 Feb 2016
690lehrmann-project.comMesh Digital Limited6 Feb 20156 Jul 20176 Feb 2018
691lehulandsonline.com----
692lehuo520.comDOMAIN NAME NETWORK PTY LTD27 Feb 202527 Feb 202527 Feb 2026
693lehuoguoji.comHiChina Zhicheng Technology Limited6 Feb 20156 Feb 20156 Feb 2016
694lehuoguoji.netHiChina Zhicheng Technology Limited6 Feb 20156 Feb 20156 Feb 2016
695lehuy008.comeNom, Inc.6 Feb 20156 Feb 20156 Feb 2016
696lehaitv.comHiChina Zhicheng Technology Limited28 Feb 201527 Jun 202528 Feb 2028
697lehaitv.netHiChina Zhicheng Technology Limited28 Feb 201521 Feb 202528 Feb 2028
698lehambone.comFastDomain Inc.28 Feb 201528 Feb 201628 Feb 2017
699lehmetalk.comGoDaddy.com, LLC28 Feb 201528 Feb 201528 Feb 2016
700lehoahoianclothshop.comP.A. Viet Nam Company Limited28 Feb 201528 Feb 201528 Feb 2016
701lehtimaja.netWild West Domains, LLC28 Feb 201528 Feb 201528 Feb 2016
702lehuachengleyuan.comBeijing Lanhai Jiye Technology Co., Ltd1 Mar 201524 Jul 20251 Mar 2026
703lehuobo.comDynadot, LLC5 Jun 20195 Jun 20195 Jun 2020
704lehuogroup.comHiChina Zhicheng Technology Limited18 Mar 202018 Mar 202018 Mar 2021
705leharpermens.comGoDaddy.com, LLC22 Aug 201422 Aug 201422 Aug 2015
706leharpermens.infoGoDaddy.com, LLC23 Aug 201423 Aug 201423 Aug 2015
707leharpermens.netGoDaddy.com, LLC22 Aug 201422 Aug 201422 Aug 2015
708lehderfest.comregister.com, Inc.22 Aug 20149 Aug 202322 Aug 2025
709lehighvalleyautorama.comeNom, Inc.23 Aug 201423 Aug 201423 Aug 2015
710lehlong.comeNom, Inc.6 Apr 20216 Apr 20216 Apr 2022
711lehrylco.comHiChina Zhicheng Technology Limited14 Nov 201815 Nov 201814 Nov 2019
712lehuamamo-morioka.comGMO Internet Inc.22 Aug 20147 Aug 201722 Aug 2018
713lehuiche.comChengdu West Dimension Digital Technology Co., Ltd…13 Jan 201613 Jan 201613 Jan 2026
714lehuazhuan.comEranet International Limited11 May 202321 May 202411 May 2024
715lehrerfuerlehrer.comGoDaddy.com, LLC7 Nov 20147 Nov 20147 Nov 2015
716lehrerbezahlenlehrer.comGoDaddy.com, LLC7 Nov 20147 Nov 20147 Nov 2015
717lehmanfuneralhones.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Nov 20148 Nov 20148 Nov 2015
718leher8.com1API GmbH31 Mar 201831 Mar 201831 Mar 2019
719lehangar-a-becanes.comGandi SAS7 Nov 20146 Nov 20177 Nov 2018
720lehangarducycle.comGoDaddy.com, LLC14 Apr 201514 Apr 201514 Apr 2016
721lehangarducycle.netGoDaddy.com, LLC14 Apr 201514 Apr 201514 Apr 2016
722lehangarducycle.orgGoDaddy.com, LLC14 Apr 201515 Apr 201714 Apr 2018
723lehelmet.comRegister.it SPA7 Feb 20187 Feb 20187 Feb 2019
724lehishaer.comGoDaddy.com, LLC14 Apr 201514 Apr 201514 Apr 2017
725lehubmobile.comGandi SAS14 Apr 201514 Apr 201514 Apr 2016
726lehuibang.comHiChina Zhicheng Technology Limited11 Sep 201919 Sep 202411 Sep 2025
727lehighmathcircle.orgeNom, Inc.25 Jun 201522 Jun 201725 Jun 2018
728leharpermens.orgGoDaddy.com, LLC23 Aug 201423 Aug 201423 Aug 2015
729lehedu.orgPDR Ltd. d/b/a PublicDomainRegistry.com23 Aug 201424 Aug 201423 Aug 2015
730lehighacres-quick-money-at-home.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Aug 201423 Aug 201423 Aug 2015
731lehighvalleycateringandevents.comGoDaddy.com, LLC24 Aug 201424 Aug 201624 Aug 2017
732lehighvalleycateringevents.comGoDaddy.com, LLC23 Aug 201423 Aug 201423 Aug 2015
733lehighvalleycateringpros.comGoDaddy.com, LLC24 Aug 201424 Aug 201824 Aug 2019
734lehladakhcabs.comGoDaddy.com, LLC15 Jul 202126 Sep 202415 Jul 2024
735lehnard.net1&1 Internet AG23 Aug 20145 Dec 201723 Aug 2018
736lehrbuch-wirtschaftsinformatik.orgGoDaddy.com, LLC6 Nov 20147 Jul 20246 Nov 2028
737lehrbuch-wirtschaftsinformatik.netGoDaddy.com, LLC6 Nov 201418 Jan 20246 Nov 2023
738lehrbuch-wirtschaftsinformatik.infoGoDaddy.com, LLC6 Nov 201418 Nov 20236 Nov 2024
739lehavin.netHiChina Zhicheng Technology Limited6 Nov 20145 Nov 20246 Nov 2026
740lehayet.comWebfusion Ltd.12 Aug 20145 Aug 201612 Aug 2018
741lehighvalleybusinessdirectory.comHostinger, UAB5 Feb 20246 Apr 20245 Feb 2026
742lehighvalleymovers.comGoDaddy.com, LLC4 Dec 20155 Dec 20244 Dec 2025
743lehmanandassciatesconsulting.comeNom, Inc.12 Aug 201412 Aug 201412 Aug 2015
744lehmanbaseballrewards.comGoDaddy.com, LLC12 Aug 201412 Aug 201412 Aug 2015
745lehmanns-group.com1&1 Internet AG12 Aug 201413 Aug 201612 Aug 2018
746lehmanroofinginc.comNameCheap, Inc.2 Aug 20193 Jul 20252 Aug 2026
747lehuozuhe.comPSI-USA, Inc. dba Domain Robot10 Apr 202518 Jul 202510 Apr 2026
748lehalal.comOVH sas21 Aug 200919 Jul 202421 Aug 2025
749lehewservices.comregister.com, Inc.24 Aug 201424 Aug 201424 Aug 2015
750lehighvalleylock.comGoDaddy.com, LLC28 Jan 202411 Mar 202528 Jan 2026
751lehipetersen.comGoDaddy.com, LLC24 Aug 201424 Aug 201424 Aug 2015
752lehky-vydelek-online.infoRegtime Ltd.24 Aug 201424 Aug 201424 Aug 2015
753lehuajapan.comBeijing Lanhai Jiye Technology Co., Ltd11 Apr 202212 Apr 202411 Apr 2025
754lehuiwanju.comXin Net Technology Corporation24 Aug 201424 Aug 201424 Aug 2015
755lehubagro.comOVH sas8 Nov 20146 Nov 20168 Nov 2017
756lehse.com-24 Aug 202424 Aug 202424 Aug 2025
757lehouseofhood.comFastDomain Inc.8 Nov 20148 Nov 20148 Nov 2015
758lehighvalleyfamilyphotos.comTucows Domains Inc.5 Nov 20139 Nov 20145 Nov 2015
759lehrlingsselektion.infoNameCheap, Inc.19 Aug 2024-19 Aug 2025
760lehighvalleytransmissions.netGoDaddy.com, LLC7 Nov 201419 Dec 20247 Nov 2024
761lehighvalleycoffeeparty.orgTucows Domains Inc.3 Nov 20127 Nov 20143 Nov 2015
762lehatitia.comHiChina Zhicheng Technology Limited31 Oct 201531 Oct 201531 Oct 2016
763lehighvalleybuilders.comTucows Domains Inc.10 Aug 201021 Oct 202410 Aug 2024
764lehippiechic.comGoDaddy.com, LLC13 Aug 201416 Sep 202213 Aug 2025
765lehmanlegal.comGoDaddy.com, LLC13 Aug 201414 Aug 202413 Aug 2025
766lehmanlegal.infoGoDaddy.com, LLC13 Aug 201414 Aug 201913 Aug 2020
767lehmanlegal.netGoDaddy.com, LLC13 Aug 20146 Aug 201513 Aug 2017
768lehmanlegal.orgGoDaddy.com, LLC13 Aug 201428 Jul 201713 Aug 2018
769lehmanlegal.usGoDaddy.com, LLC13 Aug 20146 Aug 201512 Aug 2017
770lehqdznawppm.comGMO Internet Inc.13 Aug 201413 Aug 201413 Aug 2015
771lehrerinnen.comDynadot, LLC31 Aug 201931 Aug 202431 Aug 2025
772leharieventing.comGoDaddy.com, LLC24 Nov 201925 Nov 202424 Nov 2025
773lehfoo.comBeijing Lanhai Jiye Technology Co., Ltd27 Aug 201429 Jul 202527 Aug 2025
774lehighcannabis.com1API GmbH18 Feb 20202 Apr 202418 Feb 2024
775lehighcannabisclub.comGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
776lehighcountycars.comDreamHost, LLC26 Aug 201427 Aug 201526 Aug 2016
777lehighrepair.comGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
778lehighvalleyfamilyportraits.comGoDaddy.com, LLC31 May 201731 May 201731 May 2018
779lehighvalleyiphonerepair.comGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
780lehiighgas.comTucows Domains Inc.26 Aug 201430 Aug 201526 Aug 2016
781lehindre.comTucows Domains Inc.22 Nov 20249 Dec 202422 Nov 2025
782lehlostudio.comNetwork Solutions, LLC25 Aug 201425 Aug 201425 Aug 2015
783lehnrfeugftkj.comGMO Internet Inc.26 Aug 201426 Aug 201426 Aug 2015
784lehongsteel.netP.A. Viet Nam Company Limited25 Aug 201425 Aug 201425 Aug 2015
785lehsuniyathermaltechnologies.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Aug 201425 Aug 201425 Aug 2015
786lehtikeisari.comCNOBIN INFORMATION TECHNOLOGY LIMITED9 Dec 20219 Dec 20219 Dec 2022
787lehuadesign.comGoDaddy.com, LLC15 Mar 202016 Nov 202215 Mar 2030
788lehvee.comBeijing Lanhai Jiye Technology Co., Ltd13 Jun 202315 Aug 202513 Jun 2025
789lehuakongjian.comHiChina Zhicheng Technology Limited9 Nov 20149 Nov 20149 Nov 2015
790lehuajixiang.comBeijing Lanhai Jiye Technology Co., Ltd18 Feb 202416 Aug 202518 Feb 2026
791lehighgapguttercleaning.comWild West Domains, LLC9 Nov 201410 Nov 20249 Nov 2025
792lehighdeltachi.comMedia Elite Holdings Limited19 Mar 202119 Mar 202119 Mar 2022
793lehteterycz.com-1 Oct 20161 Oct 20161 Oct 2018
794lehuo510.comKey-Systems GmbH14 May 202327 Jul 202414 May 2024
795lehuohui.net-2 Jun 20253 Jun 20252 Jun 2026
796lehuodingshi.netDropCatch.com 1188 LLC13 Sep 202113 Sep 202113 Sep 2022
797leheze.comHiChina Zhicheng Technology Limited27 Aug 201427 Aug 201427 Aug 2015
798lehighvalleyflooring.comMetaregistrar BV Applications18 Dec 201920 Dec 202418 Dec 2025
799lehmanbarn.comNetwork Solutions, LLC27 Aug 201430 Jul 202427 Aug 2026
800lehrisolutions.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Aug 201427 Aug 201427 Aug 2015
801lehuiyun.comHiChina Zhicheng Technology Limited27 Aug 20143 Aug 202427 Aug 2025
802lehuo56.comChengdu West Dimension Digital Technology Co., Ltd…27 Aug 201427 Aug 201427 Aug 2015
803lehuoway.comHiChina Zhicheng Technology Limited27 Aug 201427 Aug 201427 Aug 2015
804lehuokj.netChengdu West Dimension Digital Technology Co., Ltd…27 Aug 201427 Aug 201427 Aug 2015
805lehangholidays.comDomain.com, LLC15 Aug 201428 Sep 202415 Aug 2024
806lehdiamonds.comGandi SAS15 Aug 201415 Aug 201415 Aug 2015
807lehgov.comGoDaddy.com, LLC15 Aug 201415 Aug 201415 Aug 2015
808lehighema.orgGMO Internet Inc.15 Aug 201415 Aug 201415 Aug 2015
809lehighlandscapeservices.comTucows Domains Inc.11 Aug 201315 Aug 201411 Aug 2015
810lehighsf.orgPDR Ltd. d/b/a PublicDomainRegistry.com15 Aug 201415 Aug 201415 Aug 2015
811lehighvalleycomicexpo.comGoDaddy.com, LLC15 Aug 201416 Aug 202415 Aug 2026
812lehman-brothers.info-26 Jun 202526 Jun 202526 Jun 2026
813lehmanhotsprings.netNetwork Solutions, LLC15 Aug 201416 Jun 202515 Aug 2026
814lehmannhealthcare.comMarcaria.com International, Inc.15 Aug 201415 Aug 201415 Aug 2015
815lehorvath.comTucows Domains Inc.15 Aug 201419 Aug 201515 Aug 2016
816lehuiguo8.com35 Technology Co., Ltd.15 Aug 201415 Aug 201415 Aug 2015
817lehrerfinancial.comGoDaddy.com, LLC11 Nov 201411 Nov 201411 Nov 2016
818lehonggz.comHiChina Zhicheng Technology Limited11 Nov 20141 Nov 201711 Nov 2018
819lehoiquagarena.comregister.com, Inc.12 Dec 20168 Mar 202512 Dec 2025
820lehoiquagaren.comNetowl, Inc.10 Nov 201410 Nov 201410 Nov 2015
821lehnert-bau.comCronon AG10 Nov 201430 Dec 202410 Nov 2025
822leherissonvoyageur.comOVH sas10 Nov 20143 Jan 202510 Nov 2025
823lehanwang.comBeijing Lanhai Jiye Technology Co., Ltd10 Nov 201424 Jul 202510 Nov 2025
824lehighvalleymechanics.comRealtime Register B.V.28 Aug 201428 Aug 201428 Aug 2015
825lehlikes.comBigRock Solutions Ltd.28 Aug 201428 Aug 201428 Aug 2015
826lehoitango.comMoniker Online Services LLC28 Aug 201428 Aug 201428 Aug 2015
827lehrenbau.comMesh Digital Limited26 Feb 201827 Jan 202526 Feb 2026
828lehuotoupiao.comGuangDong NaiSiNiKe Information Technology Co Ltd.28 Aug 201428 Aug 201428 Aug 2015
829lehavre-ltd.comGoDaddy.com, LLC16 Aug 201416 Aug 201416 Aug 2015
830lehrbergerhofladen.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Dec 20176 Dec 20176 Dec 2018
831lehighuniversityalumni.infoGoDaddy.com, LLC10 Nov 201410 Nov 201410 Nov 2015
832lehuojidi.comHiChina Zhicheng Technology Limited11 Nov 201411 Nov 201411 Nov 2017
833lehrlingstraining.comLedl.net GmbH11 Nov 20144 Feb 202411 Nov 2025
834lehohi.comHiChina Zhicheng Technology Limited12 Nov 201412 Nov 201412 Nov 2015
835lehegongyuan.comHiChina Zhicheng Technology Limited12 Nov 201412 Nov 201412 Nov 2015
836lehtinenusa.netGoDaddy.com, LLC10 Nov 201410 Nov 201410 Nov 2015
837lehighuniversityalumni.orgGoDaddy.com, LLC10 Nov 201410 Nov 201410 Nov 2015
838lehighuniversityalumni.netGoDaddy.com, LLC10 Nov 201410 Nov 201410 Nov 2015
839lehanwang.netAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…14 Jul 202216 Jul 202514 Jul 2026
840lehuojidi.netHiChina Zhicheng Technology Limited11 Nov 201411 Nov 201411 Nov 2015
841lehuojidi.mobiHiChina Zhicheng Technology Limited11 Nov 2014-11 Nov 2015
842lehegongyuan.netHiChina Zhicheng Technology Limited12 Nov 201412 Nov 201412 Nov 2015
843lehaillan.orgGandi SAS11 Nov 201023 Nov 201611 Nov 2017
844lehaaz.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Aug 201718 Aug 20244 Aug 2025
845lehighvalleyfamilypetshow.comGoDaddy.com, LLC11 Sep 201412 Sep 202411 Sep 2025
846lehighvalleykidsventure.comWild West Domains, LLC11 Sep 201414 Dec 201511 Sep 2017
847lehltg.com-21 Oct 201621 Oct 201621 Oct 2017
848lehmannaviation.infoGoDaddy.com, LLC11 Sep 201411 Sep 201411 Sep 2015
849lehmat.comNameCheap, Inc.11 Sep 201410 Sep 202411 Sep 2025
850lehmat.netNameCheap, Inc.11 Sep 201410 Sep 202411 Sep 2025
851lehmkuhlinsuranceagency.comTucows Domains Inc.8 Sep 201112 Sep 20148 Sep 2015
852lehungkhang.comName.com, Inc.12 Sep 201411 Sep 201712 Sep 2018
853lehunwang.netBizcn.com, Inc.12 Sep 201412 Sep 201412 Sep 2015
854lehyatra.comGoDaddy.com, LLC13 Nov 201413 Nov 201413 Nov 2015
855lehuistreet.comHiChina Zhicheng Technology Limited13 Nov 201413 Nov 201413 Nov 2015
856lehmanwellness.comGoDaddy.com, LLC7 Oct 202118 Oct 20247 Oct 2025
857lehladakhvisit.comGoDaddy.com, LLC13 Nov 201413 Nov 201413 Nov 2015
858lehighvalleymodels.comTucows Domains Inc.10 Nov 201314 Nov 201410 Nov 2015
859lehighvalleycloud.comVitalwerks Internet Solutions, LLC DBA No-IP13 Nov 201419 Nov 201513 Nov 2016
860lehighslipandfallattorney.comGoDaddy.com, LLC13 Nov 201413 Nov 201413 Nov 2015
861lehighautoaccidentattorney.comGoDaddy.com, LLC13 Nov 201413 Nov 201413 Nov 2015
862lehighacreslawyers.comGoDaddy.com, LLC23 Mar 202523 Mar 202523 Mar 2026
863lehaha8.comEranet International Limited9 Aug 20259 Aug 20259 Aug 2026
864lehemovies.comHiChina Zhicheng Technology Limited29 Aug 201429 Aug 201429 Aug 2015
865leheng.usShanghai Meicheng Technology Information Co., Ltd29 Aug 2014-28 Aug 2015
866leheyingye.comShanghai Meicheng Technology Information Co., Ltd6 Jan 20166 Jan 20166 Jan 2017
867lehighautosalesandservice.comGoDaddy.com, LLC29 Aug 201430 Aug 202429 Aug 2025
868lehighcountyhomes.comGoDaddy.com, LLC29 Dec 201624 Sep 202429 Dec 2025
869lehmannjrotc.orgFastDomain Inc.20 Jul 201129 Aug 201420 Jul 2015
870lehner-wt.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Aug 201430 Aug 201430 Aug 2015
871lehohoo.comNamesilo, LLC27 Apr 201828 Apr 202527 Apr 2026
872lehuishang.comHiChina Zhicheng Technology Limited17 Nov 201520 Oct 201617 Nov 2017
873lehui518.comBeijing Lanhai Jiye Technology Co., Ltd23 Sep 202124 Sep 202323 Sep 2024
874lehuir.comSquarespace Domains LLC22 Mar 202417 Mar 202522 Mar 2026
875lehvidio.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Sep 201412 Sep 201412 Sep 2015
876lehmancatholicbasketball.comGoDaddy.com, LLC30 Aug 201430 Aug 201430 Aug 2015
877lehuitongsz.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Aug 201430 Aug 201430 Aug 2015
878lehmannaviation.usNamesilo, LLC11 Sep 20146 Dec 202416 Jan 2026
879lehaiyen.comGoDaddy.com, LLC24 Feb 202424 Feb 202524 Feb 2026
880leheitiv.comNetwork Solutions, LLC14 Sep 201412 Sep 201614 Sep 2017
881lehousesa.comTucows Domains Inc.9 Sep 201313 Sep 20149 Sep 2015
882lehovss-de.comTucows Domains Inc.10 Sep 201313 Sep 201410 Sep 2015
883lehuangou.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…17 Feb 202526 Feb 202517 Feb 2028
884lehuofuzhou.comeName Technology Co., Ltd.14 Sep 201414 Sep 201414 Sep 2015
885lehuoquanzhou.comeName Technology Co., Ltd.14 Sep 201414 Sep 201414 Sep 2015
886lehuoxiamen.comeName Technology Co., Ltd.14 Sep 201414 Sep 201414 Sep 2015
887lehvoss-de.comTucows Domains Inc.10 Sep 201314 Sep 201410 Sep 2015
888lehaopj.comShanghai Meicheng Technology Information Co., Ltd31 Aug 201431 Aug 201431 Aug 2015
889lehmanagency.comGoDaddy.com, LLC22 Feb 201922 Feb 201922 Feb 2022
890lehmanagency.infoGoDaddy.com, LLC31 Aug 201412 Sep 201731 Aug 2018
891lehmanagency.netGoDaddy.com, LLC31 Aug 201423 Aug 201631 Aug 2017
892lehmanagency.orgGoDaddy.com, LLC31 Aug 201412 Sep 201731 Aug 2018
893leho0871.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED28 Jul 202429 Jul 202528 Jul 2025
894leho0871.netPDR Ltd. d/b/a PublicDomainRegistry.com15 Nov 201615 Jan 201715 Nov 2017
895leho0871.orgChengdu West Dimension Digital Technology Co., Ltd…15 Apr 201715 Jun 201715 Apr 2018
896lehaoju.comJiangsu Bangning Science and technology Co. Ltd.17 Apr 202121 May 202417 Apr 2024
897lehasoft.comRegister NV dba Register.eu14 Sep 201414 Sep 201414 Sep 2015
898lehengrun.comGuangzhou Domains, Inc.4 Jun 20177 Jul 20174 Jun 2018
899lehighvalleydivorcelawyer.comTucows Domains Inc.11 Sep 200915 Sep 201411 Sep 2015
900lehighvalleymedicalmalpracticelawyer.comTucows Domains Inc.11 Sep 200915 Sep 201411 Sep 2015
901lehoogarden.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Sep 201414 Sep 201414 Sep 2015
902lehroutboards.comDropCatch.com 1445 LLC3 Dec 20183 Dec 20183 Dec 2019
903lehuoqp.comXin Net Technology Corporation15 Sep 201419 Sep 201715 Sep 2018
904lehuacourt.comGoDaddy.com, LLC3 Feb 20163 Feb 20253 Feb 2026
905lehoche.comSquarespace Domains LLC5 Aug 20255 Aug 20255 Aug 2028
906lehighvalleytechtutors.comDomain.com, LLC14 Nov 201414 Nov 201414 Nov 2015
907lehautcolombier.com1&1 Internet AG1 Sep 20147 Sep 20161 Sep 2017
908lehobm.comHiChina Zhicheng Technology Limited2 Sep 20142 Sep 20142 Sep 2017
909lehong.orgGoogle, Inc.10 Oct 201717 Jul 202510 Oct 2028
910lehrwerk.comRegistryGate GmbH1 Sep 20142 Sep 20241 Sep 2025
911lehuo88.comBeijing Lanhai Jiye Technology Co., Ltd16 Feb 202229 Jul 202516 Feb 2026
912lehuobar.com-18 Jun 202220 Aug 202318 Jun 2023
913lehuoshenghuo.comXin Net Technology Corporation1 Sep 20141 Sep 20141 Sep 2015
914lehmandepot.comGMO Internet Inc.16 Sep 201416 Sep 201416 Sep 2015
915lehuaxin.com-24 Oct 20175 Jan 202524 Oct 2024
916lehe88.com-9 May 20169 May 20169 May 2017
917lehao18.comChengdu West Dimension Digital Technology Co., Ltd…17 Dec 201917 Dec 201917 Dec 2020
918lehberg.comTurnCommerce, Inc. DBA NameBright.com2 Sep 201427 Aug 20202 Sep 2025
919lehforlouisville.comNameCheap, Inc.31 Jul 202431 Jul 202431 Jul 2025
920lehforlouisville.netNameCheap, Inc.3 Sep 201411 Jan 20183 Sep 2018
921lehforlouisville.orgNameCheap, Inc.6 Sep 20212 Nov 20236 Sep 2026
922lehiauto.comGoDaddy.com, LLC12 Oct 201912 Oct 201912 Oct 2020
923lehighvalleyactingclasses.comMarcaria.com International, Inc.2 Sep 20142 Sep 20142 Sep 2015
924lehua88.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED22 Jan 202522 Jan 202522 Jan 2026
925lehuihome.net-18 Sep 202320 Oct 202418 Sep 2024
926lehuilives.netDROPCATCH.COM 773 LLC16 Nov 201610 Dec 201716 Nov 2018
927lehuoxiaozhen.comXiamen ChinaSource Internet Service Co., Ltd.22 May 201822 May 202322 May 2024
928lehighvalleyhome.usGoDaddy.com, LLC13 Nov 201418 Nov 201912 Nov 2020
929lehebooks.orgPDR Ltd. d/b/a PublicDomainRegistry.com15 Sep 201415 Sep 201415 Sep 2015
930lehighvalleycloudsolutions.comGoDaddy.com, LLC15 Sep 201416 Sep 201615 Sep 2017
931lehighvalleylacrosseacademy.comGoDaddy.com, LLC15 Sep 201415 Sep 201415 Sep 2016
932lehighvalleypa.comTurnCommerce, Inc. DBA NameBright.com15 Sep 20149 Mar 202515 Sep 2025
933lehoangaspendale.com-15 Sep 201415 Sep 201415 Sep 2017
934lehuamucai.comBizcn.com, Inc.15 Sep 201415 Sep 201415 Sep 2015
935lehuclub.comChengdu West Dimension Digital Technology Co., Ltd…20 Mar 202020 Mar 202020 Mar 2021
936lehuii.comHefei Juming Network Technology Co., Ltd3 Mar 201827 Jun 20253 Mar 2026
937lehunhui.comChengdu West Dimension Digital Technology Co., Ltd…15 Sep 201415 Sep 201415 Sep 2018
938lehuojujia.comShanghai Meicheng Technology Information Co., Ltd15 Sep 201415 Sep 201415 Sep 2015
939lehuoziran.comGMO Internet Inc.25 Mar 2019-25 Mar 2020
940lehuuloc.comNameCheap, Inc.4 Nov 20244 Nov 20244 Nov 2025
941lehuodc.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Mar 202116 Mar 202115 Mar 2022
942lehuo92.comHazelDomains, Inc.17 Nov 202118 Nov 202117 Nov 2022
943lehmannisr.comMarcaria.com International, Inc.15 Nov 201415 Nov 201415 Nov 2015
944lehmanncargo.comMarcaria.com International, Inc.15 Nov 201415 Nov 201415 Nov 2015
945lehightargets.comGoDaddy.com, LLC16 Nov 201416 Nov 201616 Nov 2017
946lehiventures.comTucows Domains Inc.17 Sep 201416 Sep 202417 Sep 2025
947lehua169.comNamesilo, LLC14 May 201815 May 201814 May 2019
948lehazart.comNetwork Solutions, LLC3 Sep 20143 Sep 20143 Sep 2015
949lehighvalleydecorating.comTucows Domains Inc.30 Aug 20124 Sep 201430 Aug 2015
950lehighvalleystores.comFabulous.com Pty Ltd.1 Sep 20084 Oct 20151 Sep 2016
951lehilandscaping.comNameCheap, Inc.27 May 202415 May 202527 May 2026
952lehmanhaileyhomes.comWild West Domains, LLC4 Sep 20144 Sep 20164 Sep 2017
953lehmond.comHiChina Zhicheng Technology Limited13 May 201813 May 201813 May 2019
954lehoxq.comGoDaddy.com, LLC3 Sep 20143 Sep 20143 Sep 2015
955lehtolapsi.comeNom, Inc.3 Dec 20153 Dec 20153 Dec 2016
956lehtx.comGoDaddy.com, LLC3 Sep 201416 Sep 20223 Sep 2026
957lehtx.infoNameCheap, Inc.13 Feb 202326 Mar 202413 Feb 2024
958lehtx.netGoDaddy.com, LLC13 Sep 202114 Sep 202413 Sep 2025
959lehtx.orgGoDaddy.com, LLC3 Sep 20143 Sep 20143 Sep 2016
960lehuncheng.comHiChina Zhicheng Technology Limited3 Sep 20143 Sep 20163 Sep 2017
961lehuncheng.netHiChina Zhicheng Technology Limited3 Sep 20143 Sep 20143 Sep 2015
962lehe-china.comHiChina Zhicheng Technology Limited17 Sep 201423 Nov 202417 Sep 2025
963lehighvalleyhousebuyer.comGoDaddy.com, LLC15 Jun 201615 Jun 201615 Jun 2017
964lehumo.comTucows Domains Inc.17 Sep 20146 Aug 202517 Sep 2026
965lehe-china.netHiChina Zhicheng Technology Limited17 Sep 201415 Sep 201517 Sep 2017
966lehrerzen.comTucows Domains Inc.14 Sep 201317 Sep 201414 Sep 2015
967lehighvalleyhomesolutions.comNameCheap, Inc.17 Sep 201418 Sep 202417 Sep 2025
968lehubquebec.comDomain.com, LLC23 Sep 202325 Jun 202523 Sep 2025
969lehighvalleyhondaxchange.comeNom, Inc.4 Sep 20144 Sep 20144 Sep 2015
970lehighvalleyhondaxchange.neteNom, Inc.4 Sep 20144 Sep 20144 Sep 2015
971lehighvalleypoconosnightout.comeNom, Inc.4 Sep 20146 Aug 20174 Sep 2018
972lehman-langerman.comTucows Domains Inc.1 Sep 20044 Sep 20141 Sep 2015
973lehoa.orgGoDaddy.com, LLC4 Sep 20146 Jul 20244 Sep 2026
974lehockeylhjmq.comDropCatch.com 435 LLC22 Nov 201722 Nov 201722 Nov 2018
975lehockeylhjmq.netGoDaddy.com, LLC4 Sep 20145 Sep 20164 Sep 2017
976lehrbuch.net-30 Dec 202129 Jan 202530 Dec 2025
977lehuitoy.comXin Net Technology Corporation5 Sep 20146 Sep 20245 Sep 2025
978lehuitoys.comXin Net Technology Corporation5 Sep 20146 Sep 20245 Sep 2025
979lehuopie.comEpik Inc.29 Aug 201929 Aug 201929 Aug 2020
980lehuoleju.comHiChina Zhicheng Technology Limited17 Nov 201417 Nov 201417 Nov 2015
981lehmannvocare.comGoDaddy.com, LLC17 Nov 201417 Nov 201417 Nov 2015
982lehmanassociatesconcrete.comTucows Domains Inc.17 Nov 201421 Nov 201817 Nov 2018
983lehighvalleyledger.comGoDaddy.com, LLC21 Jan 201921 Jan 201921 Jan 2020
984leharcoupons.comGoDaddy.com, LLC18 Sep 201419 Sep 201418 Sep 2015
985lehrbound.comeNom, Inc.18 Sep 201418 Sep 201418 Sep 2015
986lehuajaycees.comGoDaddy.com, LLC18 Sep 201418 Sep 201418 Sep 2015
987lehuo18.comChengdu West Dimension Digital Technology Co., Ltd…11 Jul 201811 Jul 201811 Jul 2019
988lehuocook.comHiChina Zhicheng Technology Limited18 Sep 201418 Sep 201418 Sep 2015
989lehighvalleyhondaxchange.useNom, Inc.4 Sep 20144 Sep 20143 Sep 2015
990lehehe.orgHiChina Zhicheng Technology Limited3 Dec 201524 Jun 20173 Dec 2017
991lehazy.neteNom, Inc.5 Sep 20147 Aug 20165 Sep 2017
992lehewitt.netGoDaddy.com, LLC21 Jun 202422 Jun 202521 Jun 2026
993lehightonendscopy.comGoDaddy.com, LLC5 Sep 20146 Sep 20245 Sep 2025
994lehighvalleyfinancing.orgGMO Internet Inc.4 Mar 20165 Mar 20174 Mar 2018
995lehmanninternational.comTucows Domains Inc.25 Oct 202429 Oct 202425 Oct 2025
996lehmanninternational.info1&1 Internet AG6 Sep 2014-6 Sep 2015
997lehmanninternational.net1&1 Internet AG6 Sep 20146 Sep 20146 Sep 2015
998lehonp.comregister.com, Inc.25 Nov 201629 Dec 201625 Nov 2017
999lehrer-machen-schule.comCPS-Datensysteme GmbH5 Sep 201410 Sep 20245 Sep 2025
1000lehrerinluzcelis.comEstrategias WebSite S.L.5 Sep 201422 May 20255 Sep 2025

Displaying 1,000 out of 42,570 domains starting with the keyword "LEH". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=leh

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now