Keyword: KWIKKAPITAL
Reverse Whois » KEYWORD [kwikkapital ] { 4 domain names }
Num | Domain Name | Registrar | Created | Updated | Expiry |
---|---|---|---|---|---|
1 | kwikkapital.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 29 Oct 2020 | 31 Oct 2024 | 29 Oct 2025 |
2 | kwikkapitaltelemarketingservices.com | GoDaddy.com, LLC | 12 Jun 2024 | 12 Jun 2024 | 12 Jun 2034 |
3 | kwikkapitalseamansloan.com | GoDaddy.com, LLC | 27 Aug 2024 | 26 May 2025 | 27 Aug 2034 |
4 | kwikkapitalofwloan.com | GoDaddy.com, LLC | 28 Jan 2025 | 28 Jan 2025 | 28 Jan 2035 |

Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=kwikkapital
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
---|---|---|---|---|
200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |