Our database now contains whois records of 628 Million (628,112,433) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1589 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [628 Million Domains] $10,000 Details

Keyword: KIDSFIRST

Reverse Whois » KEYWORD [kidsfirst ]  { 1,109 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1kidsfirst.orgDeluxe Small Business Sales, Inc. d/b/a Aplus.net9 May 199610 May 202510 May 2026
2kidsfirst.usGoDaddy.com, LLC15 Jul 201715 Jul 202514 Jul 2026
3kidsfirst.nycGoDaddy.com, LLC3 Dec 20143 Dec 20142 Dec 2015
4kidsfirst.redGMO Internet Inc.16 Feb 201516 Feb 201516 Feb 2017
5kidsfirst.worldGoDaddy.com, LLC24 Apr 20158 Jun 201724 Apr 2019
6kidsfirst.internationalGoDaddy.com, LLC24 Apr 20158 Jun 201724 Apr 2019
7kidsfirst.globalGoDaddy.com, LLC24 Apr 201514 Apr 202024 Apr 2022
8kidsfirst.academyGoDaddy.com, LLC24 Apr 201519 Apr 202024 Apr 2022
9kidsfirst.mobiGoDaddy.com, LLC27 Aug 201527 Aug 201527 Aug 2016
10kidsfirst.ongName.com, Inc.6 Nov 201520 Oct 20246 Nov 2025
11kidsfirst.ngoName.com, Inc.6 Nov 201520 Oct 20246 Nov 2025
12kidsfirst.bizTucows Domains Inc.2 Apr 200422 Feb 20251 Apr 2026
13kidsfirst.netEasyspace LTD1 Nov 200214 Jan 20251 Nov 2025
14kidsfirst.xyzGMO Internet Inc.17 Sep 202421 Jan 202517 Sep 2025
15kidsfirst.comDomain.com, LLC9 Apr 199819 Mar 20258 Apr 2026
16kidsfirst.infoGoDaddy.com, LLC15 Jul 201729 Aug 202415 Jul 2025
17kidsfirst.ca-25 Sep 20137 Aug 201725 Sep 2018
18kidsfirst.coGoDaddy.com, LLC14 Jun 201719 Jun 202513 Jun 2027
19kidsfirst.de--14 Oct 2016-
20kidsfirst.in-22 Nov 20161 Jan 201822 Nov 2018
21kidsfirst.networkGoDaddy.com, LLC15 Jul 201729 Aug 202415 Jul 2025
22kidsfirst.schoolGoDaddy.com, LLC29 Nov 20179 Feb 202529 Nov 2024
23kidsfirst.education-27 Feb 20254 Mar 202527 Feb 2026
24kidsfirst.co.uk-10 Nov 200412 Oct 202410 Nov 2025
25kidsfirst.org.ukOne.com A/S30 May 20131 May 201730 May 2019
26kidsfirst.onlineDomeneshop AS dba domainnameshop.com18 Mar 202428 Apr 202518 Mar 2025
27kidsfirst.foundationGoDaddy.com, LLC6 Jun 201910 Jun 20206 Jun 2021
28kidsfirst.proGoDaddy.com, LLC27 Jun 201328 Jun 202527 Jun 2026
29kidsfirst.clubGoDaddy.com, LLC3 Jul 20258 Jul 20253 Jul 2028
30kidsfirst.centerWild West Domains, LLC4 May 202112 Feb 20254 May 2027
31kidsfirst.voteGoDaddy.com, LLC8 Oct 202413 Oct 20248 Oct 2025
32kidsfirst.lifeGoDaddy.com, LLC6 Aug 202111 Aug 20216 Aug 2022
33kidsfirst.frOVH sas12 Jul 201728 Feb 202528 Jan 2026
34kidsfirst.ccGoDaddy.com, LLC14 Jan 200015 Jan 202514 Jan 2026
35kidsfirst.agencyGoDaddy.com, LLC6 Jul 20227 Sep 20246 Jul 2025
36kidsfirst.nl-20 Mar 200016 Oct 2024-
37kidsfirst.edu.plNamware.com, Inc.13 May 201912 May 202513 May 2026
38kidsfirst.org.nz-16 Aug 200016 Nov 2024-
39kidsfirst.appNameCheap, Inc.16 Mar 201914 Feb 202516 Mar 2026
40kidsfirst.shopGoDaddy.com, LLC18 Feb 20241 Apr 202518 Feb 2025
41kidsfirst.llcGoDaddy.com, LLC30 Jan 202020 Feb 202530 Jan 2026
42kidsfirst.dentistDynadot, LLC13 Jul 202223 Aug 202313 Jul 2023
43kidsfirst.la-8 May 20152 May 20258 May 2026
44kidsfirst.co.nz-19 Jul 20059 Feb 2025-
45kidsfirst.vipAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…9 Nov 20214 Nov 20249 Nov 2025
46kidsfirst.storeGoDaddy.com, LLC11 Sep 202312 Sep 202411 Sep 2025
47kidsfirst.toysTucows Domains Inc.10 Oct 202320 Nov 202410 Oct 2024
48kidsfirst.kidsGoDaddy.com, LLC23 Feb 20249 Apr 202523 Feb 2026
49kidsfirst.com.au--4 Apr 2025-
50kidsfirst.net.cn????????????14 Mar 2024-14 Mar 2026
51kidsfirst.topAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…9 Nov 20219 Nov 20219 Nov 2025
52kidsfirst.ru-5 Aug 2008-5 Aug 2025
53kidsfirst.fundNameCheap, Inc.10 Jul 202415 Jun 202510 Jul 2026
54kidsfirst.ro-6 Nov 2024-6 Nov 2025
55kidsfirst.com.br-26 Aug 202127 Jul 202326 Aug 2025
56kidsfirst.dk-2 Sep 2024-1 Sep 2025
57kidsfirst.se-30 Jun 202530 Jun 202530 Jun 2026
58kidsfirstswimschools.comNetwork Solutions, LLC11 Aug 200211 Jun 202411 Aug 2027
59kidsfirstoptimist.orgTucows Domains Inc.22 Oct 201426 Oct 201522 Oct 2016
60kidsfirstoptimist.netTucows Domains Inc.24 Oct 201428 Oct 201524 Oct 2016
61kidsfirstfoundation.netGoDaddy.com, LLC24 Oct 201425 Oct 202424 Oct 2025
62kidsfirstoptimist.comGoDaddy.com, LLC27 Oct 201427 Oct 201427 Oct 2015
63kidsfirstacademy.comeNom, Inc.12 Feb 201122 Feb 202512 Feb 2026
64kidsfirstfitness.comeNom, Inc.30 Dec 201021 Dec 201630 Dec 2017
65kidsfirstdaycare.comGoDaddy.com, LLC27 Nov 199928 Nov 202427 Nov 2025
66kidsfirstlearningcenter.com-7 May 20257 May 20257 May 2026
67kidsfirstfoundation.usGoDaddy.com, LLC17 Jun 20149 Apr 201716 Jun 2018
68kidsfirstlearning.comGoDaddy.com, LLC25 Nov 199916 Sep 202225 Nov 2025
69kidsfirstped.netregister.com, Inc.31 Oct 20141 Nov 202431 Oct 2025
70kidsfirstfrc.ca-6 Jul 201020 Aug 20246 Jul 2025
71kidsfirsthomepage.comTucows Domains Inc.21 Aug 200725 Aug 201721 Aug 2017
72kidsfirst1.comGoDaddy.com, LLC4 Nov 20145 Nov 20244 Nov 2029
73kidsfirstumcpp.com----
74kidsfirstgy.orgeNom, Inc.21 Aug 201421 Aug 201421 Aug 2016
75kidsfirstcn.comGoDaddy.com, LLC23 Aug 201424 Aug 202423 Aug 2026
76kidsfirstcn.orgGoDaddy.com, LLC23 Aug 20147 Oct 202423 Aug 2029
77kidsfirstcoltsneck.comGoDaddy.com, LLC23 Aug 201424 Aug 202423 Aug 2026
78kidsfirstcoltsneck.orgGoDaddy.com, LLC23 Aug 20147 Oct 202423 Aug 2026
79kidsfirstnj.orgGoDaddy.com, LLC23 Aug 20147 Oct 202423 Aug 2026
80kidsfirstmobiledentist.comDomain-It!, Inc.26 Aug 201426 Aug 201426 Aug 2015
81kidsfirsttrans.comWild West Domains, LLC25 Aug 201426 Aug 201625 Aug 2017
82kidsfirsttravel.comWild West Domains, LLC25 Aug 20147 Sep 202425 Aug 2025
83kidsfirstofga.comTucows Domains Inc.6 Nov 201310 Nov 20146 Nov 2015
84kidsfirstesports.comDomain.com, LLC27 Aug 201428 Jun 201627 Aug 2018
85kidsfirstuk.comGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
86kidsfirstevaluation.comTucows Domains Inc.28 Nov 200613 Nov 202428 Nov 2025
87kidsfirstoutreach.comGoogle, Inc.19 Jul 20204 Jul 202419 Jul 2025
88kidsfirstoptimists.comFastDomain Inc.13 Nov 201413 Nov 201413 Nov 2015
89kidsfirstoc.comGoDaddy.com, LLC29 Aug 201429 Aug 201429 Aug 2016
90kidsfirstdoctor.comTucows Domains Inc.9 Sep 201113 Sep 20149 Sep 2015
91kidsfirsttalkshow.comGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
92kidsfirstwithdrlori.comGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
93kidsfirstdayofschool.comGoDaddy.com, LLC2 Sep 20142 Sep 20142 Sep 2016
94kidsfirst-dental.comGoDaddy.com, LLC4 Sep 20144 Sep 20244 Sep 2026
95kidsfirstbydrswartz.comNetwork Solutions, LLC3 Sep 20143 Sep 20143 Sep 2015
96kidsfirstdentalgreeley.comGoDaddy.com, LLC4 Sep 201416 Sep 20224 Sep 2026
97kidsfirstdentalwellington.comGoDaddy.com, LLC4 Sep 201416 Sep 20224 Sep 2026
98kidsfirstdentalwindsor.comGoDaddy.com, LLC4 Sep 20144 Sep 20244 Sep 2026
99kidsfirstfc.comGoDaddy.com, LLC4 Sep 20144 Sep 20244 Sep 2026
100kidsfirstfortcollins.comGoDaddy.com, LLC4 Sep 20144 Sep 20244 Sep 2026
101kidsfirstgreeley.comGoDaddy.com, LLC4 Sep 20144 Sep 20244 Sep 2026
102kidsfirstpediatricdental.comGoDaddy.com, LLC4 Sep 20144 Sep 20244 Sep 2026
103kidsfirstwellington.comGoDaddy.com, LLC4 Sep 20144 Sep 20244 Sep 2026
104kidsfirstwindsor.comGoDaddy.com, LLC4 Sep 20144 Sep 20244 Sep 2026
105kidsfirstkids.comGoDaddy.com, LLC18 Nov 201419 Nov 202418 Nov 2029
106kidsfirstids.infoGMO Internet Inc.2 Oct 2014-2 Oct 2015
107kidsfirstarts.comGoDaddy.com, LLC8 Oct 20148 Oct 20148 Oct 2015
108kidsfirstcenter.netGoDaddy.com, LLC13 Oct 201414 Oct 202413 Oct 2034
109kidsfirstfood.comGoDaddy.com, LLC13 Oct 201411 Oct 201613 Oct 2017
110kidsfirsteducational.comGoDaddy.com, LLC3 Dec 201429 Mar 20253 Dec 2025
111kidsfirstcoalition.orgNameCheap, Inc.13 Jun 202513 Jun 202513 Jun 2026
112kidsfirstdance.comNetwork Solutions, LLC22 Dec 201422 Dec 201422 Dec 2015
113kidsfirst5preschool.comLaunchpad, Inc.22 Dec 201422 Dec 201422 Dec 2015
114kidsfirstpaa.orgGoDaddy.com, LLC23 Dec 201424 Dec 201623 Dec 2017
115kidsfirstbuildingssecond.comWild West Domains, LLC1 Jan 20151 Jan 20151 Jan 2017
116kidsfirstdubai.com1&1 Internet AG18 Jun 202518 Jun 202518 Jun 2026
117kidsfirstdental.dentalGoDaddy.com, LLC4 Sep 201419 Oct 20244 Sep 2026
118kidsfirstdaycare.nycGoDaddy.com, LLC3 Dec 20143 Dec 20142 Dec 2015
119kidsfirst-coaching.frlMijndomein.nl BV3 Feb 201510 Apr 20153 Apr 2016
120kidsfirstpediatricdentistry.dentistGoDaddy.com, LLC20 Apr 20154 Jun 202520 Apr 2026
121kidsfirstresponders.orgDomain.com, LLC16 Aug 2015-16 Aug 2016
122kidsfirstresponders.netDomain.com, LLC16 Aug 201516 Aug 201516 Aug 2016
123kidsfirstdentistryct.comTucows Domains Inc.12 Aug 200916 Aug 201512 Aug 2016
124kidsfirstonpurpose.comWild West Domains, LLC19 Jan 201519 Jan 201519 Jan 2016
125kidsfirstconnect.comeNom, Inc.20 Jun 202421 Jun 202520 Jun 2025
126kidsfirstclinic.comDomainPeople, Inc.29 Jan 201521 Jan 202529 Jan 2029
127kidsfirstpuzzles.comGoDaddy.com, LLC1 Feb 20152 Feb 20251 Feb 2026
128kidsfirstknife.comTurnCommerce, Inc. DBA NameBright.com23 Apr 20203 Jun 202523 Apr 2025
129kidsfirstknife.orgGoDaddy.com, LLC5 Feb 20156 Apr 20155 Feb 2020
130kidsfirstknife.netGoDaddy.com, LLC5 Feb 20155 Feb 20155 Feb 2020
131kidsfirstknife.infoGoDaddy.com, LLC5 Feb 20156 Apr 20155 Feb 2020
132kidsfirstpolicelobby.orgTucows Domains Inc.9 Feb 201413 Feb 20169 Feb 2017
133kidsfirstgolf.comGoDaddy.com, LLC30 Jan 202530 Jan 202530 Jan 2027
134kidsfirstfostercare.comGoDaddy.com, LLC19 Feb 201519 Feb 201519 Feb 2017
135kidsfirstfostercare.orgGoDaddy.com, LLC19 Feb 201519 Feb 201519 Feb 2017
136kidsfirstdaycare2040.comGoDaddy.com, LLC12 Mar 201512 Mar 201512 Mar 2016
137kidsfirstlearning.orgGoDaddy.com, LLC24 Mar 20218 May 202524 Mar 2026
138kidsfirststar.comregister.com, Inc.23 Mar 201525 May 201723 Mar 2018
139kidsfirstglobal.comTurnCommerce, Inc. DBA NameBright.com27 Mar 201521 Mar 202127 Mar 2026
140kidsfirstpediatricdentistry.comGoDaddy.com, LLC31 Mar 20151 Apr 202531 Mar 2026
141kidsfirstinvestment.comGoDaddy.com, LLC8 Apr 20159 Apr 20258 Apr 2026
142kidsfirstwellness.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2017
143kidsfirstot.comGoogle, Inc.12 Mar 202025 Feb 202512 Mar 2026
144kidsfirstpediatricdentist.comGoDaddy.com, LLC20 Apr 201521 Apr 202520 Apr 2026
145kidsfirstkready.comeNom, Inc.29 Aug 201729 Aug 201729 Aug 2018
146kidsfirstwebster.comWild West Domains, LLC1 May 20152 May 20251 May 2026
147kidsfirstresolution.comWild West Domains, LLC6 May 20156 May 20256 May 2026
148kidsfirstech.comeNom, Inc.15 May 201515 May 201515 May 2016
149kidsfirstsports.netNamesilo, LLC3 Sep 20033 Nov 20243 Sep 2026
150kidsfirstafrica.orgGoDaddy.com, LLC15 Dec 202129 Jan 202515 Dec 2025
151kidsfirstafrica.netGoDaddy.com, LLC15 Sep 201515 Sep 201515 Sep 2016
152kidsfirstafrica.infoGoDaddy.com, LLC15 Sep 2015-15 Sep 2016
153kidsfirstafrica.comGoDaddy.com, LLC15 Sep 201516 Sep 202415 Sep 2025
154kidsfirstaba.comGoDaddy.com, LLC12 Jun 201513 Jun 202312 Jun 2026
155kidsfirstaba.orgGoDaddy.com, LLC12 Jun 20159 Jul 202412 Jun 2026
156kidsfirstinternational.comNetwork Solutions, LLC22 Jun 201522 Jun 201522 Jun 2018
157kidsfirstpage.comWild West Domains, LLC5 Jul 20155 Jul 20155 Jul 2016
158kidsfirstallen.comDROPCATCH.COM 756 LLC27 Sep 201628 Sep 201727 Sep 2018
159kidsfirstadventure.comLaunchpad, Inc.29 Jan 202018 Jan 202529 Jan 2026
160kidsfirstallen.orgDomain.com, LLC8 Jul 2015-8 Jul 2016
161kidsfirstallen.netDomain.com, LLC8 Jul 20158 Jul 20158 Jul 2016
162kidsfirstontario.com1&1 Internet AG11 Jul 201512 Jul 201611 Jul 2018
163kidsfirsthome.comregister.com, Inc.2 May 20252 May 20252 May 2026
164kidsfirstfilmfestival.comDropCatch.com 531 LLC27 Sep 201528 Sep 201627 Sep 2017
165kidsfirstthailand.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Jul 201518 Jul 201720 Jul 2018
166kidsfirstmontessori.comGoDaddy.com, LLC20 Jul 201512 Oct 202220 Jul 2025
167kidsfirstproject.orgDomain.com, LLC21 Jul 201527 Jun 202521 Jul 2026
168kidsfirstphone.infoWild West Domains, LLC24 Jul 201524 Jul 201724 Jul 2018
169kidsfirstchoice.netNetwork Solutions, LLC25 Jul 201525 Jun 202425 Jul 2025
170kidsfirstplaythings.comFastDomain Inc.29 Jul 201514 Jul 201729 Jul 2018
171kidsfirstaustralia.comTurnCommerce, Inc. DBA NameBright.com4 Jan 201813 Feb 20254 Jan 2025
172kidsfirstpediatricspecialist.comTucows Domains Inc.27 Jul 201131 Jul 201527 Jul 2016
173kidsfirstms.comWix.com Ltd.17 Aug 202218 Jul 202417 Aug 2026
174kidsfirstms.orgPDR Ltd. d/b/a PublicDomainRegistry.com18 Oct 201629 Nov 201718 Oct 2018
175kidsfirstconflictresolution.comNameCheap, Inc.5 Aug 201525 Jan 20185 Aug 2018
176kidsfirstts.comTucows Domains Inc.6 Aug 201510 Aug 20176 Aug 2017
177kidsfirsttoo.infoGoDaddy.com, LLC13 Oct 201513 Oct 201513 Oct 2016
178kidsfirstcampaign.orgGoDaddy.com, LLC23 Oct 201511 Jul 202423 Oct 2025
179kidsfirstcampaign.comGoDaddy.com, LLC23 Oct 201523 Oct 202323 Oct 2025
180kidsfirstdoll.comFastDomain Inc.2 Nov 201518 Oct 20242 Nov 2025
181kidsfirstslo.comGoDaddy.com, LLC17 Nov 201517 Nov 201517 Nov 2016
182kidsfirstjustice.comNetwork Solutions, LLC19 Nov 201526 Jul 201718 Nov 2017
183kidsfirstjustice.orgNetwork Solutions, LLC19 Nov 201511 Jan 201719 Nov 2017
184kidsfirstkicks.orgGoDaddy.com, LLC22 Nov 201522 Nov 201522 Nov 2016
185kidsfirstkicks.comGoDaddy.com, LLC22 Nov 201522 Nov 201522 Nov 2016
186kidsfirstamerica.ngoName.com, Inc.6 Nov 201520 Oct 20246 Nov 2025
187kidsfirstamerica.ongName.com, Inc.6 Nov 201520 Oct 20246 Nov 2025
188kidsfirstapp.comTucows Domains Inc.29 Nov 20153 Dec 201629 Nov 2016
189kidsfirstfurniture.comeNom, Inc.8 Dec 20158 Dec 20158 Dec 2016
190kidsfirstpediatricdentistry.usGoDaddy.com, LLC16 Dec 201516 Dec 201615 Dec 2017
191kidsfirstblair.orgGoDaddy.com, LLC18 Jun 20082 Aug 202418 Jun 2029
192kidsfirstbiz.comGoDaddy.com, LLC1 Jan 20161 Jan 20241 Jan 2026
193kidsfirstoptimists.orgTucows Domains Inc.28 Dec 20061 Jan 201628 Dec 2016
194kidsfirstdating.comGoDaddy.com, LLC7 Jan 20167 Jan 20167 Jan 2017
195kidsfirstdocs.comGoDaddy.com, LLC8 Apr 200614 Jan 20242 Sep 2025
196kidsfirstservices.comGoogle, Inc.14 Jan 201630 Dec 202414 Jan 2026
197kidsfirstdayschool.comGoDaddy.com, LLC4 Feb 20194 Feb 20194 Feb 2020
198kidsfirstact.orgGoDaddy.com, LLC10 Feb 201610 Feb 201610 Feb 2017
199kidsfirstact.comGoDaddy.com, LLC10 Feb 201610 Feb 201610 Feb 2017
200kidsfirstcoaching.comGoDaddy.com, LLC10 Jun 202411 Jun 202510 Jun 2026
201kidsfirstmarketing.comCronon AG10 Feb 201610 Feb 201610 Feb 2018
202kidsfirstfamilydaycare.comNetwork Solutions, LLC14 Feb 201612 Feb 201714 Feb 2018
203kidsfirstworldproblems.comAscio Technologies, Inc. Danmark - Filial af Ascio…28 Feb 201628 Feb 201628 Feb 2017
204kidsfirstphonics.comTucows Domains Inc.25 Feb 201129 Feb 201625 Feb 2017
205kidsfirstsportscenter.com1&1 Internet AG4 Mar 20164 Mar 20164 Mar 2018
206kidsfirstmediation.infoGoDaddy.com, LLC7 Mar 20167 Mar 20167 Mar 2017
207kidsfirstpediatrics.netTucows Domains Inc.20 Sep 202427 Sep 202420 Sep 2025
208kidsfirstpd.comGoDaddy.com, LLC24 Jul 200824 Nov 202423 Nov 2025
209kidsfirstadoption.comGoDaddy.com, LLC4 Mar 19991 Apr 20244 Mar 2026
210kidsfirstri.orgNameCheap, Inc.25 Jul 202422 Jan 202525 Jul 2025
211kidsfirstbasketball.orgSynergy Wholesale Pty Ltd20 Feb 201214 Apr 201720 Feb 2018
212kidsfirstchicago.orgNetwork Solutions, LLC31 Mar 20165 Mar 202531 Mar 2028
213kidsfirstchicago.netNetwork Solutions, LLC31 Mar 201628 Feb 202531 Mar 2028
214kidsfirstcounseling.comGoDaddy.com, LLC10 Jun 202411 Jun 202510 Jun 2026
215kidsfirstchicago.comNetwork Solutions, LLC31 Mar 201628 Feb 202531 Mar 2031
216kidsfirstreno.orgregister.com, Inc.29 Dec 20102 Jan 202429 Dec 2025
217kidsfirstalberta.infoGoDaddy.com, LLC16 Apr 201616 Apr 201616 Apr 2017
218kidsfirstab.infoGoDaddy.com, LLC16 Apr 201616 Apr 201616 Apr 2017
219kidsfirstalberta.orgGoDaddy.com, LLC16 Apr 201617 Apr 201716 Apr 2018
220kidsfirstalberta.netGoDaddy.com, LLC16 Apr 201616 Apr 201616 Apr 2017
221kidsfirstalberta.comGoDaddy.com, LLC16 Apr 201616 Apr 201616 Apr 2018
222kidsfirstab.orgGoDaddy.com, LLC16 Apr 201617 Apr 201716 Apr 2018
223kidsfirstab.netGoDaddy.com, LLC16 Apr 201616 Apr 201616 Apr 2017
224kidsfirstab.comGoDaddy.com, LLC16 Apr 201616 Apr 201616 Apr 2018
225kidsfirstdentalsc.comGoDaddy.com, LLC4 May 20095 May 20254 May 2026
226kidsfirstoptimistclub.orgNetwork Solutions, LLC21 Apr 201627 Mar 202521 Apr 2026
227kidsfirstacademy.orgWild West Domains, LLC7 Apr 202512 Apr 20257 Apr 2026
228kidsfirstpediatricdentistry.netGoDaddy.com, LLC25 Apr 201626 Apr 202525 Apr 2026
229kidsfirstpediatricdentistry.infoGoDaddy.com, LLC25 Apr 20167 May 202025 Apr 2021
230kidsfirststj.orgGMO Internet Inc.12 Jul 201712 Jul 201712 Jul 2018
231kidsfirsturgentcare.comGoogle, Inc.21 Aug 202221 Oct 202421 Aug 2024
232kidsfirstme.comGoDaddy.com, LLC2 May 20162 May 20162 May 2017
233kidsfirstphone.comGoDaddy.com, LLC14 May 201615 May 202514 May 2026
234kidsfirstparenting.orgregister.com, Inc.20 May 20165 May 201720 May 2018
235kidsfirstnewyork.orgeNom, Inc.19 May 201620 Apr 201719 May 2018
236kidsfirstdental.orgAllworldnames.com LLC22 Sep 202321 Oct 202422 Sep 2025
237kidsfirstri.netGoDaddy.com, LLC24 May 201624 May 201624 May 2017
238kidsfirstri.comTurnCommerce, Inc. DBA NameBright.com11 Aug 201923 Aug 202211 Aug 2025
239kidsfirstedu.comGoDaddy.com, LLC6 Nov 20238 Nov 20246 Nov 2025
240kidsfirstscholarships.comWild West Domains, LLC1 Jun 20161 Jun 20161 Jun 2017
241kidsfirstped.comGoDaddy.com, LLC21 Jan 200322 Jan 202521 Jan 2026
242kidsfirstsports.comNetwork Solutions, LLC20 Apr 199919 Feb 202220 Apr 2027
243kidsfirstedu.orgeNom, Inc.9 Jun 20162 Jun 20259 Jun 2026
244kidsfirstdiscoveryspace.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Jun 201623 Jun 201720 Jun 2018
245kidsfirst-english.comNetwork Solutions, LLC21 Jun 20167 Jun 202421 Jun 2026
246kidsfirstpediatricclinic.infoGoDaddy.com, LLC22 Jun 201622 Jun 201622 Jun 2017
247kidsfirstedu.us-29 Jun 201629 Jun 201628 Jun 2017
248kidsfirstpublications.comGoDaddy.com, LLC29 Jun 201630 Jun 202529 Jun 2026
249kidsfirsthealthcare.orgGoDaddy.com, LLC19 Dec 20132 Feb 202519 Dec 2025
250kidsfirstauction.comNameCheap, Inc.5 May 200617 Jul 20235 May 2023
251kidsfirstofstuart.comregister.com, Inc.12 Apr 200612 Apr 200612 Apr 2018
252kidsfirstpediatricsga.orgeNom, Inc.6 Jul 201615 Jun 20176 Jul 2020
253kidsfirstpediatrics.orgeNom, Inc.6 Jul 201615 Jun 20176 Jul 2020
254kidsfirstpediatric.neteNom, Inc.6 Jul 201615 Jun 20176 Jul 2020
255kidsfirstpediatrics.videoeNom, Inc.6 Jul 201620 Jun 20176 Jul 2020
256kidsfirstacademyinc.comSquarespace Domains LLC27 Jul 20113 Mar 202527 Jul 2026
257kidsfirsttoday.bizGoDaddy.com, LLC19 Jul 201330 Jul 201718 Jul 2017
258kidsfirstinc.bizFastDomain Inc.23 Apr 201323 Apr 201622 Apr 2017
259kidsfirstsports.bizNetwork Solutions, LLC10 Sep 20139 Sep 20169 Sep 2017
260kidsfirstdoctors.bizGoDaddy.com, LLC18 Mar 201314 Aug 201617 Mar 2017
261kidsfirstraleigh.bizGoDaddy.com, LLC18 Mar 201314 Aug 201617 Mar 2017
262kidsfirstchoicetransportation.comGoDaddy.com, LLC19 Jul 201619 Jul 201619 Jul 2019
263kidsfirsttc.comGoDaddy.com, LLC29 Jul 201630 Jul 202429 Jul 2026
264kidsfirsttherapy.netTucows Domains Inc.4 Aug 20168 Aug 20184 Aug 2018
265kidsfirstswim.comGoDaddy.com, LLC21 Mar 202331 Jan 202521 Mar 2026
266kidsfirstvending.com-15 Aug 201615 Aug 201615 Aug 2017
267kidsfirstcar.comTucows Domains Inc.20 Aug 201624 Aug 201720 Aug 2017
268kidsfirstchallenge.comGoDaddy.com, LLC25 Aug 201625 Aug 201625 Aug 2017
269kidsfirstabudhabi.comGoDaddy.com, LLC7 Jan 20227 Jan 20227 Jan 2023
270kidsfirstpreschool.comWild West Domains, LLC1 Sep 20162 Aug 20241 Sep 2025
271kidsfirstclub.netHostinger, UAB24 Jan 202526 Mar 202524 Jan 2026
272kidsfirstclub.orgGoDaddy.com, LLC30 Oct 20244 Nov 202430 Oct 2025
273kidsfirstclub.comTurnCommerce, Inc. DBA NameBright.com19 Nov 201813 Nov 202019 Nov 2025
274kidsfirstmedia.comGoDaddy.com, LLC3 Nov 20204 Nov 20243 Nov 2025
275kidsfirstpediatricpartners.comNetwork Solutions, LLC16 Oct 200818 Oct 202416 Oct 2029
276kidsfirstwebpage.comTucows Domains Inc.28 Oct 200229 Apr 202528 Oct 2025
277kidsfirstofthecarolinas.comGoDaddy.com, LLC9 Dec 200410 Dec 20239 Dec 2025
278kidsfirstgames.comGoDaddy.com, LLC5 Feb 20126 Feb 20255 Feb 2026
279kidsfirstpediatricsmilledgeville.comGoDaddy.com, LLC28 Oct 201029 Oct 201428 Oct 2016
280kidsfirstbookaboutsex.comGoDaddy.com, LLC6 May 20106 May 20106 May 2020
281kidsfirsttherapy.comTurnCommerce, Inc. DBA NameBright.com20 Aug 202026 May 202320 Aug 2025
282kidsfirstindiana.comRealtime Register B.V.23 May 202424 May 202523 May 2026
283kidsfirstregina.com1API GmbH25 Feb 201125 Feb 202525 Feb 2026
284kidsfirstpeds.comGoDaddy.com, LLC23 Nov 201823 Feb 202423 Nov 2031
285kidsfirstbed.comGKG.NET, INC.13 Dec 20064 Nov 201513 Dec 2016
286kidsfirstdentalcare.comGoDaddy.com, LLC2 May 200513 Nov 20242 Oct 2025
287kidsfirst-nc.comGoDaddy.com, LLC20 Nov 201221 Oct 202420 Nov 2025
288kidsfirstlaw.comGoDaddy.com, LLC4 Jan 202217 Mar 20244 Jan 2024
289kidsfirststafford.comGoDaddy.com, LLC13 Apr 201314 Apr 202313 Apr 2028
290kidsfirstpa.comBeijing Lanhai Jiye Technology Co., Ltd13 Aug 202222 Apr 202513 Aug 2025
291kidsfirst01.comeNom, Inc.16 Aug 201018 Jul 202416 Aug 2025
292kidsfirstbc.comGoDaddy.com, LLC17 Apr 201417 Apr 201417 Apr 2019
293kidsfirstcouponbook.comGoDaddy.com, LLC11 Jul 201211 Sep 202211 Jul 2032
294kidsfirstart.comGoDaddy.com, LLC5 Jan 201330 Apr 20155 Jan 2017
295kidsfirstcenter.comTurnCommerce, Inc. DBA NameBright.com17 Jun 200815 Jan 202017 Jun 2025
296kidsfirstnow.comGoDaddy.com, LLC25 Oct 200825 Oct 202325 Oct 2025
297kidsfirstfamilyplan.com-3 May 20235 Jul 20243 May 2024
298kidsfirstyoga.comGoDaddy.com, LLC24 Sep 20124 Oct 201324 Sep 2018
299kidsfirstalways.comTurnCommerce, Inc. DBA NameBright.com5 Jul 201329 Jun 20215 Jul 2025
300kidsfirstbanking.comGoDaddy.com, LLC24 Apr 201325 Apr 202524 Apr 2026
301kidsfirstbooks.comregister.com, Inc.22 Nov 200224 Oct 201722 Nov 2017
302kidsfirstabq.comGoDaddy.com, LLC30 Aug 20134 Sep 202430 Aug 2029
303kidsfirstaid.comGoDaddy.com, LLC29 Aug 20033 Jul 202429 Aug 2025
304kidsfirstinsurance.comTurnCommerce, Inc. DBA NameBright.com4 Sep 201714 Oct 20244 Sep 2024
305kidsfirsttoys.comHiChina Zhicheng Technology Limited26 Jun 200218 Mar 202526 Jun 2026
306kidsfirstannarbor.comDropCatch.com 1129 LLC19 Mar 201720 Mar 201719 Mar 2018
307kidsfirstgroup.comGoDaddy.com, LLC22 Aug 201119 Aug 202422 Aug 2029
308kidsfirstuganda.comTucows Domains Inc.9 Jan 202420 Dec 20249 Jan 2027
309kidsfirstfish.comGoDaddy.com, LLC16 Mar 200627 Apr 202516 Mar 2025
310kidsfirstsolution.comGoDaddy.com, LLC6 Mar 20136 Mar 20166 Mar 2017
311kidsfirstofflorida.comTucows Domains Inc.7 Oct 200817 Jul 20247 Oct 2027
312kidsfirstfoundation.comTurnCommerce, Inc. DBA NameBright.com14 Aug 20178 Aug 202014 Aug 2025
313kidsfirstchiropractic.comBeijing Lanhai Jiye Technology Co., Ltd25 Jul 202226 Aug 202425 Jul 2024
314kidsfirstpedsnc.comGoDaddy.com, LLC5 Aug 201929 Oct 20225 Aug 2029
315kidsfirststeps.comGoDaddy.com, LLC15 Feb 20084 Feb 202515 Feb 2026
316kidsfirstfinancial.comGoDaddy.com, LLC27 Oct 201125 Oct 202427 Oct 2025
317kidsfirstma.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Jun 202222 Aug 202310 Jun 2023
318kidsfirst123.comCloudFlare, Inc.6 Sep 201222 Feb 20256 Sep 2026
319kidsfirstpediatric.comTurnCommerce, Inc. DBA NameBright.com16 Dec 201225 Jan 202516 Dec 2024
320kidsfirstsmile.comFastDomain Inc.13 Jun 201229 Apr 202513 Jun 2026
321kidsfirstpediatrics.comNetwork Solutions, LLC20 May 199921 Mar 202220 May 2027
322kidsfirstlearningct.comTucows Domains Inc.20 Nov 201324 Nov 202320 Nov 2024
323kidsfirstokc.comWeb Commerce Communications Limited dba WebNic.cc15 Sep 202225 Oct 202315 Sep 2023
324kidsfirstva.comGoDaddy.com, LLC13 Apr 201314 Apr 202313 Apr 2033
325kidsfirstnanny.comTucows Domains Inc.13 Feb 200824 Sep 201713 Feb 2018
326kidsfirstsoccer.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Nov 199918 Nov 202418 Nov 2025
327kidsfirstdent.comDomainSite, Inc.3 Dec 200629 Jan 20163 Dec 2025
328kidsfirstconsulting.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Apr 202425 May 202513 Apr 2025
329kidsfirstbusiness.comGoDaddy.com, LLC22 Dec 201322 Dec 202422 Dec 2025
330kidsfirstadvocacy.comGoDaddy.com, LLC28 Mar 20139 May 202428 Mar 2024
331kidsfirstblair.comGoDaddy.com, LLC18 Jun 200818 Jun 202418 Jun 2029
332kidsfirstmassachusetts.comGoDaddy.com, LLC4 Mar 201418 Feb 20154 Mar 2017
333kidsfirstcoalition.comGoDaddy.com, LLC27 Jul 20238 Oct 202427 Jul 2024
334kidsfirsthaircut.comTucows Domains Inc.17 Feb 201421 Feb 201717 Feb 2017
335kidsfirstdentalsouthcarolina.comGoDaddy.com, LLC25 Mar 201426 Mar 202525 Mar 2026
336kidsfirstlawrence.comregister.com, Inc.26 Sep 201311 Sep 201626 Sep 2018
337kidsfirstpet.comFastDomain Inc.16 Aug 200928 Sep 202416 Aug 2024
338kidsfirstbehavioralconsulting.comeNom, Inc.18 May 201018 May 201718 May 2018
339kidsfirstbraces.comGoDaddy.com, LLC28 Feb 201429 Feb 202428 Feb 2026
340kidsfirstsavings.comNetwork Solutions, LLC8 Nov 20029 Sep 20248 Nov 2025
341kidsfirstdiabetessecond.comDreamHost, LLC26 Dec 201110 Mar 202526 Dec 2024
342kidsfirstkar.comFastDomain Inc.13 May 201213 May 201613 May 2017
343kidsfirstonline.comTucows Domains Inc.27 Aug 200629 Jul 201727 Aug 2018
344kidsfirstchoice.comTurnCommerce, Inc. DBA NameBright.com6 Mar 200520 Aug 20216 Mar 2026
345kidsfirsttutoring.comGoDaddy.com, LLC31 Jan 20137 Feb 202431 Jan 2026
346kidsfirstchiro.comGoDaddy.com, LLC2 Sep 201112 Oct 20112 Sep 2016
347kidsfirstlearningcenters.comGoDaddy.com, LLC18 Feb 200919 Feb 202518 Feb 2026
348kidsfirsttopeka.comGoDaddy.com, LLC5 Nov 20136 Nov 20235 Nov 2025
349kidsfirstcare.com1&1 Internet AG10 Oct 201313 Mar 201810 Oct 2025
350kidsfirstpedsraeford.comGoDaddy.com, LLC9 Sep 20109 Sep 20249 Sep 2026
351kidsfirststep.comCosmotown, Inc.2 Apr 202313 May 20242 Apr 2024
352kidsfirstint.comGoDaddy.com, LLC12 May 201412 May 202512 May 2026
353kidsfirstraleigh.comGoDaddy.com, LLC18 Mar 201313 Mar 202318 Mar 2028
354kidsfirstdentist.comTucows Domains Inc.14 Jul 200815 Jun 202414 Jul 2025
355kidsfirstinitiative.comGoDaddy.com, LLC7 Apr 20248 Apr 20257 Apr 2026
356kidsfirstfranchisecompany.comNetwork Solutions, LLC6 Jan 20107 Nov 20236 Jan 2027
357kidsfirstmilford.com1&1 Internet AG29 Jul 201013 Mar 201829 Jul 2025
358kidsfirstparentssecond.comNetwork Solutions, LLC10 Feb 20145 Mar 201710 Feb 2018
359kidsfirstebc.comFastDomain Inc.21 Apr 20148 Jun 201721 Apr 2018
360kidsfirstswimming.comBeijing Lanhai Jiye Technology Co., Ltd25 Mar 202429 Mar 202525 Mar 2026
361kidsfirstdivorce.comGoDaddy.com, LLC13 Dec 202114 Dec 202413 Dec 2027
362kidsfirstrgmd.comGoDaddy.com, LLC27 Jun 201128 Jun 202327 Jun 2028
363kidsfirstedmond.comGoDaddy.com, LLC15 Jul 201316 Jul 201615 Jul 2017
364kidsfirstnc.comGoogle, Inc.9 Aug 202325 Jul 20249 Aug 2025
365kidsfirstseattle.comGoogle, Inc.24 Jan 20146 Jan 201724 Jan 2018
366kidsfirstlearningplace.comDropCatch.com 655 LLC6 Apr 202317 Jun 20246 Apr 2024
367kidsfirstdentistry.comGoDaddy.com, LLC12 Jan 200630 Dec 202412 Jan 2026
368kidsfirstinc.comTurnCommerce, Inc. DBA NameBright.com1 Mar 201115 Apr 20201 Mar 2026
369kidsfirstdaycareinc.comregister.com, Inc.24 Apr 200925 Apr 202524 Apr 2026
370kidsfirsteducation.comTurnCommerce, Inc. DBA NameBright.com28 Feb 20109 Apr 202528 Feb 2026
371kidsfirsttoday.comGoDaddy.com, LLC1 Feb 20102 Feb 20241 Feb 2026
372kidsfirstatsunsetview.comGoDaddy.com, LLC14 May 201013 Feb 201514 May 2020
373kidsfirstpreschooltucson.comGoDaddy.com, LLC11 Feb 20137 Feb 202511 Feb 2026
374kidsfirstinconline.comGoDaddy.com, LLC19 Nov 20087 Mar 201119 Nov 2020
375kidsfirstdeclaration.comTPP Wholesale Pty Ltd.18 Jun 201423 Mar 201718 Jun 2019
376kidsfirstbooster.comTucows Domains Inc.25 Sep 202425 Sep 202425 Sep 2025
377kidsfirst-preschool.comPorkbun, LLC31 May 202531 May 202531 May 2026
378kidsfirstmass.comGoDaddy.com, LLC4 Mar 201418 Feb 20154 Mar 2017
379kidsfirstyears.comAmazon Registrar, Inc.1 Apr 201025 Feb 20251 Apr 2026
380kidsfirst-usa.comregister.com, Inc.17 Dec 200529 Apr 202017 Dec 2025
381kidsfirsthoboken.comAdvanced Internet Technologies, Inc. (AIT)11 Mar 201112 Mar 202511 Mar 2026
382kidsfirstbasketballinc.comTucows Domains Inc.28 May 20111 Jun 202528 May 2026
383kidsfirstga.comGoDaddy.com, LLC21 Jan 200923 Jan 202521 Jan 2027
384kidsfirsttv.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Dec 200914 Dec 201519 Dec 2017
385kidsfirstweeones.comBeijing Lanhai Jiye Technology Co., Ltd11 Oct 202320 Apr 202511 Oct 2025
386kidsfirstspringfield.comNetwork Solutions, LLC23 Jan 201323 Jan 202423 Jan 2027
387kidsfirstphoto.comGoDaddy.com, LLC8 Jun 201418 Apr 20168 Jun 2017
388kidsfirstbank.comGoDaddy.com, LLC28 Apr 201028 Apr 202428 Apr 2027
389kidsfirstlv.comeNom, Inc.27 Apr 20111 Apr 202527 Apr 2026
390kidsfirstpediatriccare.comGoDaddy.com, LLC18 Nov 200712 Nov 201518 Nov 2018
391kidsfirstpublishing.comGoDaddy.com, LLC5 Jun 20146 Apr 20165 Jun 2018
392kidsfirstmedicine.comTucows Domains Inc.2 Jul 200919 Jun 20252 Jul 2026
393kidsfirstdentalgroup.comNetwork Solutions, LLC14 Jun 201315 May 202514 Jun 2027
394kidsfirstdaynurseries.comTucows Domains Inc.29 Apr 20033 May 201729 Apr 2017
395kidsfirstdental.comGoDaddy.com, LLC3 Mar 20084 Mar 20243 Mar 2026
396kidsfirststore.comMisk.com, Inc.25 Jan 201523 May 202525 Jan 2026
397kidsfirstnews.comWeb Commerce Communications Limited dba WebNic.cc24 Dec 201018 May 201524 Dec 2019
398kidsfirstjob.comGMO Internet Inc.24 Jan 20236 Apr 202424 Jan 2024
399kidsfirstids.comGoDaddy.com, LLC11 Sep 201011 Sep 201511 Sep 2016
400kidsfirstfl.comGoDaddy.com, LLC13 Aug 201214 Aug 201413 Aug 2016
401kidsfirstdentalfederalway.comTucows Domains Inc.23 Jul 201427 Jul 202123 Jul 2021
402kidsfirstframes.comDomain.com, LLC10 Jan 201426 Dec 201510 Jan 2017
403kidsfirsttennessee.comeNom, Inc.14 Jul 201115 May 202514 Jul 2026
404kidsfirstfcc.comKey-Systems GmbH4 Apr 20235 Apr 20234 Apr 2025
405kidsfirstwords.comTurnCommerce, Inc. DBA NameBright.com22 Mar 202123 Apr 202422 Mar 2024
406kidsfirstcoupon.comGoDaddy.com, LLC23 Jul 201324 Jul 201523 Jul 2017
407kidsfirstcreative.comMetaregistrar BV Applications7 Feb 202511 Apr 20257 Feb 2026
408kidsfirstword.comCrazy Domains FZ-LLC13 Nov 201124 Nov 201813 Nov 2018
409kidsfirst-ga.comGoDaddy.com, LLC29 Jul 19993 Sep 202229 Jul 2029
410kidsfirsttn.comeNom, Inc.14 Jul 201115 May 202514 Jul 2026
411kidsfirstchildcare.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Apr 200012 Jun 201811 Apr 2028
412kidsfirstfund.comTurnCommerce, Inc. DBA NameBright.com20 Dec 201714 Dec 202020 Dec 2025
413kidsfirstuniversity.comGoDaddy.com, LLC15 Jun 201327 Aug 202415 Jun 2024
414kidsfirstdds.comGoDaddy.com, LLC27 Dec 200721 Jun 202320 Jun 2028
415kidsfirstu.comGoDaddy.com, LLC15 Jun 201316 Jun 201615 Jun 2017
416kidsfirstsvsmo.comTucows Domains Inc.19 Oct 200719 Sep 201719 Oct 2018
417kidsfirstmaryland.comeNom, Inc.22 Jan 20074 Jan 201622 Jan 2017
418kidsfirstparentadvocacy.comGoDaddy.com, LLC21 May 201322 May 202521 May 2027
419kidsfirstenfield.comNameSecure L.L.C.14 Dec 200822 Mar 201714 Dec 2017
420kidsfirst2.com1&1 Internet AG29 Jul 201013 Mar 201829 Jul 2025
421kidsfirstnj.comGoDaddy.com, LLC21 Apr 201022 Apr 202421 Apr 2026
422kidsfirstpenasco.comGoDaddy.com, LLC30 Jul 201331 Jul 201630 Jul 2017
423kidsfirstdentalandbraces.comGoDaddy.com, LLC28 Feb 201429 Feb 202428 Feb 2026
424kidsfirst-pediatrics.comCatalog.com1 Mar 200628 Feb 20171 Mar 2018
425kidsfirstchoicepress.comMarkMonitor Inc.30 Aug 20082 Aug 202430 Aug 2025
426kidsfirsttherapyservices.comGoDaddy.com, LLC10 Aug 20089 Aug 202410 Aug 2025
427kidsfirstvacations.comAmazon Registrar, Inc.17 Jun 201316 May 202517 Jun 2026
428kidsfirstpower.comGoDaddy.com, LLC20 Jul 201320 Jul 202420 Jul 2025
429kidsfirstinternet.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Mar 202121 Mar 202121 Mar 2022
430kidsfirstminnesota.comGoDaddy.com, LLC4 May 20115 May 20254 May 2027
431kidsfirstspkn.comTucows Domains Inc.17 Feb 201115 Feb 202517 Feb 2026
432kidsfirstcpr.comNetwork Solutions, LLC27 Mar 201425 Feb 202527 Mar 2026
433kidsfirstllc.com-19 Mar 202320 Apr 202419 Mar 2024
434kidsfirstcommunity.comGoDaddy.com, LLC9 Jul 201310 Jul 20249 Jul 2025
435kidsfirsttoo.com1&1 Internet AG29 Jul 201013 Mar 201829 Jul 2025
436kidsfirstafterdivorce.comNameCheap, Inc.28 Oct 2020-28 Oct 2021
437kidsfirstok.comOVH sas7 Jun 202415 Jun 20257 Jun 2026
438kidsfirstapps.comGoDaddy.com, LLC5 Feb 20126 Feb 20255 Feb 2026
439kidsfirstjonesboro.comGoDaddy.com, LLC13 Feb 201014 Feb 201613 Feb 2017
440kidsfirstdoctors.comTurnCommerce, Inc. DBA NameBright.com5 Jun 201713 Feb 20255 Jun 2025
441kidsfirstcac.comTurnCommerce, Inc. DBA NameBright.com1 Jul 20172 Aug 20241 Jul 2024
442kidsfirsthawaii.comGoDaddy.com, LLC30 Dec 200718 Oct 202230 Dec 2025
443kidsfirstchristian.comNameSecure L.L.C.7 May 20075 May 20167 May 2017
444kidsfirstenglish.comPDR Ltd. d/b/a PublicDomainRegistry.com4 May 20119 Apr 20254 May 2026
445kidsfirstbedrooms.comGoDaddy.com, LLC12 Nov 200813 Nov 201412 Nov 2016
446kidsfirstnorth.com1API GmbH7 May 20137 May 20247 May 2026
447kidsfirsttransportation.comWild West Domains, LLC25 Aug 201426 Aug 201625 Aug 2017
448kidsfirst-education.comGoDaddy.com, LLC6 Apr 20126 Apr 20166 Apr 2019
449kidsfirsttexas.comGransy s.r.o. d/b/a subreg.cz7 Jan 201830 Dec 20247 Jan 2026
450kidsfirsttriage.comeNom, Inc.21 Jan 201123 Dec 201621 Jan 2018
451kidsfirstpediatricsga.comTLDs LLC dba SRSplus22 Jan 200914 Jan 202522 Jan 2026
452kidsfirstfishing.com-6 Dec 20246 Apr 20256 Dec 2025
453kidsfirstcoupons.comHongkong Domain Name Information Management Co., L…10 Nov 202113 Nov 202210 Nov 2022
454kidsfirstmediation.comGoDaddy.com, LLC9 Apr 20259 Apr 20259 Apr 2026
455kidsfirstmc.comFastDomain Inc.5 Dec 201020 Nov 20245 Dec 2025
456kidsfirstsite.comeNom, Inc.26 Feb 201228 Jan 201726 Feb 2018
457kidsfirst-peds.comCloudFlare, Inc.12 Sep 201613 Aug 202412 Sep 2025
458kidsfirsthomecare.com-12 Sep 201612 Sep 201612 Sep 2017
459kidsfirsttutoringcenter.com-20 Sep 201620 Sep 201620 Sep 2017
460kidsfirstlifeinsurancecom.com-25 Sep 201625 Sep 201625 Sep 2018
461kidsfirstsports.xyzNameCheap, Inc.26 Sep 20161 Oct 201626 Sep 2017
462kidsfirstcomm.orgNetwork Solutions, LLC5 Oct 20167 Jun 20245 Oct 2025
463kidsfirstppf.orgGoDaddy.com, LLC6 Oct 201617 Nov 20176 Oct 2018
464kidsfirstmassachusetts.infoGoDaddy.com, LLC4 Mar 201418 Feb 20154 Mar 2017
465kidsfirsttoday.infoGoDaddy.com, LLC19 Jul 20132 Sep 202419 Jul 2025
466kidsfirstdoctors.infoGoDaddy.com, LLC18 Mar 201318 Jan 201618 Mar 2017
467kidsfirstint.infoGoDaddy.com, LLC12 May 201413 May 202512 May 2026
468kidsfirstma.infoGoDaddy.com, LLC4 Mar 201418 Feb 20154 Mar 2017
469kidsfirstseattle.infoGoogle, Inc.24 Jan 201410 Mar 201724 Jan 2018
470kidsfirstllc.infoTucows Domains Inc.3 May 201013 Jun 20233 May 2023
471kidsfirstannarbor.infoGoDaddy.com, LLC30 Dec 201331 Dec 201530 Dec 2016
472kidsfirstadvocacy.infoGoDaddy.com, LLC28 Mar 20139 May 202428 Mar 2024
473kidsfirstmass.infoGoDaddy.com, LLC4 Mar 201418 Feb 20154 Mar 2017
474kidsfirstlearning.infoGoDaddy.com, LLC9 Apr 201424 May 20259 Apr 2026
475kidsfirstraleigh.infoGoDaddy.com, LLC18 Mar 201318 Jan 201618 Mar 2017
476kidsfirst-ev.infoDeutsche Telekom AG11 Jun 201124 Dec 202311 Jun 2024
477kidsfirstraleigh.mobiGoDaddy.com, LLC18 Mar 201318 Jan 201618 Mar 2017
478kidsfirstdoctors.mobiGoDaddy.com, LLC18 Mar 201318 Jan 201618 Mar 2017
479kidsfirstnow.netGoDaddy.com, LLC12 Oct 201617 Oct 202312 Oct 2025
480kidsfirststeps.netFastDomain Inc.31 Aug 20133 Oct 201631 Aug 2016
481kidsfirstraleigh.netGoDaddy.com, LLC18 Mar 201319 Mar 201518 Mar 2017
482kidsfirstmedia.netGoDaddy.com, LLC28 May 201329 May 202328 May 2028
483kidsfirstpeds.netGoDaddy.com, LLC8 Apr 20063 Sep 20222 Sep 2025
484kidsfirstvacations.netAmazon Registrar, Inc.17 Jun 201318 Jun 202517 Jun 2025
485kidsfirstky.netTucows Domains Inc.24 Jun 202428 Jun 202524 Jun 2026
486kidsfirstmaryland.neteNom, Inc.22 Jan 20074 Jan 201622 Jan 2017
487kidsfirstdoctors.netGoDaddy.com, LLC18 Mar 20131 May 201518 Mar 2017
488kidsfirstinsurance.netNetwork Solutions, LLC16 Jun 20066 May 201616 Jun 2017
489kidsfirstinc.netNetwork Solutions, LLC25 Mar 20088 Feb 202525 Mar 2028
490kidsfirstminnesota.netGoDaddy.com, LLC4 May 20115 May 20254 May 2027
491kidsfirstdental.netGoDaddy.com, LLC6 May 20097 May 20256 May 2026
492kidsfirsttoday.netGoDaddy.com, LLC19 Jul 201320 Jul 202419 Jul 2025
493kidsfirstcac.netGoDaddy.com, LLC13 Apr 200412 Feb 201513 Apr 2017
494kidsfirsttexas.netGoDaddy.com, LLC17 Oct 201118 Oct 202417 Oct 2025
495kidsfirstsavings.netNetwork Solutions, LLC8 Nov 20029 Sep 20248 Nov 2025
496kidsfirstannarbor.netGoDaddy.com, LLC30 Dec 201331 Dec 201530 Dec 2016
497kidsfirstma.netGoDaddy.com, LLC4 Mar 201418 Feb 20154 Mar 2017
498kidsfirstdocs.netGoDaddy.com, LLC8 Apr 20063 Sep 20222 Sep 2025
499kidsfirstlearningcenters.netGoDaddy.com, LLC18 Feb 200919 Feb 202518 Feb 2026
500kidsfirstadvocacy.netGoDaddy.com, LLC28 Mar 201329 Mar 202428 Mar 2025
501kidsfirstblair.netGoDaddy.com, LLC18 Jun 200818 Jun 202418 Jun 2029
502kidsfirsttherapyservices.netGoDaddy.com, LLC10 Aug 200822 Oct 202410 Aug 2024
503kidsfirstlearning.netGoDaddy.com, LLC18 Feb 200919 Feb 202518 Feb 2026
504kidsfirstga.netGoDaddy.com, LLC30 Jan 201417 Aug 201630 Jan 2019
505kidsfirstwords.netGoDaddy.com, LLC15 Oct 200920 Oct 202315 Oct 2025
506kidsfirstseattle.netGoogle, Inc.24 Jan 20146 Jan 201724 Jan 2018
507kidsfirstcommunity.netGoDaddy.com, LLC9 Jul 201310 Jul 20249 Jul 2025
508kidsfirstbanking.netGoDaddy.com, LLC24 Apr 201325 Apr 202524 Apr 2026
509kidsfirstabq.netGoDaddy.com, LLC30 Aug 20135 Sep 202430 Aug 2025
510kidsfirstmass.netGoDaddy.com, LLC4 Mar 201418 Feb 20154 Mar 2017
511kidsfirstfund.netGoDaddy.com, LLC2 May 20083 May 20152 May 2017
512kidsfirstint.netGoDaddy.com, LLC12 May 201412 May 202512 May 2026
513kidsfirstmassachusetts.netGoDaddy.com, LLC4 Mar 201418 Feb 20154 Mar 2017
514kidsfirsttake.com-21 Oct 201621 Oct 201621 Oct 2017
515kidsfirstortho.orgTucows Domains Inc.7 Sep 200628 Aug 20247 Sep 2025
516kidsfirstdeclaration.orgTPP Wholesale Pty Ltd.18 Jun 201423 Mar 201718 Jun 2019
517kidsfirstinvestment.orgTucows Domains Inc.18 Dec 200711 Dec 201618 Dec 2017
518kidsfirstmn.orgTucows Domains Inc.5 Dec 202315 Jan 20255 Dec 2024
519kidsfirstcouponbook.orgGoDaddy.com, LLC11 Jul 201210 Sep 201211 Jul 2022
520kidsfirstenterprise.orgGoDaddy.com, LLC24 Jul 20077 Sep 202424 Jul 2025
521kidsfirstmo.orgGoDaddy.com, LLC3 Dec 200917 Jan 20253 Dec 2025
522kidsfirstmaryland.orgeNom, Inc.22 Jan 20074 Jan 201622 Jan 2017
523kidsfirsttherapy.org1&1 Internet AG2 Jul 20145 Oct 20172 Jul 2018
524kidsfirstnm.orgGoDaddy.com, LLC9 Jul 201223 Aug 20249 Jul 2026
525kidsfirstawareness.orgGoDaddy.com, LLC5 Jan 200816 Feb 20255 Jan 2025
526kidsfirstcenter.orgWild West Domains, LLC17 Jun 199912 Feb 202517 Jun 2026
527kidsfirstcecc.orgNetwork Solutions, LLC21 Oct 20096 Jun 201421 Oct 2019
528kidsfirsthawaii.orgGoDaddy.com, LLC30 Dec 200712 Jun 202430 Dec 2025
529kidsfirstraleigh.orgGoDaddy.com, LLC18 Mar 201318 Jan 201618 Mar 2017
530kidsfirstcanada.orgAutomattic Inc.14 Jul 200429 Jun 202514 Jul 2026
531kidsfirstabq.orgGoDaddy.com, LLC30 Aug 201314 Oct 202430 Aug 2025
532kidsfirstky.orgGoDaddy.com, LLC13 Apr 201324 Jun 202513 Apr 2025
533kidsfirsttennessee.orgeNom, Inc.14 Jul 201120 May 202514 Jul 2026
534kidsfirstinc.orgGoDaddy.com, LLC19 Nov 200820 Feb 202519 Nov 2030
535kidsfirstinternet.orgBeijing Lanhai Jiye Technology Co., Ltd16 Mar 202415 Jan 202516 Mar 2026
536kidsfirstoc.orgNameCheap, Inc.6 Aug 20221 Jun 20256 Aug 2025
537kidsfirstbooster.orgeNom, Inc.3 Jan 20126 May 20173 Jan 2019
538kidsfirstchildcare.orgGoDaddy.com, LLC6 Apr 200921 May 20256 Apr 2026
539kidsfirstannarbor.orgGoDaddy.com, LLC30 Dec 201331 Dec 201530 Dec 2017
540kidsfirst-mt.orgTucows Domains Inc.15 Oct 200719 Oct 201715 Oct 2018
541kidsfirstpolicy.orgTucows Domains Inc.18 Dec 200711 Dec 201618 Dec 2017
542kidsfirstfund.orgNameCheap, Inc.17 Nov 199911 Nov 202417 Nov 2025
543kidsfirstfilmfestival.orgDeluxe Small Business Sales, Inc. d/b/a Aplus.net9 Jul 200322 Jan 20259 Jul 2025
544kidsfirstint.orgGoDaddy.com, LLC12 May 201413 May 202512 May 2026
545kidsfirstcac.orgGoDaddy.com, LLC13 Apr 200412 Feb 201513 Apr 2017
546kidsfirsttoday.orgGoDaddy.com, LLC19 Jul 20132 Sep 202419 Jul 2025
547kidsfirstsoccer.orgTucows Domains Inc.24 Sep 200717 Sep 201724 Sep 2018
548kidsfirstminnesota.orgGoDaddy.com, LLC4 May 201110 May 20254 May 2027
549kidsfirstparentssecond.orgNameCheap, Inc.29 Jun 20229 Sep 202329 Jun 2023
550kidsfirstpledge.orgGoDaddy.com, LLC12 Jan 201226 Feb 202512 Jan 2026
551kidsfirstcast.orgGoDaddy.com, LLC23 Feb 20129 Apr 202523 Feb 2030
552kidsfirstef.orgeNom, Inc.2 Aug 20132 May 20252 Aug 2025
553kidsfirstpenasco.orgGoDaddy.com, LLC30 Jul 201323 Oct 201730 Jul 2018
554kidsfirsttrust.orgAnnulet LLC28 Jun 201429 Aug 201728 Jun 2018
555kidsfirstassociation.orgGoDaddy.com, LLC1 Jul 20118 Jul 20251 Jul 2026
556kidsfirstatsunsetview.orgGoDaddy.com, LLC14 May 201013 Feb 201514 May 2020
557kidsfirstmass.orgGoDaddy.com, LLC4 Mar 201415 Apr 20244 Mar 2024
558kidsfirstmariposa.orgNameCheap, Inc.26 Oct 20111 Oct 202426 Oct 2025
559kidsfirstawarenesscenter.orgGoDaddy.com, LLC1 Nov 201012 Jan 20251 Nov 2024
560kidsfirsttherapyservices.orgGoDaddy.com, LLC10 Aug 200821 Sep 202410 Aug 2024
561kidsfirsttexas.orgGoDaddy.com, LLC17 Oct 20111 Dec 202417 Oct 2025
562kidsfirstnow.orgGoDaddy.com, LLC25 Oct 200814 Jun 202425 Oct 2025
563kidsfirstofthecarolinas.orgGoDaddy.com, LLC15 Oct 200714 Jun 202415 Oct 2025
564kidsfirst-foundation.orgGoDaddy.com, LLC22 Jun 20065 Sep 202422 Jun 2027
565kidsfirstfundracine.orgGoDaddy.com, LLC5 Feb 20136 Feb 20175 Feb 2019
566kidsfirstmassachusetts.orgGoDaddy.com, LLC4 Mar 20146 Mar 20174 Mar 2018
567kidsfirstenfield.orgGoDaddy.com, LLC2 Jun 201422 Jun 20152 Jun 2019
568kidsfirstofflorida.orgTucows Domains Inc.7 Oct 200822 Jul 20247 Oct 2027
569kidsfirstadoption.orgGoDaddy.com, LLC19 Jan 20065 Sep 202419 Jan 2026
570kidsfirstdoctors.orgGoDaddy.com, LLC18 Mar 201318 Jan 201618 Mar 2017
571kidsfirstvietnam.orgNetwork Solutions, LLC25 Oct 20007 Dec 201725 Oct 2018
572kidsfirstoakland.orgeNom, Inc.9 Jan 20013 Jan 20229 Jan 2031
573kidsfirsttn.orgeNom, Inc.14 Jul 201120 May 202514 Jul 2026
574kidsfirstinitiative.orgNetwork Solutions, LLC31 Jan 20136 Jan 202531 Jan 2028
575kidsfirstiowa.org1&1 Internet AG11 Feb 200514 Feb 202511 Feb 2026
576kidsfirst-ic.orgFastDomain Inc.16 Dec 20095 Dec 202416 Dec 2025
577kidsfirstma.orgGoDaddy.com, LLC4 Mar 20146 Mar 20174 Mar 2018
578kidsfirstfoundation.orgGoDaddy.com, LLC12 Mar 200226 Apr 202512 Mar 2026
579kidsfirstusa.orgGoDaddy.com, LLC15 Feb 202516 Mar 202515 Feb 2026
580kidsfirstent.orgGoDaddy.com, LLC24 Jul 20077 Sep 202424 Jul 2025
581kidsfirstseattle.orgGoogle, Inc.24 Jan 20144 Jan 201824 Jan 2019
582kidsfirstagenda.orgGoogle, Inc.23 Oct 20247 Nov 202423 Oct 2025
583kidsfirstdaycare.orgeNom, Inc.11 Dec 200820 Nov 202211 Dec 2031
584kidsfirstthenpets.orgNetwork Solutions, LLC1 Apr 20113 Apr 20161 Apr 2017
585kidsfirstlearningcenter.orgGoDaddy.com, LLC14 Mar 201328 Apr 202514 Mar 2026
586kidsfirstadvocacy.orgGoDaddy.com, LLC28 Mar 201328 Mar 202428 Mar 2025
587kidsfirsthhc.comGoDaddy.com, LLC24 Oct 201624 Oct 202424 Oct 2025
588kidsfirstbike.comeNom, Inc.25 Oct 20167 Dec 201725 Oct 2017
589kidsfirstlook.de--13 Jan 2012-
590kidsfirstuae.com-30 Oct 201630 Oct 201630 Oct 2017
591kidsfirstnepal.orgNetwork Solutions, LLC1 Nov 201610 Oct 20241 Nov 2026
592kidsfirstplate.orgNetwork Solutions, LLC12 Nov 201612 Jan 201712 Nov 2018
593kidsfirstfoundationtravel.com1&1 Internet AG15 Nov 201615 Nov 201615 Nov 2017
594kidsfirsttravel.orgGoDaddy.com, LLC15 Sep 202230 Oct 202415 Sep 2025
595kidsfirstfoundationtravel.org1&1 Internet AG16 Nov 201626 Nov 201716 Nov 2018
596kidsfirstsoccer.netGoDaddy.com, LLC1 Dec 20161 Dec 20161 Dec 2017
597kidsfirstsoccerclub.comGoDaddy.com, LLC2 Dec 201612 Feb 20252 Dec 2024
598kidsfirstsoccerclub.orgGoDaddy.com, LLC2 Dec 201614 Dec 20172 Dec 2018
599kidsfirstabc.comGoDaddy.com, LLC8 Dec 20169 Dec 20248 Dec 2026
600kidsfirstlearningacademy.comGoDaddy.com, LLC13 Dec 201613 Dec 201613 Dec 2018
601kidsfirstathletics.comNameCheap, Inc.26 Mar 20243 May 202526 Mar 2026
602kidsfirstpediatrictables.comGoDaddy.com, LLC14 Dec 201614 Dec 201614 Dec 2018
603kidsfirstmuscatine.orgregister.com, Inc.28 Dec 201630 Dec 201728 Dec 2018
604kidsfirstgym.comNameCheap, Inc.6 Jan 20176 Jan 20176 Jan 2018
605kidsfirstutah.comGoDaddy.com, LLC14 Feb 201714 Feb 201714 Feb 2018
606kidsfirstcustody.comGoDaddy.com, LLC10 Aug 201811 Aug 202410 Aug 2025
607kidsfirstlawguard.comGoDaddy.com, LLC27 Feb 201727 Feb 201727 Feb 2018
608kidsfirstdaycareut.comGoDaddy.com, LLC11 Apr 201711 Apr 201711 Apr 2018
609kidsfirstdirectory.infoWest263 International Limited17 Apr 201716 Jun 201717 Apr 2018
610kidsfirstdirectorynew.winChengdu West Dimension Digital Technology Co., Ltd…17 Apr 201722 Apr 201717 Apr 2018
611kidsfirstdirectorynew.infoWest263 International Limited26 Apr 201725 Jun 201726 Apr 2018
612kidsfirstvisitationservicesofindiana.comeNom, Inc.1 May 201717 May 20171 May 2018
613kidsfirstspecialtyplan.comGoDaddy.com, LLC11 May 201712 May 202511 May 2026
614kidsfirstspecialtyplan.infoGoDaddy.com, LLC11 May 201725 Jun 202511 May 2026
615kidsfirstspecialtyplan.netGoDaddy.com, LLC11 May 201712 May 202511 May 2026
616kidsfirstspecialtyplan.orgGoDaddy.com, LLC11 May 201712 May 202511 May 2026
617kidsfirstpediatricsraeford.comGoDaddy.com, LLC13 May 201728 Nov 202413 May 2026
618kidsfirstpediatricsfayetteville.comGoDaddy.com, LLC13 May 201728 Nov 202413 May 2026
619kidsfirstcolorado.comGoDaddy.com, LLC11 Mar 202111 Mar 202111 Mar 2022
620kidsfirst-distribution.comOVH sas19 May 201719 May 201719 May 2018
621kidsfirstaustralia.netNetRegistry Pty Ltd.2 Jun 20172 Jun 20172 Jun 2019
622kidsfirstpediatricdentalcare.comGoDaddy.com, LLC1 Jun 201728 May 20251 Jun 2026
623kidsfirstpdc.comGoDaddy.com, LLC1 Jun 20172 Jun 20251 Jun 2026
624kidsfirstaustralia.orgMelbourne IT, Ltd2 Jun 201726 May 20252 Jun 2026
625kidsfirstcooking.comGoDaddy.com, LLC6 Jun 20176 Jun 20176 Jun 2018
626kidsfirstrecipes.comGoDaddy.com, LLC6 Jun 20176 Jun 20176 Jun 2018
627kidsfirstatlanta.orgDreamHost, LLC19 Jun 201719 Aug 201719 Jun 2018
628kidsfirstatlanta.comDreamHost, LLC19 Jun 201719 Jun 201719 Jun 2018
629kidsfirstdirectoryshop.loanChengdu West Dimension Digital Technology Co., Ltd…3 Jul 2017-3 Jul 2018
630kidsfirstcolorado.orgGoDaddy.com, LLC6 Jul 20176 Jul 20176 Jul 2018
631kidsfirstpediactrics.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Jul 201719 Jul 201719 Jul 2018
632kidsfirstestateplanning.comInternet Domain Services BS Corp24 Jul 201625 Jul 201724 Jul 2017
633kidsfirstclass.comBeijing Lanhai Jiye Technology Co., Ltd2 Aug 20174 Apr 20252 Aug 2025
634kidsfirstfamily.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Aug 20174 Aug 20174 Aug 2018
635kidsfirstclub.infoNetwork Solutions, LLC9 Aug 201715 Jul 20249 Aug 2025
636kidsfirstwa.orgTucows Domains Inc.19 May 20229 May 202519 May 2026
637kidsfirstdirectory.winWest263 International Limited16 Aug 2017-16 Aug 2018
638kidsfirstdrc.infoGoDaddy.com, LLC23 Aug 20177 Oct 202423 Aug 2025
639kidsfirstdrc.orgAmazon Registrar, Inc.23 Aug 201724 Jul 202423 Aug 2025
640kidsfirsthouston.comNameCheap, Inc.24 Aug 201724 Aug 201724 Aug 2018
641kidsfirstdirectorylike.winWest263 International Limited7 Sep 2017-7 Sep 2018
642kidsfirstvietnam.netNetwork Solutions, LLC8 Sep 20178 Sep 20178 Sep 2018
643kidsfirstdirectoryfit.onlineWest263 International Limited19 Sep 2017-19 Sep 2018
644kidsfirstascs-supervision.comNetwork Solutions, LLC28 Sep 201728 Sep 201728 Sep 2018
645kidsfirst-foundation.comGoDaddy.com, LLC3 Oct 201715 Apr 20243 Oct 2025
646kidsfirstvietnam.comNetwork Solutions, LLC3 Oct 20173 Oct 20173 Oct 2018
647kidsfirstcentre.comTucows Domains Inc.4 Oct 201715 Dec 20234 Oct 2023
648kidsfirstdirectoryfit.loanWest263 International Limited6 Oct 2017-6 Oct 2018
649kidsfirstei.comeNom, Inc.10 Oct 20173 Oct 202410 Oct 2025
650kidsfirstonline.infoGoDaddy.com, LLC19 Oct 201719 Oct 201719 Oct 2018
651kidsfirsttexas.infoGoDaddy.com, LLC19 Oct 201719 Oct 201719 Oct 2018
652kidsfirstcecc.comDropCatch.com 1396 LLC9 Jan 20199 Jan 20199 Jan 2020
653kidsfirstagenda.comNetwork Solutions, LLC23 Oct 201723 Oct 201723 Oct 2018
654kidsfirstdirectoryhot.loanWest263 International Limited26 Oct 2017-26 Oct 2018
655kidsfirstcard.comDomain.com, LLC27 Oct 201728 Oct 201727 Oct 2018
656kidsfirstcredit.comDomain.com, LLC27 Oct 201728 Oct 201727 Oct 2018
657kidsfirstcentre.uk-19 Jan 201720 Jan 202519 Jan 2027
658kidsfirstdirectory.faithWest263 International Limited10 Nov 2017-10 Nov 2018
659kidsfirstaz.infoGoDaddy.com, LLC15 Nov 201715 Nov 201715 Nov 2019
660kidsfirstincstl.comNetwork Solutions, LLC15 Nov 201715 Nov 201715 Nov 2018
661kidsfirst-team.comNetwork Solutions, LLC27 Nov 201727 Nov 201727 Nov 2018
662kidsfirstdirectory.partyWest263 International Limited27 Nov 2017-27 Nov 2018
663kidsfirstrichmond.comNameCheap, Inc.27 Nov 201727 Nov 201727 Nov 2018
664kidsfirstdirectoryjp.menWest263 International Limited4 Dec 2017-4 Dec 2018
665kidsfirstdirectorythe.menWest263 International Limited13 Dec 2017-13 Dec 2018
666kidsfirstbank.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 Feb 20139 Feb 201716 Feb 2018
667kidsfirstaid.co.uk-11 Oct 201711 Oct 201711 Oct 2019
668kidsfirstcoaching.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…26 Jan 201519 Jan 201726 Jan 2019
669kidsfirstpediatrictherapies.comGoogle, Inc.5 Jan 20185 Jan 20185 Jan 2019
670kidsfirstcentre.co.uk-4 Oct 20174 Oct 20174 Oct 2019
671kidsfirstaidwarehouse.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…29 Jul 200822 Jul 201629 Jul 2018
672kidsfirstinsurance.co.uk-16 Jun 200624 Jun 202416 Jun 2027
673kidsfirstdirectoryinjp.faithWest263 International Limited3 Jan 20188 Jan 20183 Jan 2019
674kidsfirstcenter.co.uk-4 Oct 20175 Sep 20234 Oct 2025
675kidsfirstdirectory.racingWest263 International Limited10 Jan 2018-10 Jan 2019
676kidsfirstdirectory.loanWest263 International Limited10 Jan 2018-10 Jan 2019
677kidsfirstcollaborative.comTucows Domains Inc.11 Jan 201828 Dec 202411 Jan 2026
678kidsfirstdaycare.co.ukGandi SAS13 Jan 201813 Jan 201813 Jan 2019
679kidsfirstdirectory.reviewWest263 International Limited17 Jan 2018-17 Jan 2019
680kidsfirstdirectorys.partyWest263 International Limited24 Jan 2018-24 Jan 2019
681kidsfirstdirectoryinjp.partyWest263 International Limited5 Feb 2018-5 Feb 2019
682kidsfirstdirectoryinjp.reviewWest263 International Limited9 Feb 2018-9 Feb 2019
683kidsfirstcecc.netNetwork Solutions, LLC14 Feb 201814 Feb 201814 Feb 2019
684kidsfirstsandiego.comGoogle, Inc.24 Mar 201824 Mar 201824 Mar 2019
685kidsfirstaidprogram.comCrazy Domains FZ-LLC27 Mar 201827 Mar 201827 Mar 2019
686kidsfirstcharity.co.uk-27 Mar 201827 Mar 201827 Mar 2019
687kidsfirsttutors.co.uk-27 Mar 20185 Jul 202427 Mar 2026
688kidsfirstcasthosting.comTucows Domains Inc.30 Mar 20183 Apr 202130 Mar 2021
689kidsfirstguitar.comDropCatch.com 655 LLC1 Jun 20242 Jul 20251 Jun 2025
690kidsfirstcoparenting.comeNom, Inc.9 Jul 202423 Jun 20259 Jul 2026
691kidsfirstfamilylaw.com1API GmbH19 May 20184 Apr 202319 May 2026
692kidsfirsttransport.comGoDaddy.com, LLC27 Mar 202127 Mar 202127 Mar 2022
693kidsfirstspeechtherapy.comGoDaddy.com, LLC2 Jun 20182 Jun 20252 Jun 2027
694kidsfirstcovington.comGoDaddy.com, LLC15 Jun 201815 Jun 201815 Jun 2020
695kidsfirstmedina.netNetwork Solutions, LLC16 Jun 201817 Jun 201816 Jun 2019
696kidsfirstbedding.comGoDaddy.com, LLC22 Jun 201823 Jun 202422 Jun 2026
697kidsfirstadoption.netGoDaddy.com, LLC24 Jun 20181 Apr 202424 Jun 2026
698kidsfirstamerica.comTurnCommerce, Inc. DBA NameBright.com13 Sep 20227 Sep 202313 Sep 2025
699kidsfirstamerica.infoeNom, Inc.25 Jun 201815 Jun 201925 Jun 2020
700kidsfirstamerica.neteNom, Inc.25 Jun 201825 Jun 201825 Jun 2020
701kidsfirstbooster.netNetwork Solutions, LLC29 Jun 201830 Jun 201829 Jun 2019
702kidsfirstindiana.netNetwork Solutions, LLC4 Jul 20185 Jul 20184 Jul 2019
703kidsfirstworld.comHosting Concepts B.V. dba Openprovider17 Jul 201817 Jul 201817 Jul 2019
704kidsfirstnwi.comGoDaddy.com, LLC20 Jul 201828 Oct 202220 Jul 2026
705kidsfirstgametruck.comGoDaddy.com, LLC23 Jul 201823 Jul 201823 Jul 2019
706kidsfirstchicago.infoGoDaddy.com, LLC1 Aug 20182 Aug 20191 Aug 2020
707kidsfirsttx.comGoDaddy.com, LLC10 Aug 201811 Aug 202410 Aug 2025
708kidsfirstdaycareandlearningcenterinc.comGoDaddy.com, LLC15 Aug 201816 Aug 202415 Aug 2025
709kidsfirstslidell.comGoDaddy.com, LLC16 Aug 201810 Dec 202416 Aug 2025
710kidsfirstorthodontist.comGoogle, Inc.17 Aug 201816 Sep 202417 Aug 2024
711kidsfirstorthodontics.comGoogle, Inc.17 Aug 201816 Sep 202417 Aug 2024
712kidsfirstortho.comGoDaddy.com, LLC27 Sep 201828 Sep 202427 Sep 2026
713kidsfirstreadingclub.comFastDomain Inc.3 Oct 201829 Sep 20243 Oct 2025
714kidsfirstchoicejuice.comTucows Domains Inc.15 Oct 201819 Oct 202215 Oct 2023
715kidsfirstbehavioral.comeNom, Inc.18 Oct 201811 Oct 202418 Oct 2025
716kidsfirstonline.netGoDaddy.com, LLC23 Oct 201824 Oct 202423 Oct 2025
717kidsfirstvisitationindianapolis.comGKG.NET, INC.3 Dec 20183 Dec 20183 Dec 2019
718kidsfirsts.comGoDaddy.com, LLC12 Dec 201812 Dec 201812 Dec 2019
719kidsfirstrugby.comParagon Internet Group Ltd t/a Paragon Names18 Dec 201818 Dec 201818 Dec 2019
720kidsfirstdentallancaster.comGoDaddy.com, LLC20 Dec 201819 Dec 202420 Dec 2025
721kidsfirstdentalgreenwood.comGoDaddy.com, LLC20 Dec 201819 Dec 202420 Dec 2025
722kidsfirstdentalcolumbia.comGoDaddy.com, LLC20 Dec 201819 Dec 202420 Dec 2025
723kidsfirstspeechtherapist.comGoDaddy.com, LLC10 Jan 201911 Jan 202510 Jan 2026
724kidsfirstvisitationservices.comGoDaddy.com, LLC6 May 20216 May 20256 May 2026
725kidsfirstaidtutelage.clubURL Solutions, Inc.18 Jan 201918 Jan 201918 Jan 2020
726kidsfirstvisitation.comGoDaddy.com, LLC24 Jan 201925 Jan 202524 Jan 2026
727kidsfirstlegal.comGoDaddy.com, LLC4 Feb 201916 Feb 20254 Feb 2026
728kidsfirstspeech.comregister.com, Inc.10 Feb 201910 Feb 202510 Feb 2026
729kidsfirstgig.comGoDaddy.com, LLC10 Feb 201910 Feb 201910 Feb 2021
730kidsfirstwiki.comTucows Domains Inc.18 Feb 201922 Feb 202218 Feb 2022
731kidsfirstservice.comGoogle, Inc.18 Feb 201918 Feb 201918 Feb 2020
732kidsfirstmagazine.comGoDaddy.com, LLC20 Feb 20193 Apr 202520 Feb 2025
733kidsfirstcellphone.comGoDaddy.com, LLC21 Feb 201921 Feb 201921 Feb 2020
734kidsfirstpreschoolacademy.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Mar 201914 Apr 20243 Mar 2024
735kidsfirstwashington.comGoDaddy.com, LLC11 Mar 201911 Mar 201911 Mar 2020
736kidsfirstvotes.comGoDaddy.com, LLC13 Mar 201914 Mar 202513 Mar 2028
737kidsfirst-newhaven.netGoDaddy.com, LLC21 Mar 201921 Mar 201921 Mar 2021
738kidsfirst-newhaven.comGoDaddy.com, LLC21 Mar 201921 Mar 201921 Mar 2021
739kidsfirst-newhaven.usGoDaddy.com, LLC21 Mar 201921 Mar 201921 Mar 2021
740kidsfirstnetwork.comGoDaddy.com, LLC10 Jun 202510 Jun 202510 Jun 2026
741kidsfirstswimschool.comApril Sea Information Technology Corporation20 Sep 200429 Apr 202520 Sep 2025
742kidsfirstswfl.comGoDaddy.com, LLC23 Apr 20194 Jun 202523 Apr 2025
743kidsfirstride.comGoDaddy.com, LLC30 Apr 201915 May 202530 Apr 2026
744kidsfirstidaho.comTucows Domains Inc.2 May 201913 Jul 20232 May 2023
745kidsfirstswinschools.comGoDaddy.com, LLC6 Jun 20196 Jun 20196 Jun 2020
746kidsfirstagency.comGoDaddy.com, LLC10 Jun 201911 Jun 202410 Jun 2029
747kidsfirstphc.comeNom, Inc.10 Jun 201911 Jun 202510 Jun 2025
748kidsfirstacademy.net1&1 Internet AG7 Jul 20197 Jul 20197 Jul 2025
749kidsfirstnet.comGoDaddy.com, LLC23 Jul 201923 Jul 202423 Jul 2025
750kidsfirstministries.comTucows Domains Inc.6 Aug 201923 Jul 20246 Aug 2025
751kidsfirstfundraising.comGoDaddy.com, LLC12 Aug 201912 Aug 201912 Aug 2020
752kidsfirstelpaso.com1&1 Internet AG3 Sep 20193 Sep 20193 Sep 2020
753kidsfirstgirard.comNameCheap, Inc.6 Sep 2019-6 Sep 2020
754kidsfirstoo.comRegister NV dba Register.eu15 Sep 201915 Sep 201915 Sep 2020
755kidsfirstfundraiser.comGoDaddy.com, LLC23 Sep 201923 Sep 201923 Sep 2020
756kidsfirstsportszone.netTucows Domains Inc.25 Sep 201929 Sep 202225 Sep 2022
757kidsfirstsportszone.comTucows Domains Inc.25 Sep 201929 Sep 202225 Sep 2023
758kidsfirstbeloit.comNetwork Solutions, LLC2 Oct 201915 Dec 20242 Oct 2024
759kidsfirstcc.comGoDaddy.com, LLC2 Oct 20196 Oct 20232 Oct 2025
760kidsfirstmoney.comGoDaddy.com, LLC2 Oct 20193 Oct 20232 Oct 2025
761kidsfirstaid.netGoDaddy.com, LLC7 Oct 20197 Oct 20197 Oct 2020
762kidsfirstconference.neteNom, Inc.12 Oct 201912 Oct 201912 Oct 2021
763kidsfirstconference.comeNom, Inc.12 Oct 201912 Oct 201912 Oct 2021
764kidsfirstalliance.comGoDaddy.com, LLC23 Feb 202423 Feb 202523 Feb 2026
765kidsfirstdentalva.comGoDaddy.com, LLC7 Nov 201921 Mar 20257 Nov 2025
766kidsfirstearlylearning.comGoDaddy.com, LLC8 Nov 20199 Nov 20248 Nov 2025
767kidsfirstapartments.comWix.com Ltd.12 Nov 20197 Jun 202412 Nov 2025
768kidsfirstnova.comGoDaddy.com, LLC27 Nov 201910 May 202527 Nov 2026
769kidsfirstdentalmartinsville.comGoDaddy.com, LLC11 Dec 201919 Dec 202411 Dec 2025
770kidsfirstdentalroanoke.comGoDaddy.com, LLC11 Dec 201919 Dec 202411 Dec 2025
771kidsfirsthealth.comGoDaddy.com, LLC14 Dec 201925 Jan 202514 Dec 2024
772kidsfirstproject.comGoDaddy.com, LLC9 Jan 20209 Jan 20209 Jan 2021
773kidsfirstteaching.comGoogle, Inc.10 Jan 202010 Jan 202010 Jan 2021
774kidsfirstacademysumter.comregister.com, Inc.28 Jan 202029 Jan 202528 Jan 2026
775kidsfirstaz.comTurnCommerce, Inc. DBA NameBright.com1 Feb 20204 Mar 20241 Feb 2024
776kidsfirstacademyalamogordo.comGoDaddy.com, LLC6 Feb 202020 Apr 20256 Feb 2025
777kidsfirst-academy.comGoDaddy.com, LLC6 Feb 20207 Feb 20256 Feb 2026
778kidsfirstacademys.comGoDaddy.com, LLC6 Feb 202020 Apr 20256 Feb 2025
779kidsfirstacademyusa.comGoDaddy.com, LLC6 Feb 202020 Apr 20256 Feb 2025
780kidsfirstacademy.lifeGoDaddy.com, LLC6 Feb 202019 Apr 20256 Feb 2025
781kidsfirstacademy.educationGoDaddy.com, LLC6 Feb 202019 Apr 20256 Feb 2025
782kidsfirstacademy.clubGoDaddy.com, LLC6 Feb 20207 Feb 20256 Feb 2025
783kidsfirstshoals.comLaunchpad, Inc.10 Feb 202024 Apr 202410 Feb 2024
784kidsfirstlearningcenter.netAbove.com Pty Ltd.12 Feb 202025 Dec 202312 Feb 2026
785kidsfirstbuffalo.comAmazon Registrar, Inc.14 Feb 202010 Jan 202514 Feb 2026
786kidsfirstcdc.comGoDaddy.com, LLC20 Feb 202021 Feb 202520 Feb 2026
787kidsfirstdentalconway.comGoDaddy.com, LLC2 Mar 20203 Mar 20252 Mar 2026
788kidsfirstedtherapy.comGoDaddy.com, LLC8 Mar 202026 Jul 20248 Mar 2026
789kidsfirstvision.comGoDaddy.com, LLC26 Mar 20207 May 202426 Mar 2024
790kidsfirstoptics.comNameCheap, Inc.1 Apr 2020-1 Apr 2021
791kidsfirstpac.comGoDaddy.com, LLC8 Apr 202014 Apr 20248 Apr 2026
792kidsfirstofrichmond.comGoDaddy.com, LLC21 Jun 202223 May 202521 Jun 2026
793kidsfirstdoc.comGoDaddy.com, LLC25 Apr 202026 Apr 202325 Apr 2024
794kidsfirstacademy.infoGoDaddy.com, LLC6 Feb 202019 Apr 20256 Feb 2025
795kidsfirst-newhaven.infoGoDaddy.com, LLC21 Mar 201920 May 201921 Mar 2021
796kidsfirstcast.comTurnCommerce, Inc. DBA NameBright.com21 May 20201 Jul 202521 May 2025
797kidsfirstpressurewashingllc.comGoogle, Inc.3 Jun 20203 Aug 20233 Jun 2023
798kidsfirst-online.comTucows Domains Inc.26 May 202026 May 202026 May 2021
799kidsfirstusa.comGoDaddy.com, LLC3 Jul 20208 Jul 20253 Jul 2025
800kidsfirsteducation.netGoogle, Inc.16 Jun 202016 Jun 202016 Jun 2021
801kidsfirstacademy.techGoDaddy.com, LLC6 Feb 202019 Apr 20256 Feb 2025
802kidsfirstlc.comWild West Domains, LLC20 Jul 202021 Jul 202420 Jul 2025
803kidsfirstrochester.comAmazon Registrar, Inc.20 Jul 202022 Mar 202420 Jul 2024
804kidsfirstpediatrictherapy.comGoDaddy.com, LLC21 Jul 202015 Nov 202221 Jul 2025
805kidsfirstdarien.comNameCheap, Inc.24 Jul 2020-24 Jul 2021
806kidsfirstpreschool.netregister.com, Inc.31 Jul 202031 Jul 202031 Jul 2021
807kidsfirstexchange.comGoDaddy.com, LLC9 Aug 20209 Aug 20209 Aug 2021
808kidsfirstak.comTucows Domains Inc.11 Aug 202026 Feb 202511 Aug 2025
809kidsfirstclinics.comGoDaddy.com, LLC14 Aug 202015 Aug 202414 Aug 2025
810kidsfirsthomedaycare.comLaunchpad, Inc.29 Aug 202010 Sep 202429 Aug 2025
811kidsfirstcanada.comeasyDNS Technologies, Inc.4 Mar 20204 Mar 20254 Mar 2030
812kidsfirstaidtutelage.siteURL Solutions, Inc.1 Oct 202012 Oct 20201 Oct 2021
813kidsfirstfoods.comDynadot, LLC8 Oct 20208 Oct 20218 Oct 2021
814kidsfirstofstafford.comGoDaddy.com, LLC9 Oct 20209 Oct 20209 Oct 2021
815kidsfirstadmin.comGoDaddy.com, LLC12 Oct 202012 Oct 202012 Oct 2021
816kidsfirsttexasonline.comGoDaddy.com, LLC19 Oct 202020 Oct 202419 Oct 2025
817kidsfirstofpasadena.comNameCheap, Inc.20 Oct 2020-20 Oct 2021
818kidsfirstrentals.comGoDaddy.com, LLC21 Jun 20232 Jul 202521 Jun 2026
819kidsfirstrental.comGoDaddy.com, LLC21 Jun 20232 Jul 202521 Jun 2026
820kidsfirstot.ca-22 Apr 20157 Apr 202522 Apr 2026
821kidsfirstcode.comNameCheap, Inc.9 Nov 2020-9 Nov 2022
822kidsfirst-ot.comGoDaddy.com, LLC6 Dec 20207 Dec 20246 Dec 2025
823kidsfirstcommunication.comSquarespace Domains LLC9 Dec 202016 Nov 20249 Dec 2025
824kidsfirstacademy.siteHostinger, UAB27 Apr 20252 May 202527 Apr 2026
825kidsfirstsports.onlineNetwork Solutions, LLC20 Dec 202031 Aug 202320 Dec 2026
826kidsfirstbooster.onlineNetwork Solutions, LLC27 Dec 202027 Dec 202027 Dec 2021
827kidsfirstacademylouisville.comFastDomain Inc.28 Dec 20209 Feb 202528 Dec 2029
828kidsfirstoccupationaltherapy.comGoDaddy.com, LLC30 Dec 202030 Oct 202230 Dec 2025
829kidsfirstsvs.comGoDaddy.com, LLC4 Jan 20214 Jan 20214 Jan 2022
830kidsfirstreaders.comNetEarth One Inc. d/b/a NetEarth15 Jan 202115 Jan 202115 Jan 2022
831kidsfirstclinic.clubGoDaddy.com, LLC22 Jan 202122 Jan 202122 Jan 2022
832kidsfirstclinics.clubGoDaddy.com, LLC22 Jan 202122 Jan 202122 Jan 2022
833kidsfirstmd.comGoDaddy.com, LLC26 Jan 202127 Jan 202526 Jan 2026
834kidsfirstkitchen.comNamespro Solutions Inc.27 Jan 20217 Apr 202427 Jan 2024
835kidsfirstineducation.comeNom, Inc.27 Jan 202110 Jan 202527 Jan 2026
836kidsfirstcy.comPapaki Ltd.4 Feb 20215 Nov 20244 Feb 2026
837kidsfirstoklahoma.comGoogle, Inc.20 Feb 202120 Feb 202120 Feb 2022
838kidsfirstpeds.bizGoDaddy.com, LLC24 Feb 20219 Jul 202424 Feb 2029
839kidsfirstpeds.infoGoDaddy.com, LLC24 Feb 202130 Aug 202424 Feb 2029
840kidsfirstlearningcentre.com1API GmbH26 Feb 202111 Apr 202326 Feb 2023
841kidsfirstna.comGoDaddy.com, LLC18 Mar 202119 Mar 202518 Mar 2026
842kidsfirstministry.comGoDaddy.com, LLC18 Mar 202119 Mar 202518 Mar 2026
843kidsfirstchildcare.netGoogle, Inc.22 Mar 202122 Mar 202122 Mar 2022
844kidsfirstlearning.bizGoDaddy.com, LLC24 Mar 202130 Mar 202524 Mar 2026
845kidsfirsthelp.comGransy s.r.o. d/b/a subreg.cz29 Mar 202121 Mar 202529 Mar 2026
846kidsfirstpedstx.comGoogle, Inc.2 Apr 202118 Mar 20252 Apr 2026
847kidsfirstpediatricstx.comGoogle, Inc.2 Apr 202118 Mar 20252 Apr 2026
848kidsfirst-tutorcentres.com1&1 Internet AG14 Apr 202114 Apr 202114 Apr 2022
849kidsfirstdcsd.comGoDaddy.com, LLC25 Mar 202525 Mar 202525 Mar 2027
850kidsfirstemergency.comSquarespace Domains LLC29 Apr 202129 May 202429 Apr 2024
851kidsfirstdyslexia.comWild West Domains, LLC16 May 202116 May 202516 May 2027
852kidsfirstinolatheschools.comGoDaddy.com, LLC17 May 202122 May 202517 May 2026
853kidsfirst-gif.comGMO Internet Inc.19 May 20212 Apr 202519 May 2026
854kidsfirsttampa.comGoogle, Inc.29 May 202130 May 202329 May 2024
855kidsfirstct.comGoDaddy.com, LLC3 Jul 202113 Aug 20243 Jul 2024
856kidsfirstschoolsupplies.comGoDaddy.com, LLC13 Jul 202113 Jul 202113 Jul 2022
857kidsfirstpedsraefordjobs.comAmazon Registrar, Inc.18 Aug 20211 Oct 202318 Aug 2023
858kidsfirstconsultants.comTucows Domains Inc.4 Dec 202424 May 20254 Dec 2025
859kidsfirstjointcommittee.comGoDaddy.com, LLC30 Aug 202130 Aug 202130 Aug 2022
860kidsfirstmadison.netNameCheap, Inc.1 Sep 2021-1 Sep 2022
861kidsfirstmadison.comNameCheap, Inc.1 Sep 2021-1 Sep 2022
862kidsfirstwheels.comNameCheap, Inc.16 Sep 202117 Aug 202416 Sep 2025
863kidsfirstd20.netFastDomain Inc.18 Sep 20211 Dec 202418 Sep 2024
864kidsfirstd20.comFastDomain Inc.18 Sep 20211 Dec 202418 Sep 2024
865kidsfirstdentalstudio.comGoDaddy.com, LLC29 Sep 202110 Nov 202429 Sep 2024
866kidsfirstcalifornia.comGoDaddy.com, LLC5 Feb 20246 Feb 20255 Feb 2026
867kidsfirstca.comGoDaddy.com, LLC1 Oct 20212 Oct 20241 Oct 2025
868kidsfirstnursery.comLaunchpad, Inc.9 Oct 20215 Oct 20249 Oct 2025
869kidsfirst4ever.comeNom, Inc.21 Oct 202122 Sep 202421 Oct 2025
870kidsfirstky.comGoDaddy.com, LLC5 Nov 20216 Nov 20245 Nov 2025
871kidsfirstnv.comDropCatch.com 1091 LLC22 Nov 202122 Nov 202122 Nov 2022
872kidsfirsteyewear.comDomain.com, LLC23 Nov 202123 Nov 202123 Nov 2026
873kidsfirstcollaborativeva.comGoDaddy.com, LLC29 Nov 20218 Oct 202229 Nov 2026
874kidsfirstla.comGoDaddy.com, LLC14 Jan 202215 Jan 202514 Jan 2026
875kidsfirst-crianzaconamor.comGoogle, Inc.27 Feb 20224 Mar 202427 Feb 2024
876kidsfirstfam.comNameCheap, Inc.15 Jan 202127 Jan 202515 Jan 2026
877kidsfirstcuc.comDomainPeople, Inc.17 Mar 20222 Mar 202517 Mar 2026
878kidsfirstma.centerNetwork Solutions, LLC27 Mar 202229 Mar 202327 Mar 2024
879kidsfirstnft.comIHS Telekom, Inc.26 Mar 202227 Mar 202326 Mar 2024
880kidsfirstfranchise.companyNetwork Solutions, LLC18 Apr 20221 Jul 202318 Apr 2023
881kidsfirstcry.comHostinger, UAB31 Oct 202313 Jan 202531 Oct 2024
882kidsfirstcos.comGoogle, Inc.1 May 202216 Apr 20251 May 2026
883kidsfirstcoloradosprings.comGoogle, Inc.1 May 202216 Apr 20251 May 2026
884kidsfirstcardboard.comFastDomain Inc.22 May 202224 Jun 202322 May 2023
885kidsfirstco.orgGoDaddy.com, LLC18 Mar 202030 Aug 202418 Mar 2026
886kidsfirstfunding.orgDomain.com, LLC12 Jun 202219 May 202512 Jun 2026
887kidsfirstcopgroep.xyzNameCheap, Inc.13 Jun 202224 Aug 202313 Jun 2023
888kidsfirstyears.orgCloudFlare, Inc.2 Jul 202121 May 20252 Jul 2026
889kidsfirstllc.orgGoogle, Inc.23 Jun 202223 Jun 202323 Jun 2024
890kidsfirstak.orgGoogle, Inc.21 Jul 202012 Jul 202421 Jul 2025
891kidsfirstd49.orgGoogle, Inc.21 Jul 202212 Jul 202421 Jul 2025
892kidsfirsthoboken.orgGoDaddy.com, LLC21 Jul 20224 Sep 202421 Jul 2026
893kidsfirstsummit.orgGoogle, Inc.22 Jul 202213 Jul 202422 Jul 2025
894kidsfirstcl.infoGoDaddy.com, LLC22 Jul 202226 Mar 202422 Jul 2025
895kidsfirstsummit.comGoogle, Inc.22 Jul 20228 Jul 202422 Jul 2025
896kidsfirsthoboken.oneGoDaddy.com, LLC25 Jul 202225 Jul 202225 Jul 2023
897kidsfirsthoboken.bizGoDaddy.com, LLC25 Jul 20225 Sep 202425 Jul 2024
898kidsfirsthoboken.netGoDaddy.com, LLC25 Jul 20225 Sep 202425 Jul 2024
899kidsfirsthobokennj.comGoDaddy.com, LLC25 Jul 20225 Sep 202425 Jul 2024
900kidsfirstduval.comGoogle, Inc.2 Aug 20223 Aug 20232 Aug 2024
901kidsfirstlearning1.bizName.com, Inc.2 Aug 20221 Aug 20242 Aug 2025
902kidsfirstcharterconference.orgGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
903kidsfirstus.orgGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
904kidsfirstsc.orgGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
905kidsfirst-conference.orgGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
906kidsfirstsc.netGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
907kidsfirstcharterconference.netGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
908kidsfirstus.netGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
909kidsfirst-conference.netGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
910kidsfirstus.comGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
911kidsfirstsc.comGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
912kidsfirstcharterconference.comGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
913kidsfirst-conference.comGoDaddy.com, LLC5 Aug 202216 Sep 20245 Aug 2024
914kidsfirstclc.comGoogle, Inc.11 Aug 202212 Aug 202311 Aug 2024
915kidsfirstfnd.orgGoDaddy.com, LLC28 Mar 201929 Jul 202428 Mar 2029
916kidsfirstparent.comGoDaddy.com, LLC21 Aug 202222 Aug 202421 Aug 2025
917kidsfirstpediatricdentalcarelp.comGoDaddy.com, LLC23 Aug 202220 Aug 202423 Aug 2025
918kidsfirstwinona.comWix.com Ltd.7 Sep 202011 Sep 20227 Sep 2022
919kidsfirstcda.comTucows Domains Inc.12 Sep 202216 Sep 202412 Sep 2025
920kidsfirstd20.orgGoDaddy.com, LLC5 Dec 202410 Dec 20245 Dec 2025
921kidsfirstdivorcecoach.comGoDaddy.com, LLC18 Sep 202230 Nov 202418 Sep 2024
922kidsfirst4ever.orgeNom, Inc.29 Sep 20225 Sep 202429 Sep 2025
923kidsfirstca.orgGoDaddy.com, LLC1 Oct 20211 Oct 20221 Oct 2023
924kidsfirst4ever.neteNom, Inc.29 Sep 202231 Aug 202429 Sep 2025
925kidsfirststl.comWix.com Ltd.7 Oct 20227 Sep 20247 Oct 2025
926kidsfirstclimate.orgName.com, Inc.14 Oct 202212 Jul 202314 Oct 2027
927kidsfirstfostering.comGoDaddy.com, LLC18 Oct 202219 Oct 202418 Oct 2025
928kidsfirstadoption.onlineGoDaddy.com, LLC24 Oct 202214 Sep 202424 Oct 2025
929kidsfirstsitka.org1&1 Internet AG28 Oct 202110 Dec 202328 Oct 2023
930kidsfirstfunding.comGoDaddy.com, LLC27 Oct 202228 Oct 202427 Oct 2026
931kidsfirstcamp.comGoDaddy.com, LLC4 Oct 201716 Oct 20214 Oct 2022
932kidsfirst-sa.comNameCheap, Inc.4 Nov 202216 Jan 20244 Nov 2023
933kidsfirstopshop.org.au--10 Apr 2025-
934kidsfirstsdcare.comGoDaddy.com, LLC16 Nov 202227 Dec 202316 Nov 2023
935kidsfirsttroy.comCloudFlare, Inc.9 Dec 20229 Nov 20249 Dec 2025
936kidsfirstmedina.onlineNetwork Solutions, LLC15 Dec 202226 Feb 202415 Dec 2023
937kidsfirstpreschool.ca-8 Aug 20227 Oct 20228 Aug 2025
938kidsfirstwater.comGoDaddy.com, LLC9 Jan 202319 Feb 20249 Jan 2024
939kidsfirstsupervisedvisits.comWix.com Ltd.11 Jan 202321 Feb 202411 Jan 2024
940kidsfirstaid.ca-7 Apr 20158 Apr 20257 Apr 2028
941kidsfirstphysio.ca-21 Nov 200614 Nov 202421 Nov 2025
942kidsfirsttransport.be-21 May 2019--
943kidsfirstpets.comNameCheap, Inc.27 Jan 20236 Mar 202427 Jan 2025
944kidsfirstpediatricdentists.comGoDaddy.com, LLC28 Jan 202329 Jan 202528 Jan 2026
945kidsfirstmontessori.ca-5 Sep 20137 Aug 20245 Sep 2029
946kidsfirstdrc.comGoDaddy.com, LLC23 Aug 201724 Aug 202423 Aug 2025
947kidsfirstmedina.comSquarespace Domains LLC25 Jul 201715 Sep 202425 Jul 2025
948kidsfirststaff.comGoDaddy.com, LLC7 Sep 20178 Sep 20247 Sep 2025
949kidsfirstapparel.comGoDaddy.com, LLC7 Sep 20178 Sep 20247 Sep 2025
950kidsfirstut.comGoDaddy.com, LLC19 Oct 201720 Oct 202319 Oct 2026
951kidsfirstprincealbert.comNetwork Solutions, LLC21 Nov 20177 Jun 202421 Nov 2025
952kidsfirst-therapy.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Dec 201722 Dec 202419 Dec 2025
953kidsfirstaustralia.org.au--26 May 2024-
954kidsfirstclothingconsignment.comGoDaddy.com, LLC5 Mar 20236 Mar 20255 Mar 2026
955kidsfirstgilmer.comNameCheap, Inc.15 Feb 201816 Jan 202515 Feb 2026
956kidsfirstpoliticssecond.comGoDaddy.com, LLC16 Feb 201828 Apr 202416 Feb 2024
957kidsfirsthousing.orgDomain.com, LLC10 Mar 202323 Apr 202410 Mar 2024
958kidsfirsttutors.comGoDaddy.com, LLC26 Mar 201827 Mar 202426 Mar 2026
959kidsfirstgarden.comGoDaddy.com, LLC4 May 20184 May 20254 May 2026
960kidsfirstspeechpathology.comKey-Systems GmbH12 Mar 201925 May 202412 Mar 2024
961kidsfirstkansas.comGoDaddy.com, LLC15 Mar 202316 Mar 202515 Mar 2027
962kidsfirstchildmonitoring.comGoDaddy.com, LLC22 Mar 20233 May 202522 Mar 2025
963kidsfirstmonitoring.comGoDaddy.com, LLC22 Mar 20233 May 202422 Mar 2024
964kidsfirstdaycare.netGoDaddy.com, LLC22 Mar 202323 Mar 202522 Mar 2027
965kidsfirsttherapycenter.comWix.com Ltd.28 Jan 20211 Feb 202428 Jan 2025
966kidsfirstmeadowlake.comWix.com Ltd.8 Mar 20217 Jun 20248 Mar 2027
967kidsfirst5050.comGoDaddy.com, LLC23 Apr 202124 Apr 202523 Apr 2026
968kidsfirstchildcarecenter.comWix.com Ltd.29 May 20212 Jun 202529 May 2025
969kidsfirstcop-edu.websiteNameCheap, Inc.8 Apr 202320 May 20248 Apr 2024
970kidsfirstcolombia.comGoDaddy.com, LLC22 Jan 202223 Jan 202522 Jan 2026
971kidsfirstupshur.comGoDaddy.com, LLC9 Feb 202222 Mar 20249 Feb 2024
972kidsfirstbelleville.comSquarespace Domains LLC23 Feb 202225 Mar 202323 Feb 2023
973kidsfirstlifestyle.comWix.com Ltd.9 May 202219 Jul 20239 May 2023
974kidsfirstpediatricjobs.comCloudFlare, Inc.19 May 202219 Apr 202519 May 2026
975kidsfirstpasadena.comGoDaddy.com, LLC13 Jun 202214 Jun 202413 Jun 2026
976kidsfirstacademy.familyGoDaddy.com, LLC6 Feb 202019 Apr 20256 Feb 2025
977kidsfirststep.co.inGoDaddy.com, LLC8 Apr 20193 Jun 20258 Apr 2025
978kidsfirstadvocate.comNetwork Solutions, LLC18 Apr 20239 May 202518 Apr 2026
979kidsfirstacademy.liveGoDaddy.com, LLC6 Feb 202019 Apr 20256 Feb 2025
980kidsfirstdrc.netGoDaddy.com, LLC23 Aug 201724 Aug 202423 Aug 2025
981kidsfirstllc.neteNom, Inc.17 May 201818 Apr 202517 May 2026
982kidsfirstspeech.netKey-Systems GmbH12 Mar 201925 May 202412 Mar 2024
983kidsfirst5050.netGoDaddy.com, LLC23 Apr 202124 Apr 202523 Apr 2026
984kidsfirstmediation.nl-20 Jan 20157 Feb 2025-
985kidsfirstgastouderbureau.nl-29 Jan 201816 Oct 2024-
986kidsfirstbarrington.orgFastDomain Inc.13 Jan 20183 Jan 202513 Jan 2026
987kidsfirstpoliticssecond.orgGoDaddy.com, LLC19 Feb 20181 Apr 202419 Feb 2024
988kidsfirstsports.orgGoDaddy.com, LLC8 Mar 201822 Apr 20258 Mar 2026
989kidsfirstaidprogram.orgCrazy Domains FZ-LLC27 Mar 201825 May 202427 Mar 2024
990kidsfirstamerica.orgNameKing.com Inc.18 Sep 202318 Sep 202418 Sep 2025
991kidsfirststo.orgGoDaddy.com, LLC7 Aug 201818 Sep 20247 Aug 2024
992kidsfirstmagazine.orgGoDaddy.com, LLC18 Apr 201930 May 202518 Apr 2025
993kidsfirstswfl.orgGoDaddy.com, LLC23 Apr 20194 Jun 202523 Apr 2025
994kidsfirstconference.orgGoDaddy.com, LLC27 Nov 20242 Dec 202427 Nov 2027
995kidsfirstdocs.orgregister.com, Inc.21 Nov 20195 Jan 202521 Nov 2025
996kidsfirstacademyalamogordo.orgGoDaddy.com, LLC6 Feb 202019 Apr 20256 Feb 2025
997kidsfirstupdate.orgNetwork Solutions, LLC17 Mar 202020 Feb 202517 Mar 2026
998kidsfirstpeds.orgNetwork Solutions, LLC2 Aug 20207 Jun 20242 Aug 2026
999kidsfirstpediatrictherapies.orgGoDaddy.com, LLC23 Aug 20209 Oct 202423 Aug 2025
1000kidsfirstcharity.orgGoDaddy.com, LLC27 Oct 202011 Dec 202427 Oct 2025

Displaying 1,000 out of 1,109 domains starting with the keyword "KIDSFIRST". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=kidsfirst

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now