Our database now contains whois records of 643 Million (643,531,764) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [643 Million Domains] $10,000 Details

Keyword: JUVE

Reverse Whois » KEYWORD [juve ]  { 11,835 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1juve.de--4 Feb 2022-
2juve.careGoDaddy.com, LLC7 Oct 20145 Jul 20247 Oct 2025
3juve.onlineName.com, Inc.26 Aug 201526 Aug 201526 Aug 2016
4juve.newsGoDaddy.com, LLC7 Oct 201921 Nov 20247 Oct 2025
5juve.fansCronon AG3 Sep 201519 Nov 20193 Sep 2020
6juve.comDynadot, LLC29 Jan 19976 Dec 202430 Jan 2026
7juve.cloudTucows Domains Inc.1 Sep 20195 Sep 20201 Sep 2020
8juve.wangeName Technology Co., Ltd.29 Feb 201629 Feb 201628 Feb 2017
9juve.proGoDaddy.com, LLC9 May 202220 Jun 20239 May 2023
10juve.storeunited-domains AG14 Jun 201628 Aug 202514 Jun 2026
11juve.bizTucows Domains Inc.29 Jan 200227 Oct 202428 Jan 2026
12juve.gdnIntracom Middle East FZE19 Jul 201614 Mar 201719 Jul 2018
13juve.futbolGoogle, Inc.7 Oct 20163 Jun 20257 Oct 2025
14juve.infoSecura GmbH15 Aug 200122 Jul 202515 Aug 2026
15juve.netTucows Domains Inc.11 Nov 199927 Jul 202511 Nov 2026
16juve.orgTucows Domains Inc.31 Aug 200123 Jun 202531 Aug 2026
17juve.usDynadot, LLC6 Dec 202410 Sep 20256 Dec 2025
18juve.xyz-1 Mar 20226 Jun 20251 Mar 2026
19juve.liveNameCheap, Inc.15 Jul 20241 Aug 202515 Jul 2026
20juve.networkUniregistrar Corp5 Jun 201729 Sep 20175 Jun 2018
21juve.lifeGoDaddy.com, LLC2 Dec 202013 Jan 20242 Dec 2023
22juve.cat1&1 Internet AG18 Jul 201718 Jul 201718 Jul 2018
23juve.ltdAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…12 Sep 201712 Sep 201712 Sep 2018
24juve.co.uk-16 Feb 199916 Feb 201716 Feb 2018
25juve.siteAB NameISP3 Sep 20183 Sep 20183 Sep 2019
26juve.wtfNamesilo, LLC29 Jul 20241 Sep 202529 Jul 2025
27juve.expertNameCheap, Inc.2 Dec 20182 Dec 20182 Dec 2019
28juve.linkNameCheap, Inc.2 Sep 202122 Mar 20252 Sep 2026
29juve.emailDomeneshop AS dba domainnameshop.com19 Sep 202029 Nov 202419 Sep 2024
30juve.realtyEpik Inc.29 Sep 202014 Nov 202129 Sep 2022
31juve.landGoDaddy.com, LLC16 Oct 202016 Oct 202316 Oct 2024
32juve.worldGoDaddy.com, LLC2 Dec 202013 Jan 20242 Dec 2023
33juve.techAscio Technologies, Inc. Danmark - Filial af Ascio…15 Jul 202116 Jul 202515 Jul 2026
34juve.solutionsAscio Technologies, Inc. Danmark - Filial af Ascio…15 Jul 202115 Jul 202515 Jul 2026
35juve.academyTucows Domains Inc.3 Sep 20217 Sep 20223 Sep 2023
36juve.ccAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Mar 20157 Nov 20216 Mar 2025
37juve.websiteeNom, Inc.8 Sep 20228 Sep 20228 Sep 2023
38juve.coffeeNameCheap, Inc.9 Oct 202220 Nov 20239 Oct 2023
39juve.com.coPDR Ltd. d/b/a PublicDomainRegistry.com5 Jul 201910 Jul 20235 Jul 2023
40juve.dk-4 Sep 2018-30 Sep 2026
41juve.ae----
42juve.co.nzKey-Systems GmbH5 Nov 20103 Sep 2025-
43juve.asiaAscio Technologies, Inc. Danmark - Filial af Ascio…21 Mar 200824 Jul 202521 Mar 2026
44juve.com.br-29 Apr 201025 Apr 202429 Apr 2026
45juve.oneTucows Domains Inc.1 Feb 202314 Mar 20251 Feb 2025
46juve.cnEPAG Domainservices GmbH11 Apr 2005-11 Apr 2026
47juve.instituteGoogle, Inc.8 Feb 20236 Feb 20248 Feb 2024
48juve.net.cn????????????25 Mar 2024-25 Mar 2026
49juve.spaceNameCheap, Inc.6 May 201818 Jun 20236 May 2023
50juve.com.au--29 Dec 2024-
51juve.au--24 Dec 2024-
52juve.fun1&1 Internet AG7 Oct 202413 Nov 20247 Oct 2025
53juve.ioMarkMonitor Inc.28 Feb 20191 Feb 202528 Feb 2026
54juve.it-10 Mar 200012 Nov 202412 Nov 2025
55juve.nl-10 May 201224 Apr 2023-
56juve.socialGoDaddy.com, LLC29 Apr 202310 Jul 202429 Apr 2024
57juve.plNamware.com, Inc.13 Mar 201918 Feb 202513 Mar 2026
58juve.shopTucows Domains Inc.18 Oct 202018 Nov 202418 Oct 2025
59juve.pubAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…3 Sep 20184 Sep 20233 Sep 2024
60juve.studioCommuniGal Communication Ltd.27 Sep 2024-27 Sep 2026
61juve.beautyGoDaddy.com, LLC29 Aug 202330 Aug 202529 Aug 2026
62juve.ro-16 Oct 2001-13 Oct 2029
63juve.betCommuniGal Communication Ltd.--28 Jan 2026
64juve.inDynadot, LLC10 Dec 202024 Aug 202510 Dec 2028
65juve.skinGoDaddy.com, LLC11 Mar 202427 May 202511 Mar 2026
66juve.fanGoDaddy.com, LLC24 Mar 20244 Jun 202524 Mar 2025
67juve.ru-27 Mar 2007-27 Mar 2026
68juve.hu-11 Apr 2003--
69juve.se-19 Jul 202419 Jul 202419 Jul 2026
70juve.sk-8 Feb 202110 Mar 20258 Feb 2026
71juve.groupChengdu West Dimension Digital Technology Co., Ltd…24 Nov 202424 Nov 202424 Nov 2025
72juve.co.idReserved7 Feb 20149 Feb 20257 Feb 2026
73juve.runGoDaddy.com, LLC9 Mar 202514 Mar 20259 Mar 2026
74juve.appGoDaddy.com, LLC9 Mar 202514 Mar 20259 Mar 2026
75juve.coGoDaddy.com, LLC30 Jun 20236 Jul 202530 Jun 2026
76juve.meGoDaddy.com, LLC7 Oct 201414 Jun 20247 Oct 2025
77juve.frEPAG Domainservices GmbH23 May 20081 Jan 202510 Mar 2026
78juve.mobiChengdu West Dimension Digital Technology Co., Ltd…6 Aug 20256 Aug 20256 Aug 2026
79juve.schoolKey-Systems GmbH18 Sep 202518 Sep 202518 Sep 2026
80juvenilediabetestreatment.comNameCheap, Inc.18 Nov 201718 Nov 201718 Nov 2018
81juve1897.netTucows Domains Inc.21 Sep 20081 Sep 202521 Sep 2026
82juvena.comMesh Digital Limited14 Jan 199812 Jan 202513 Jan 2026
83juvefc.comTucows Domains Inc.1 Sep 20022 Aug 20251 Sep 2026
84juvemania.it-4 Aug 201720 Aug 20254 Aug 2026
85juvenews24.comTucows Domains Inc.7 Jun 201613 Feb 20257 Jun 2026
86juventuz.orgPorkbun, LLC8 Jan 201212 Jan 20258 Jan 2026
87juve-fans.comDropCatch.com 1219 LLC30 Apr 201930 Apr 201930 Apr 2020
88juvederm.comMarkMonitor Inc.2 May 200128 Jul 20252 May 2026
89juventusmember.comTucows Domains Inc.22 Feb 200712 Nov 202422 Feb 2026
90juvepontedera.it-24 Sep 200324 Oct 20248 Oct 2025
91juvenileprobationcareers.comDynamic Network Services, Inc.15 Jul 201128 Aug 202515 Jul 2025
92juvestore.comTucows Domains Inc.17 Jun 200113 Feb 202517 Jun 2026
93juventuscosmetic.comGoDaddy.com, LLC8 Apr 20119 Apr 20258 Apr 2026
94juvenews.netNameCheap, Inc.7 Sep 20257 Sep 20257 Sep 2026
95juventus.comTucows Domains Inc.24 Sep 19989 Jul 202523 Sep 2026
96juventusarabia.netTucows Domains Inc.31 Jul 201931 Jul 201931 Jul 2020
97juvelive.it-22 Jan 20107 Feb 202522 Jan 2026
98juvellio.jp-24 Dec 20109 Apr 201231 Dec 2012
99juventus-fr.comInternet Domain Services BS Corp21 Jun 200419 Jun 202521 Jun 2026
100juvepoland.comOVH sas28 Oct 200317 Sep 202428 Oct 2026
101juvesoccerschool.comMoniker Online Services LLC13 May 202010 Jun 202513 May 2026
102juventude.gov.br----
103juventudrosada.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Mar 20161 Mar 20161 Mar 2017
104juventudybelleza.comeNom, Inc.2 Mar 201023 Feb 20252 Mar 2026
105juventus-bulgaria.comGoDaddy.com, LLC15 Nov 200516 Nov 202415 Nov 2025
106juveatrestelle.itRealtime Register B.V.31 Aug 20238 Apr 20258 Apr 2026
107juvecaserta.it-13 Jun 200323 Oct 20247 Oct 2025
108juvela.com.tw-7 Sep 2014-7 Sep 2015
109juvemagazine.it-23 Oct 201312 Sep 20259 Aug 2026
110juvenes.fi-7 Jul 200927 Jul 20127 Jul 2017
111juveniapuszczykowo.pl-20 Sep 201121 Sep 201620 Sep 2017
112juvenileinstructor.orgGoDaddy.com, LLC13 Nov 200728 Dec 202413 Nov 2025
113juventibus.comGoDaddy.com, LLC27 Mar 201328 Mar 202527 Mar 2026
114juventude.com.br-15 May 199719 May 202515 May 2034
115juventuschina.com.cn-24 Aug 2007-24 Aug 2026
116juventusclubindonesia.comCV. Rumahweb Indonesia27 Jul 200926 Jul 202527 Jul 2026
117juventusfanclub.euSite Leader, Inc.---
118juventusmania.netGoDaddy.com, LLC5 Apr 200218 May 20255 Apr 2026
119juverest.comGoDaddy.com, LLC13 Sep 201014 Sep 202413 Sep 2025
120juventudprm.comGoDaddy.com, LLC22 Oct 201422 Oct 201422 Oct 2015
121juventudconelprm.comGoDaddy.com, LLC22 Oct 201422 Oct 201422 Oct 2015
122juvencavazos.comNetwork Solutions, LLC21 Oct 201419 Oct 201721 Oct 2018
123juvelierereview.comName.com, Inc.22 Oct 201422 Oct 201422 Oct 2015
124juvedocqatar.comDomain.com, LLC22 Oct 20147 Oct 201622 Oct 2017
125juvedermaustin.comKey-Systems GmbH26 Jul 202126 Jul 202126 Jul 2022
126juvero.netGMO Internet Inc.20 Oct 201420 Oct 201420 Oct 2015
127juventudenluchachile.orgGoDaddy.com, LLC19 Oct 201419 Oct 201419 Oct 2015
128juveno.usGoDaddy.com, LLC19 Oct 201419 Oct 201418 Oct 2015
129juventusdocksa.comNetwork Solutions, LLC22 Oct 201422 Oct 201422 Oct 2015
130juventudpresbiteriana.comCNOBIN INFORMATION TECHNOLOGY LIMITED9 Dec 20219 Dec 20219 Dec 2022
131juventudmercosur.comGoDaddy.com, LLC22 Oct 201422 Oct 201422 Oct 2016
132juvelmag.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Oct 201422 Oct 201422 Oct 2015
133juventudyvigor.comTucows Domains Inc.24 Dec 202424 Dec 202424 Dec 2025
134juventus.hu-6 Aug 1996--
135juvenaljustice.ru-15 Oct 2009-15 Oct 2025
136juventusfc.ir----
137juvenews.eu----
138juvelirum.ru-13 Feb 2013-13 Feb 2026
139juventus.ir----
140juventus.ru-28 Apr 2017-28 Apr 2026
141juventushungary.hu-6 May 2008--
142juveros-shop.ru-8 Sep 2008-8 Sep 2026
143juventudrebelde.cu----
144juventus.kr-22 Apr 200717 Oct 201722 Apr 2021
145juvenalorden.netBinero AB21 Oct 201421 Oct 201421 Oct 2015
146juvet.comKey-Systems GmbH5 Nov 19996 Nov 20245 Nov 2025
147juventudinformada.com.ar----
148juventusvsbarcelonalivestreamscores.comGMO Internet Inc.10 Sep 201910 Sep 201910 Sep 2020
149juventud90seg.comGoDaddy.com, LLC31 May 201531 May 201531 May 2016
150juventudlajauretche.comWild West Domains, LLC23 Oct 201423 Oct 201423 Oct 2015
151juventudcogoppr.comTucows Domains Inc.24 Oct 201428 Oct 201724 Oct 2017
152juvethailand.comKey-Systems GmbH26 Dec 202426 Dec 202426 Dec 2025
153juventa-spb.infoTLDs LLC dba SRSplus18 Feb 200831 Mar 202518 Feb 2028
154juventud-valencia.es----
155juventinita.comMAFF Inc.13 Sep 202222 Nov 202313 Sep 2023
156juvenile-books.comName.com, Inc.24 Oct 201425 Oct 201424 Oct 2015
157juventudybelleza.infoGoDaddy.com, LLC21 Apr 201521 Jun 201521 Apr 2016
158juvent.comGoDaddy.com, LLC10 Mar 20034 Mar 202410 Mar 2029
159juventussoft.comTucows Domains Inc.31 Aug 20244 Sep 202531 Aug 2026
160juventudchat.comGoDaddy.com, LLC24 May 20134 May 202524 May 2026
161juvexinproline.comGoDaddy.com, LLC24 May 201025 May 201524 May 2016
162juventusdei.org----
163juvenilepie.comregister.com, Inc.25 Oct 201425 Oct 201425 Oct 2015
164juvenile.infoNetwork Solutions, LLC8 Oct 20237 Oct 202414 Jan 2026
165juvedermplano.comGoDaddy.com, LLC28 May 201029 May 201528 May 2016
166juvedermmissionvalleysandiego.comGoDaddy.com, LLC30 May 201231 May 201530 May 2016
167juventussc.comWild West Domains, LLC30 May 200831 May 201530 May 2016
168juventudkehila.orgGoDaddy.com, LLC30 May 201411 Jun 201530 May 2016
169juvedermbasics.comGoDaddy.com, LLC3 Jun 20084 Jun 20153 Jun 2016
170juventudescolombia.orgDynadot4 LLC20 Aug 201528 Jul 201720 Aug 2018
171juveniledata.comGoDaddy.com, LLC3 Jun 20023 Sep 20243 Jun 2025
172juvesia.org----
173juvesia.infoGoDaddy.com, LLC4 Jun 20144 Jun 20154 Jun 2016
174juvenor.comGoDaddy.com, LLC25 Aug 201526 Aug 202525 Aug 2026
175juvenilelawyer.netGoDaddy.com, LLC27 Aug 202528 Aug 202527 Aug 2026
176juventust.comGoDaddy.com, LLC23 May 201324 May 201523 May 2016
177juvens.orgregister.com, Inc.4 Sep 20126 Nov 20144 Sep 2019
178juventustestosterone.comGoDaddy.com, LLC23 May 201324 May 201523 May 2016
179juventudadefis.orgWild West Domains, LLC22 May 20133 Jun 201522 May 2016
180juvesia.comGoDaddy.com, LLC4 Jun 201416 Jun 20154 Jun 2016
181juvesia.netGoDaddy.com, LLC4 Jun 20145 Jun 20154 Jun 2016
182juvenilejusticeprobationofficerassociation.comGoDaddy.com, LLC5 Jun 20115 Jun 20155 Jun 2016
183juvel-tech.coGoDaddy.com, LLC5 Jun 201410 Jun 20154 Jun 2015
184juvel-tech.netGoDaddy.com, LLC5 Jun 20146 Jun 20155 Jun 2016
185juvel-tech.comGoDaddy.com, LLC5 Jun 20146 Jun 20155 Jun 2016
186juvenilejusticeprobationofficerassociation.orgGoDaddy.com, LLC5 Jun 201117 Jun 20155 Jun 2016
187juvel-tech.infoGoDaddy.com, LLC5 Jun 20145 Jun 20155 Jun 2016
188juventusnewton.comGoDaddy.com, LLC27 Oct 201427 Oct 201427 Oct 2015
189juveleven.comGoDaddy.com, LLC10 Jul 201412 Jul 201410 Jul 2015
190juvenile.netGoDaddy.com, LLC16 Jun 201017 Jun 202516 Jun 2026
191juventudebatista.comeNom, Inc.31 Jul 20095 Aug 202531 Jul 2026
192juvenileiis.orgeNom, Inc.11 Jul 201613 Jun 201711 Jul 2018
193juvenews.comeNom, Inc.18 May 201021 Aug 202518 May 2026
194juventudsinlimites.comHosting Concepts B.V. dba Openprovider12 Dec 202112 Dec 202112 Dec 2022
195juvenilelawyersandiego.comGoDaddy.com, LLC2 Dec 200921 Apr 20152 Dec 2015
196juventudargentina.comNetwork Solutions, LLC16 Nov 201618 Nov 201716 Nov 2018
197juvenilediabetesrx.comGoDaddy.com, LLC29 Aug 20129 Jul 201429 Aug 2015
198juventudpnp.comGoDaddy.com, LLC24 Sep 201411 Jan 201524 Sep 2015
199juvenilecriminalattorney.comGoDaddy.com, LLC13 Dec 201114 Dec 202413 Dec 2025
200juvenilecriminalattorneys.comGoDaddy.com, LLC4 Jan 20124 Jan 20254 Jan 2026
201juvebo.comAlethia Domains, LLC27 Oct 20224 Dec 202327 Oct 2024
202juvebot.comGoDaddy.com, LLC9 Aug 20089 Aug 20259 Aug 2026
203juvecream.comGoDaddy.com, LLC2 Aug 20085 Aug 20252 Aug 2026
204juvefit.comGoDaddy.com, LLC2 Aug 20085 Aug 20252 Aug 2026
205juvegan.comGoDaddy.com, LLC2 Aug 20085 Aug 20252 Aug 2026
206juvegym.comGoDaddy.com, LLC2 Aug 20085 Aug 20252 Aug 2026
207juvehealth.comGoDaddy.com, LLC24 Aug 200817 May 202524 Aug 2026
208juveimage.comGoDaddy.com, LLC7 Aug 200817 Sep 20247 Aug 2024
209juvejeans.comGoDaddy.com, LLC15 Mar 20243 Jun 202515 Mar 2026
210juvelax.comGoDaddy.com, LLC2 Aug 20085 Aug 20252 Aug 2026
211juvelotion.comGoDaddy.com, LLC2 Aug 200818 Apr 20152 Aug 2015
212juveslim.comGoDaddy.com, LLC9 Aug 20089 Aug 20259 Aug 2026
213juvespa.comGoDaddy.com, LLC2 Aug 20085 Aug 20252 Aug 2026
214juvestyle.comGoDaddy.com, LLC10 Sep 20086 Sep 202510 Sep 2026
215juvetec.comGoDaddy.com, LLC2 Aug 200822 Jul 20252 Aug 2026
216juvetek.comGoDaddy.com, LLC2 Aug 20085 Aug 20252 Aug 2026
217juvewater.comGoDaddy.com, LLC9 Aug 20089 Aug 20259 Aug 2026
218juveweb.comGoDaddy.com, LLC24 Aug 20088 Sep 202524 Aug 2026
219juvewrap.com-20 Oct 202222 Dec 202320 Oct 2023
220juvegreen.comGoDaddy.com, LLC11 Dec 200815 Nov 202411 Dec 2025
221juvenilehumor.comGoDaddy.com, LLC20 Apr 20156 May 202520 Apr 2026
222juvecafe.comChengdu West Dimension Digital Technology Co., Ltd…24 May 201924 May 201924 May 2020
223juvenilejusticecommission.comeNom, Inc.13 Nov 20098 Nov 202413 Nov 2025
224juveniledivision.comeNom, Inc.25 Dec 201227 Dec 202425 Dec 2025
225juventusfootball.clubGoDaddy.com, LLC27 Aug 202127 Aug 202127 Aug 2022
226juvenilejury.comGoDaddy.com, LLC20 Apr 200716 Mar 202520 Apr 2026
227juvero.comGoDaddy.com, LLC14 Jun 201420 Jun 202514 Jun 2026
228juvenileofficer.comGoDaddy.com, LLC15 Aug 200116 Aug 202515 Aug 2026
229juventino-design.comNetwork Solutions, LLC29 Oct 201429 Oct 201429 Oct 2015
230juvenilejudgetn.comZoomRegistrar LLC19 Jun 201420 Jun 201719 Jun 2018
231juvelauden.comGMO Internet Inc.2 Aug 202431 Jul 20252 Aug 2026
232juveelipood.comGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
233juvedermedgewater.comGoDaddy.com, LLC29 Oct 201410 Jan 202529 Oct 2024
234juvenilecrime.orgDropCatch.com 1381 LLC25 Jul 202525 Jul 202525 Jul 2026
235juventusgroup.comJiangsu Bangning Science and technology Co. Ltd.1 Dec 20211 Dec 20211 Dec 2022
236juvederm4free.comGoDaddy.com, LLC29 Sep 201030 Sep 201329 Sep 2015
237juvedermforfree.comGoDaddy.com, LLC29 Sep 201030 Sep 201329 Sep 2015
238juvenile.meNameCheap, Inc.20 Apr 201926 Mar 202520 Apr 2026
239juvem.comPSI-USA, Inc. dba Domain Robot24 May 200913 Jul 202524 May 2026
240juvenilejusticesystem.comeNom, Inc.1 Nov 200127 Dec 202422 Dec 2025
241juvenilejusticeservices.comeNom, Inc.4 May 200910 May 20254 May 2026
242juvenilecriminallaw.comeNom, Inc.12 Nov 20098 Nov 202412 Nov 2025
243juveniledrugcourt.comeNom, Inc.24 Aug 201014 Aug 202524 Aug 2026
244juvenilehealth.comeNom, Inc.25 Jan 201130 Jan 202525 Jan 2026
245juventudalrescate.comeNom, Inc.26 Jan 20119 Mar 202526 Jan 2025
246juventudradical.comeNom, Inc.31 Aug 20116 Aug 202531 Aug 2026
247juvelie.infoGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
248juvenilediabetescare.comeNom, Inc.19 Nov 20112 Feb 201519 Nov 2015
249juvenilecity.comeNom, Inc.17 Apr 201210 May 201717 Apr 2018
250juvenilejudge.comeNom, Inc.8 Apr 200610 Apr 20258 Apr 2026
251juventudydemocracia.orgDomain.com, LLC29 Oct 201414 Oct 201629 Oct 2017
252juvening.useNom, Inc.29 Oct 201429 Oct 201428 Oct 2015
253juvenilemerchandise.comGoDaddy.com, LLC13 Jul 200710 Jul 201413 Jul 2015
254juventus-shqip.info1&1 Internet AG30 Oct 2014-30 Oct 2015
255juveniledefensefl.comGoDaddy.com, LLC3 Jan 200722 Apr 201529 Nov 2017
256juveniledefendant.comPorkbun, LLC3 Jan 200715 Oct 202429 Nov 2025
257juvenilelaw.comeNom, Inc.19 Jun 20013 Jul 202519 Jun 2026
258juventas.coGoDaddy.com, LLC12 Oct 201612 Oct 201611 Oct 2017
259juventaclub.comTucows Domains Inc.25 May 202525 May 202525 May 2026
260juveniletelehealth.comGoDaddy.com, LLC12 Mar 201428 Feb 201512 Mar 2016
261juventusmagazine.comRegister.it SPA18 Oct 201620 Nov 202418 Oct 2025
262juvelkompaniet.comTucows Domains Inc.31 Oct 20144 Nov 201531 Oct 2016
263juvenilefiction.comGoDaddy.com, LLC16 Sep 202013 Sep 202416 Sep 2025
264juvenator.comGoDaddy.com, LLC24 Sep 200330 Sep 202424 Sep 2025
265juvenalsanso.comLaunchpad, Inc.2 Nov 200518 Oct 20242 Nov 2025
266juvenilecrime.comGoDaddy.com, LLC11 Feb 200016 Apr 202511 Feb 2031
267juven.ru-7 Apr 2025-7 Apr 2026
268juvenilecriminallawyer.comGoDaddy.com, LLC5 Sep 20086 Sep 20255 Sep 2026
269juventuscosmeticcenter.comGoogle, Inc.6 Sep 202122 Aug 20256 Sep 2026
270juventudactiva.comTurnCommerce, Inc. DBA NameBright.com11 Nov 20155 Nov 202011 Nov 2025
271juvena.net-31 May 202126 Jun 202431 May 2026
272juvenilelawattorney.comGoDaddy.com, LLC8 Oct 200810 Feb 20258 Oct 2025
273juvenal.bizGoDaddy.com, LLC27 Nov 20167 Jan 201826 Nov 2017
274juvenal.orgLaunchpad, Inc.18 Dec 20198 Dec 202418 Dec 2025
275juveniledrugabuse.comGoDaddy.com, LLC28 Mar 201427 Mar 201528 Mar 2016
276juvenilesolutions.comGoDaddy.com, LLC30 Apr 199918 Apr 202530 Apr 2026
277juvenileattorney.orgDreamHost, LLC23 May 201127 Apr 202523 May 2026
278juvenilecomedy.comNameCheap, Inc.6 Feb 202523 Mar 20256 Feb 2026
279juvenileriskanalytics.comGoDaddy.com, LLC26 Oct 201127 Apr 201526 Oct 2016
280juvekim.fi-25 Nov 20043 Nov 201025 Nov 2015
281juvenilediabetesforum.comGoDaddy.com, LLC13 Jan 201713 Jan 201713 Jan 2018
282juventinorosas.comGoDaddy.com, LLC19 May 201524 May 202519 May 2026
283juvenilledetentioncenter.comMoniker Online Services LLC29 Nov 20058 Jun 201529 Mar 2016
284juventudviva.netPDR Ltd. d/b/a PublicDomainRegistry.com19 Apr 201612 Apr 201719 Apr 2018
285juvenile.co-20 Jul 201017 Jul 202519 Jul 2026
286juvesa.comDynadot, LLC25 Feb 200428 Aug 202425 Feb 2026
287juventudestereo.comRealtime Register B.V.12 Aug 202221 Aug 202512 Aug 2026
288juvenilehockey.comNameCheap, Inc.5 Feb 20157 Jan 20255 Feb 2026
289juvenilelawfl.comGoDaddy.com, LLC10 Jun 201011 Jun 201510 Jun 2016
290juvenate-ltd.comNameCheap, Inc.28 Jul 202528 Jul 202528 Jul 2026
291juventutemmichigan.comNameCheap, Inc.21 Mar 201211 Mar 202521 Mar 2026
292juventusstars.comTucows Domains Inc.31 Oct 20134 Nov 201431 Oct 2015
293juventudvaldemorillo.comRealtime Register B.V.3 Nov 201425 Sep 20243 Nov 2025
294juventudnecesaria.com10dencehispahard, S.L.3 Nov 20143 Nov 20143 Nov 2015
295juventixq10.com1&1 Internet AG4 Nov 20144 Nov 20144 Nov 2015
296juventix.comGoDaddy.com, LLC14 Jun 20179 Jun 202514 Jun 2027
297juveliry-urala.ru-1 Sep 2010-1 Sep 2026
298juventhealth.comGoDaddy.com, LLC2 Dec 20133 Dec 20242 Dec 2025
299juventudnecesaria.org10dencehispahard, S.L.3 Nov 20143 Nov 20143 Nov 2015
300juventudenmassa.orgName.com, Inc.3 Nov 20144 Nov 20143 Nov 2015
301juvederm.ca-12 Nov 200221 Jul 202512 Nov 2025
302juvenon.com1&1 Internet AG15 Feb 200016 Feb 202215 Feb 2026
303juventuscoin.comTucows Domains Inc.16 Mar 202227 May 202316 Mar 2023
304juventudesmedellin.comHello Internet Corp.28 Jul 202528 Jul 202528 Jul 2026
305juveniles-movie.comGoDaddy.com, LLC4 Nov 20145 Nov 20244 Nov 2026
306juvecoin.comGoogle, Inc.13 May 202129 Apr 202513 May 2026
307juventudymilenio.comGoDaddy.com, LLC14 Jun 200715 Jun 201514 Jun 2016
308juvelry.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Jul 20208 Aug 202023 Jul 2027
309juveforever.comTurnCommerce, Inc. DBA NameBright.com18 Aug 201412 Aug 202018 Aug 2025
310juvenimss.com-5 Nov 20165 Nov 20165 Nov 2017
311juventusconsulting.comTucows Domains Inc.31 Jan 20174 Feb 201831 Jan 2018
312juvenilereform.comGoDaddy.com, LLC6 Nov 20146 Nov 20146 Nov 2015
313juvenilejusticedepartment.comFabulous.com Pty Ltd.18 Oct 20053 Nov 201718 Oct 2018
314juvenileoffenses.comGoDaddy.com, LLC31 Jan 200824 Mar 201531 Jan 2016
315juventudunidafc.comGKG.NET, INC.19 Aug 201419 Aug 201419 Aug 2017
316juverly.comGoDaddy.com, LLC1 Sep 20242 Sep 20251 Sep 2026
317juvenilereform.infoGoDaddy.com, LLC6 Nov 20146 Nov 20146 Nov 2015
318juvenal.infoGoDaddy.com, LLC5 Nov 20145 Nov 20145 Nov 2015
319juvelierecomplete.comeNom, Inc.20 Aug 201420 Aug 201420 Aug 2015
320juveliereextra.comeNom, Inc.20 Aug 201420 Aug 201420 Aug 2015
321juvelierepro.comeNom, Inc.20 Aug 201420 Aug 201420 Aug 2015
322juvelieretotal.comeNom, Inc.20 Aug 201420 Aug 201420 Aug 2015
323juvenescenceboutique.comGoDaddy.com, LLC20 Aug 20147 Aug 201620 Aug 2017
324juvenrus.comeNom, Inc.19 Feb 201918 Feb 201919 Feb 2020
325juventuc.comTucows Domains Inc.31 Mar 201931 Mar 201931 Mar 2020
326juventudesandalucistas.orgNameCheap, Inc.5 Jul 20245 Jul 20255 Jul 2026
327juventudredefiniendo.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Jan 201512 Jan 201512 Jan 2016
328juvensana.comMesh Digital Limited6 Nov 20146 Nov 20246 Nov 2025
329juveliereinfo.comName.com, Inc.6 Nov 20146 Nov 20146 Nov 2015
330juvenescer.comLaunchpad, Inc.21 Aug 20146 Aug 202521 Aug 2026
331juventuspizza.comWild West Domains, LLC21 Aug 201417 Jul 202521 Aug 2026
332juvewatchinternational.comWeb Commerce Communications Limited dba WebNic.cc21 Aug 201421 Aug 201421 Aug 2015
333juvebody.comGoDaddy.com, LLC8 Nov 20208 Nov 20208 Nov 2021
334juvebodyfitness.comeNom, Inc.7 Feb 20157 Feb 20157 Feb 2016
335juvel.netCSL Computer Service Langenbach GmbH d/b/a joker.c…4 Feb 20121 Feb 20254 Feb 2026
336juventudurjc.comGMO Internet Inc.22 Apr 20154 Jun 202522 Apr 2025
337juventudemprendedora.org-4 May 20164 May 20164 May 2017
338juvenilereform.orgGoDaddy.com, LLC6 Nov 20146 Nov 20146 Nov 2016
339juvenilereform.netGoDaddy.com, LLC6 Nov 20146 Nov 20146 Nov 2015
340juvelyrika.netNordreg AB18 Feb 20109 Apr 202518 Feb 2026
341juveliereskin.comGoDaddy.com, LLC13 Feb 202326 Mar 202413 Feb 2024
342juvelighting.comTucows Domains Inc.19 Aug 201323 Aug 201419 Aug 2015
343juvenilejuvenile.comGMO Internet Inc.11 Nov 201915 Oct 202410 Nov 2025
344juvenexspany.comGoDaddy.com, LLC12 Aug 201412 Aug 201412 Aug 2015
345juvenexspaus.comGoDaddy.com, LLC12 Aug 201412 Aug 201412 Aug 2015
346juventusfcohio.comGoogle, Inc.27 Jun 201927 Jul 202027 Jun 2020
347juvenilelist.comWild West Domains, LLC9 Nov 20149 Nov 20149 Nov 2015
348juveder.comHangzhou AiMing Network Co., LTD11 Mar 202216 Apr 202511 Mar 2025
349juventudeon.netGoDaddy.com, LLC13 Aug 201413 Aug 201413 Aug 2015
350juvedermvolumalargo.comGoDaddy.com, LLC25 Aug 201426 Aug 201625 Aug 2017
351juvenile-domine.comRegister.it SPA25 Aug 201425 Aug 201425 Aug 2015
352juveniasimoesarquitetura.comRealtime Register B.V.27 Aug 201427 Aug 201427 Aug 2015
353juvetube.netTucows Domains Inc.15 Aug 201419 Aug 201515 Aug 2016
354juvenesvolley.comTucows Domains Inc.7 Nov 201011 Nov 20147 Nov 2015
355juvenilebootcamps.orgMoniker Online Services LLC29 Jun 20062 Jul 202529 Jun 2026
356juventus24.comTucows Domains Inc.4 Jul 20248 Jul 20254 Jul 2026
357juvephotography.comGoDaddy.com, LLC21 Jan 202222 Jan 202421 Jan 2026
358juvercinah.comTucows Domains Inc.28 Aug 20141 Sep 201828 Aug 2018
359juventudconfelixvasquez.comGoDaddy.com, LLC16 Aug 201416 Aug 201416 Aug 2015
360juventusungrandeamore.comWild West Domains, LLC11 Nov 201412 Nov 201611 Nov 2017
361juventudmusicaldominicana.comGoDaddy.com, LLC11 Nov 201412 Nov 201611 Nov 2018
362juventasmobile.comTucows Domains Inc.11 Sep 201415 Sep 201711 Sep 2017
363juventudlac.orgPDR Ltd. d/b/a PublicDomainRegistry.com11 Sep 201416 Aug 202511 Sep 2026
364juvenisbiomed.comeNom, Inc.1 Dec 201613 Jan 20181 Dec 2017
365juventuslegends.comTucows Domains Inc.4 May 201413 Feb 20254 May 2026
366juvenile-defense.comGoDaddy.com, LLC12 Sep 201412 Jul 201612 Sep 2017
367juvent.infoGoDaddy.com, LLC11 Oct 201625 Nov 202411 Oct 2025
368juvelirka.netPDR Ltd. d/b/a PublicDomainRegistry.com13 Sep 201413 Sep 201413 Sep 2015
369juvelieresite.comGoDaddy.com, LLC1 Sep 20141 Sep 20141 Sep 2015
370juventinocisneros.comWild West Domains, LLC31 Aug 201431 Aug 201431 Aug 2015
371juventudeprata.comVitalwerks Internet Solutions, LLC DBA No-IP31 Aug 20146 Sep 201531 Aug 2016
372juventusclublomagna.comNetwork Solutions, LLC19 Aug 202331 Oct 202419 Aug 2024
373juvesjumpers.comTucows Domains Inc.28 Aug 20111 Sep 201428 Aug 2015
374juvelume.orgTucows Domains Inc.10 Sep 201014 Sep 201410 Sep 2015
375juventudadventistaenaccion.comGoDaddy.com, LLC15 Nov 201429 Jan 201815 Nov 2019
376juvenilesmusic.comGoDaddy.com, LLC17 Jan 201816 Jan 202517 Jan 2026
377juventudesradio.comeNom, Inc.1 Sep 20141 Sep 20141 Sep 2015
378juveponce.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Sep 201411 Aug 20161 Sep 2017
379juvenews.infoKey-Systems GmbH30 Nov 20214 Nov 202430 Nov 2025
380juveninteriors.comTucows Domains Inc.29 Aug 20122 Sep 201429 Aug 2015
381juventudnacional.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Mar 202110 Mar 202110 Mar 2022
382juventusclubfabrizioravanelli.comTucows Domains Inc.29 Aug 20122 Sep 201429 Aug 2015
383juveprvip.comGoDaddy.com, LLC2 Sep 20142 Sep 20142 Sep 2015
384juvevip.comGoDaddy.com, LLC2 Sep 20142 Sep 20142 Sep 2015
385juvenatedsolutions.comGoDaddy.com, LLC15 Sep 201416 Sep 202315 Sep 2025
386juvedermtn.comGoDaddy.com, LLC3 Sep 20143 Sep 20143 Sep 2015
387juvelieres.netGMO Internet Inc.5 Apr 20165 Apr 20165 Apr 2017
388juvenatesport.comTucows Domains Inc.31 Aug 20104 Sep 201431 Aug 2015
389juvenda.comWild West Domains, LLC3 Sep 20144 Sep 20253 Sep 2026
390juverealestate.comGoDaddy.com, LLC16 Sep 200531 Dec 202416 Sep 2027
391juvenilemovement.orgGoDaddy.com, LLC14 Nov 201415 Nov 201614 Nov 2018
392juventudcristiana.comNameKing.com Inc.22 Nov 202323 Nov 202422 Nov 2025
393juventusclubdocmotogp.comRegister.it SPA4 Sep 20144 Sep 20144 Sep 2015
394juventutemlehighvalley.orgGoDaddy.com, LLC4 Sep 20145 Sep 20254 Sep 2026
395juventudevencedora.comGoDaddy.com, LLC16 Nov 201417 Nov 201416 Nov 2015
396juventosmania.netFabulous.com Pty Ltd.16 Aug 200618 Sep 201416 Aug 2015
397juvenileandtoys.usGoDaddy.com, LLC18 Sep 201418 Sep 201417 Sep 2015
398juvebeauty.comGoDaddy.com, LLC13 Jul 202424 Dec 202413 Jul 2027
399juvenalmaterialdeconstrucao.comGoDaddy.com, LLC5 Sep 20145 Sep 20145 Sep 2016
400juvenalzone.netPDR Ltd. d/b/a PublicDomainRegistry.com5 Sep 20145 Sep 20145 Sep 2015
401juveneu.orgGMO Internet Inc.6 Sep 20146 Sep 20146 Sep 2015
402juvenstore.comGoDaddy.com, LLC26 Oct 20227 Jan 202526 Oct 2024
403juventa.orgNameKing.com Inc.6 Dec 202319 Jan 20256 Dec 2024
404juventaseye.com-6 Sep 20146 Sep 20146 Sep 2017
405juventasskin.comGoogle, Inc.1 Sep 202223 Aug 20251 Sep 2026
406juvesiioskin.neteNom, Inc.5 Mar 20165 Mar 20165 Mar 2017
407juventusteamshop.comShanghai Meicheng Technology Information Co., Ltd19 Sep 201419 Sep 201419 Sep 2015
408juventus-journal.comNetowl, Inc.7 Sep 201419 Jul 20257 Sep 2026
409juveterna.comGoDaddy.com, LLC6 Sep 20146 Sep 20146 Sep 2015
410juventusclubdocmontoro.comTucows Domains Inc.14 Nov 201318 Nov 201414 Nov 2015
411juvenilesoutlet.comAcens Technologies, S.L.U.16 Nov 201211 Nov 202416 Nov 2025
412juvenilearthritisawareness.comGoDaddy.com, LLC17 Nov 201417 Nov 201417 Nov 2015
413juvesiioblogs.comeNom, Inc.20 Sep 201420 Sep 201420 Sep 2015
414juvern.comGoDaddy.com, LLC20 Sep 201421 Sep 202420 Sep 2026
415juventustech.comGoDaddy.com, LLC8 Sep 201416 Sep 20228 Sep 2026
416juvenilecasualty.netNameCheap, Inc.4 Dec 202215 Jan 20244 Dec 2023
417juventus-cn.comTucows Domains Inc.10 Dec 201527 Jul 202510 Dec 2026
418juvenilediabetessymptoms.netGMO Internet Inc.26 Nov 201526 Nov 201526 Nov 2016
419juventushistoriaenjedashurietemadhe.comGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2015
420juventure.netregister.com, Inc.30 Sep 201430 Sep 201430 Sep 2015
421juventustube.comDynadot, LLC9 Oct 202415 Oct 20249 Oct 2025
422juventusclubdoclameziaterme2012cm8.comTucows Domains Inc.15 Nov 201319 Nov 201415 Nov 2015
423juve1897.comTucows Domains Inc.27 Sep 200912 Sep 202527 Sep 2026
424juvenileis.comTucows Domains Inc.28 Sep 20062 Oct 201428 Sep 2015
425juvenaliatravel.comNominalia Internet S.L.22 Apr 201922 Apr 201922 Apr 2020
426juvenilelawtraining.comGoDaddy.com, LLC9 Sep 201427 Jul 20169 Sep 2017
427juvetunes.comGoDaddy.com, LLC9 Sep 201411 Sep 20169 Sep 2017
428juvey.comDynadot, LLC9 Sep 20149 Sep 20259 Sep 2026
429juvenile-court.comNameKing.com Inc.2 Oct 201424 Sep 20252 Oct 2026
430juventudarquibogota.orgGoDaddy.com, LLC2 Oct 201413 Oct 20162 Oct 2017
431juventudetocoista.orgeNom, Inc.9 Sep 20149 Sep 20149 Sep 2015
432juventudradiante.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Oct 20143 Oct 20143 Oct 2015
433juventudigital.orgDattatec.com SRL10 Sep 2014-10 Sep 2015
434juvenileis.netTucows Domains Inc.28 Sep 20062 Oct 201428 Sep 2015
435juventusfansqatar.comregister.com, Inc.4 Oct 20144 Oct 20144 Oct 2015
436juventudactiva.orgAnnulet LLC6 Oct 201113 Dec 20156 Oct 2017
437juveliwines.comTucows Domains Inc.22 Sep 201426 Sep 201722 Sep 2017
438juvenileoutfit.comeNom, Inc.22 Sep 201423 Sep 201422 Sep 2015
439juventudunida8.comNetwork Solutions, LLC22 Sep 201422 Sep 201422 Sep 2015
440juventus1x2.comGoto Domains LLC7 Dec 20197 Dec 20197 Dec 2020
441juvenexspanyc.comGoDaddy.com, LLC20 Nov 20148 Nov 202420 Nov 2033
442juvenilepetifile.comGoDaddy.com, LLC23 Sep 201424 Sep 201623 Sep 2017
443juveltrieste.comGoDaddy.com, LLC23 Sep 201424 Sep 201623 Sep 2018
444juve2006.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Dec 201420 Dec 201420 Dec 2015
445juvenilekillers.comGMO Internet Inc.18 Dec 201518 Dec 201518 Dec 2016
446juventudenprogresord.comTucows Domains Inc.4 Oct 20137 Oct 20144 Oct 2015
447juventudpopularneza.comGoDaddy.com, LLC7 Oct 20147 Oct 20147 Oct 2015
448juventudmasautonoma.comNetwork Solutions, LLC15 Dec 201515 Dec 201515 Dec 2016
449juvenileentertainment.comGoDaddy.com, LLC18 Aug 202118 Aug 202118 Aug 2022
450juvetoro.comNameCheap, Inc.25 Sep 202326 Sep 202425 Sep 2025
451juve2006.orgTucows Domains Inc.3 Oct 20067 Oct 20143 Oct 2015
452juventudurbana.orgPDR Ltd. d/b/a PublicDomainRegistry.com7 Oct 20147 Oct 20147 Oct 2015
453juventusvideo.comGoDaddy.com, LLC7 Oct 20147 Oct 20147 Oct 2015
454juvenexlash.comTucows Domains Inc.18 Nov 201322 Nov 201418 Nov 2015
455juveci.comHostinger, UAB3 Apr 20203 Apr 20203 Apr 2021
456juvedermandbotoxnyc.comGoDaddy.com, LLC8 Oct 201412 Jan 20248 Oct 2026
457juveni.comGoDaddy.com, LLC8 Oct 201410 Sep 20258 Oct 2026
458juventudrevolucionariamoderna.comGoDaddy.com, LLC8 Oct 20148 Oct 20148 Oct 2015
459juvelieres.orgGMO Internet Inc.13 Dec 201513 Dec 201513 Dec 2016
460juventudfuerteventura.orgCronon AG20 Nov 20144 Jan 202520 Nov 2025
461juventudesandalucistaselpuerto.orgOVH sas20 Nov 201420 Nov 201420 Nov 2015
462juvenexnyc.comGoDaddy.com, LLC3 Oct 20243 Oct 20253 Oct 2026
463juventusventiquattro.comTucows Domains Inc.29 Sep 20143 Oct 201529 Sep 2016
464juventudlevantate.comSquarespace Domains LLC4 Jul 20259 Jul 20254 Jul 2026
465juvenspark.comHiChina Zhicheng Technology Limited23 Nov 201423 Nov 201423 Nov 2015
466juvedermdfu.comMarkMonitor Inc.10 Oct 20148 Sep 202510 Oct 2026
467juvenomics.comMegazone Corp., dba HOSTING.KR10 Oct 201421 Aug 202410 Oct 2025
468juveedigital.comGoDaddy.com, LLC17 Oct 201417 Oct 201417 Oct 2015
469juventudestella.comFastDomain Inc.22 Oct 20234 Dec 202422 Oct 2024
470juventudesa.comDropCatch.com 873 LLC15 Dec 201616 Dec 201715 Dec 2018
471juveniltimoteo.comWild West Domains, LLC26 Sep 201426 Sep 201426 Sep 2015
472juvengo.comGoDaddy.com, LLC9 May 20232 Jul 20259 May 2026
473juve-e-juice.comGoDaddy.com, LLC12 Oct 201412 Oct 201412 Oct 2015
474juveejuice.comGoDaddy.com, LLC12 Oct 201431 Oct 201612 Oct 2020
475juventusclubdocbitetto.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Oct 201416 Sep 201712 Oct 2018
476juvessence.comGoDaddy.com, LLC5 Aug 20205 Aug 20255 Aug 2026
477juventuslebanon.comDomain.com, LLC24 Nov 20149 Nov 202424 Nov 2025
478juventusbeirut.comDomain.com, LLC24 Nov 20149 Nov 201724 Nov 2018
479juventashealthandbeauty.comGoDaddy.com, LLC24 Nov 201424 Nov 201424 Nov 2016
480juvening.comNameCheap, Inc.9 Dec 20249 Dec 20249 Dec 2025
481juvenilesmuebles.com10dencehispahard, S.L.18 Nov 20121 Dec 201518 Nov 2016
482juvebeirut.comDomain.com, LLC24 Nov 20149 Nov 201624 Nov 2017
483juventasurgicalcenter.comGoogle, Inc.14 Oct 201415 Jan 201514 Oct 2017
484juventasurgicalcentre.comGoogle, Inc.14 Oct 201415 Jan 201514 Oct 2017
485juventusagriculture.comGoDaddy.com, LLC14 Oct 201414 Oct 201414 Oct 2015
486juvenals.comTurnCommerce, Inc. DBA NameBright.com11 Feb 20165 Feb 202111 Feb 2026
487juventudenlucha.orgGoDaddy.com, LLC17 Oct 201417 Oct 201417 Oct 2015
488juvenilejusticevt.orgGMO Internet Inc.24 Nov 201421 Sep 201624 Nov 2017
489juveistra.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Oct 201415 Oct 201415 Oct 2015
490juvenilerecord.comDynadot, LLC30 Sep 202530 Sep 202530 Sep 2026
491juvenileshop.neteNom, Inc.15 Oct 201415 Oct 201415 Oct 2015
492juventudalerta.com1&1 Internet AG15 Oct 201415 Oct 201415 Oct 2015
493juveriaconsultancy.comBigRock Solutions Ltd.19 Oct 201420 Oct 201619 Oct 2017
494juventusclubdocprimoamore.comTucows Domains Inc.22 Nov 201326 Nov 201422 Nov 2015
495juvenilexanthogranuloma.comGoDaddy.com, LLC25 Nov 201425 Nov 201425 Nov 2015
496juvenalshiundu.comGoDaddy.com, LLC26 Nov 201427 Nov 202426 Nov 2025
497juvenalshiundu.infoGoDaddy.com, LLC26 Nov 201410 Jan 202526 Nov 2025
498juventudsandinista.comName.com, Inc.7 Jul 20187 Jul 20187 Jul 2021
499juvenilechoiceandawareness.comGoDaddy.com, LLC28 Nov 201430 Nov 201628 Nov 2018
500juventudesocialista.orgDynadot12 LLC17 Jul 202523 Aug 202517 Jul 2026
501juventusmania.orgURL Solutions, Inc.1 Aug 20171 Aug 20171 Aug 2018
502juvelhut.comeNom, Inc.1 Dec 20141 Dec 20141 Dec 2016
503juventudtransformadora.comNameCheap, Inc.14 Jul 202430 Jun 202514 Jul 2026
504juventudconproposito.comGoDaddy.com, LLC9 Sep 202120 Sep 20259 Sep 2026
505juvenile-court.netHostinger, UAB15 Feb 202517 Apr 202515 Feb 2026
506juventuss.comWeb Commerce Communications Limited dba WebNic.cc2 Aug 20182 Aug 20182 Aug 2026
507juvenilelawreview.comNamesilo, LLC5 Dec 201412 Jan 20185 Dec 2018
508juvedermbirmingham.comregister.com, Inc.26 Aug 201626 Aug 201626 Aug 2018
509juventude-adp-kilamba.comGoDaddy.com, LLC6 Dec 20146 Dec 20146 Dec 2015
510juventudesocialista.comJiangsu Bangning Science and technology Co. Ltd.24 Feb 202524 Feb 202524 Feb 2026
511juvenilelife.comTurnCommerce, Inc. DBA NameBright.com21 Jan 202015 Jan 202121 Jan 2026
512juvellenfes.comAscio Technologies, Inc. Danmark - Filial af Ascio…9 Dec 20149 Dec 20149 Dec 2015
513juvelbutiken.comGoDaddy.com, LLC12 Sep 202224 Oct 202312 Sep 2023
514juventudigc.comTucows Domains Inc.6 Dec 201010 Dec 20146 Dec 2015
515juvenilerehab.comTurnCommerce, Inc. DBA NameBright.com15 May 201825 Jun 202515 May 2025
516juvenilereasonableuseofforce.comGoDaddy.com, LLC12 Dec 201423 Feb 202512 Dec 2024
517juvelierecream.comeNom, Inc.12 Dec 201412 Dec 201412 Dec 2015
518juvelierebeauty.comeNom, Inc.12 Dec 201412 Dec 201412 Dec 2015
519juventudguevarista.orgDattatec.com SRL10 Dec 201420 Apr 201710 Dec 2017
520juvennile.comGoDaddy.com, LLC7 Nov 20247 Nov 20247 Nov 2026
521juvenileforceperceptions.comGoDaddy.com, LLC12 Dec 201413 Dec 202412 Dec 2026
522juvenile-me.comGoDaddy.com, LLC12 Dec 201412 Dec 201412 Dec 2015
523juvedermphilly.comGoDaddy.com, LLC12 Dec 201423 Feb 202512 Dec 2024
524juveniliabookscollective.comName.com, Inc.15 Dec 201415 Dec 201415 Dec 2015
525juverumors.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Dec 20147 Dec 201715 Dec 2018
526juveraproperties.comTucows Domains Inc.15 Dec 201416 Nov 202415 Dec 2025
527juvenilepictures.comGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2015
528juveplus.comGoDaddy.com, LLC16 Dec 201416 Dec 201416 Dec 2016
529juventudespoliticas.comDattatec.com SRL16 Dec 201416 Dec 201416 Dec 2015
530juventina.neteNom, Inc.15 Dec 201415 Dec 201415 Dec 2015
531juveniliabookscollective.orgName.com, Inc.15 Dec 201415 Dec 201415 Dec 2015
532juvenila.comGoDaddy.com, LLC17 Dec 201413 May 202517 Dec 2025
533juventudesantonioante.orgeNom, Inc.16 Dec 201416 Dec 201416 Dec 2015
534juventudcientifica.comIServeYourDomain.com LLC19 Jan 20244 Apr 202519 Jan 2025
535juventa-office.comBeijing Lanhai Jiye Technology Co., Ltd9 Mar 202110 Apr 20249 Mar 2024
536juventusbet.comGoDaddy.com, LLC29 Dec 20232 Mar 202529 Dec 2026
537juventudprofeta.comGoDaddy.com, LLC19 Dec 201419 Dec 201419 Dec 2015
538juventinoverme.comTucows Domains Inc.31 May 201831 May 201831 May 2019
539juvenilmente.comGoDaddy.com, LLC19 Dec 201419 Dec 201419 Dec 2015
540juventuddiferente.comGoDaddy.com, LLC29 Mar 201629 Mar 201629 Mar 2017
541juvetus.com-18 Jan 202313 Dec 202418 Jan 2026
542juvenilesoutet.comGoDaddy.com, LLC22 Dec 201422 Dec 201422 Dec 2015
543juvederm-au.comeNom, Inc.22 Dec 201422 Dec 201422 Dec 2015
544juvelen-antique.comAscio Technologies, Inc. Danmark - Filial af Ascio…22 Dec 201422 Dec 201422 Dec 2015
545juvesoccerschool.infoTucows Domains Inc.20 Dec 201324 Dec 201420 Dec 2015
546juvery.netNetowl, Inc.24 Dec 201425 Dec 202424 Dec 2024
547juventudesustentavel.comGoDaddy.com, LLC10 Apr 201610 Apr 201610 Apr 2017
548juventudmundial.comHongkong Domain Name Information Management Co., L…10 Nov 202113 Nov 202210 Nov 2022
549juvensol.comNetwork Solutions, LLC26 Dec 201426 Dec 201426 Dec 2015
550juvedermjerseycity.comGoDaddy.com, LLC26 Dec 20149 Mar 202526 Dec 2024
551juventustv.netNameCheap, Inc.31 Oct 2019-31 Oct 2020
552juventusonline.netPDR Ltd. d/b/a PublicDomainRegistry.com26 Dec 20144 Jan 201626 Dec 2017
553juvesims.com-15 Jul 201615 Jul 201615 Jul 2017
554juvenatech.comGoDaddy.com, LLC9 Jan 20199 Jan 20259 Jan 2026
555juventus-stadion.comFastDomain Inc.30 Dec 201430 Dec 201430 Dec 2015
556juvenileattorneylajolla.comNetwork Solutions, LLC29 Dec 201429 Dec 201429 Dec 2015
557juventusnation.comGoDaddy.com, LLC31 Dec 201431 Dec 202431 Dec 2026
558juventudeibc.comNetwork Solutions, LLC30 Dec 201430 Dec 201430 Dec 2015
559juvenol.comDynadot, LLC5 Feb 202420 Jan 20255 Feb 2026
560juveniledentioncenter.comFabulous.com Pty Ltd.6 Dec 20057 Jan 20166 Dec 2016
561juvenilecenteredpolicing.comregister.com, Inc.30 Dec 201431 Jan 201730 Dec 2018
562juventa74.comNetwork Solutions, LLC31 Dec 201429 Dec 201631 Dec 2017
563juvenile-incidental.orgGMO Internet Inc.31 Dec 2014-31 Dec 2015
564juventudunida.comGoDaddy.com, LLC23 May 202523 May 202523 May 2028
565juvenile-games.comGMO Internet Inc.21 Mar 20222 Jun 202521 Mar 2025
566juvenesscanada.comNetwork Solutions, LLC4 Jan 20151 Feb 20174 Jan 2019
567juventus.wangEU Technology (HK) Limited29 Jun 201416 Mar 201729 Jun 2017
568juvenil.modaGoDaddy.com, LLC1 May 201812 Jun 20251 May 2025
569juveniledependencyattorneys.xyzNetwork Solutions, LLC12 Jul 201412 Jul 201412 Jul 2015
570juvenil.shoesName.com, Inc.9 Jul 20146 Jan 20179 Jul 2017
571juvenile.xyz-26 Sep 202131 Jan 202526 Sep 2026
572juventus.tokyoGMO Internet Inc.22 Jul 201422 Jul 201422 Jul 2015
573juvenexspa.xyzNetwork Solutions, LLC1 Aug 20141 Aug 20141 Aug 2015
574juventus.rocksGoDaddy.com, LLC23 Jan 20255 Mar 202523 Jan 2026
575juvenile.votingRegistryGate GmbH18 Aug 201418 Aug 201418 Aug 2015
576juvenilelawyer.vegaseNom, Inc.2 Jun 201415 Jul 20232 Jun 2024
577juvederm.clinicAscio Technologies, Inc. Danmark - Filial af Ascio…18 Mar 202023 Mar 202018 Mar 2021
578juvederm.buzzGoDaddy.com, LLC22 Sep 201422 Sep 201421 Sep 2017
579juventus.linkTucows Domains Inc.5 Jan 201810 Jan 20185 Jan 2019
580juvedermfiller.nycGo China Domains, LLC8 Oct 20148 Oct 20147 Oct 2015
581juveniledependency.lawyerNetwork Solutions, LLC13 Oct 201419 Aug 202413 Oct 2025
582juveniledependency.attorneyNetwork Solutions, LLC13 Oct 201419 Aug 202413 Oct 2025
583juventus.trainingCronon AG10 Oct 20166 Jan 201710 Oct 2017
584juventusbulgaria.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Aug 201512 Aug 202511 Aug 2026
585juventudestrella.comNetwork Solutions, LLC11 Aug 20159 Aug 201611 Aug 2017
586juventudcomienza.com1&1 Internet AG11 Aug 201512 Aug 201611 Aug 2017
587juvenocomerz.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Aug 201530 Nov 201611 Aug 2017
588juvenis.londonMesh Digital Limited25 Oct 201425 Oct 201425 Oct 2015
589juvederm.nycGoDaddy.com, LLC4 Nov 20149 Nov 20243 Nov 2029
590juvederm.inkOnlineNIC, Inc.8 Nov 20148 Nov 20148 Nov 2015
591juvecare.websiteKey-Systems, LLC6 Nov 201412 Jan 20176 Nov 2017
592juventus.click1&1 Internet AG25 Nov 20149 Jan 201725 Nov 2017
593juventusfcfan.clubeNom, Inc.28 Nov 201428 Nov 201427 Nov 2015
594juvenile.clubNameCheap, Inc.17 Feb 201717 Feb 201816 Feb 2018
595juvenile.blueGMO Internet Inc.30 Nov 201430 Nov 201430 Nov 2015
596juventus.lifeCommuniGal Communication Ltd.30 Jul 202531 Jul 202530 Jul 2026
597juventus.ninjaeNom, Inc.5 Dec 20145 Dec 20145 Dec 2015
598juveniledelinquency.attorneyGoDaddy.com, LLC13 Dec 201413 Dec 201413 Dec 2015
599juventini.clubGoDaddy.com, LLC15 Dec 201415 Dec 201614 Dec 2017
600juvela.xyzUniregistrar Corp3 Jun 201623 Sep 20163 Jun 2017
601juvenia.xn--ses554gInternet Domain Name System Beijing Engineering Re…5 Jan 20155 Jan 20155 Jul 2019
602juvenation.clubGandi SAS6 Jan 20156 Jan 20155 Jan 2016
603juventus.companyAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…31 Oct 20201 Nov 202331 Oct 2024
604juvelo.jewelryName.com, Inc.12 Aug 201512 Aug 201512 Aug 2016
605juvenilediabetes.dietUniregistrar Corp31 Jan 201531 Jan 201531 Jan 2016
606juvenile-defense.lawyereNom, Inc.21 Feb 201511 Mar 201721 Feb 2018
607juveniles.sciencePDR Ltd. d/b/a PublicDomainRegistry.com3 Mar 20155 Mar 20152 Mar 2016
608juventus.zoneeNom, Inc.23 Mar 201523 Mar 201523 Mar 2016
609juventus.campeNom, Inc.23 Mar 201523 Mar 201523 Mar 2016
610juveedesign.galleryTucows Domains Inc.1 Apr 20145 Apr 20151 Apr 2016
611juvelive.comGoDaddy.com, LLC15 Mar 20243 Jun 202515 Mar 2026
612juvelbox.comGKG.NET, INC.13 Apr 202326 Apr 202413 Apr 2024
613juvederm.picsGoDaddy.com, LLC14 Apr 201529 May 201714 Apr 2018
614juvenil.fashionGoDaddy.com, LLC26 Apr 201526 Apr 201526 Apr 2016
615juventud.globalGoDaddy.com, LLC1 May 20152 May 20171 May 2018
616juvenes-voyages.comOVH sas5 Jan 20157 Jan 20205 Jan 2021
617juven0ile.orgKey-Systems GmbH4 Jan 2015-4 Jan 2016
618juventudemove.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Jan 20158 Jan 20158 Jan 2016
619juventasnatura.comNics Telekomünikasyon Ticaret Ltd. Şti.8 Jan 20158 Jan 20158 Jan 2016
620juvenoide.comGMO Internet Inc.25 Mar 201531 Mar 201724 Mar 2018
621juveneskincare.comGoDaddy.com, LLC8 Jan 20158 Jan 20158 Jan 2017
622juvenilereentry.org-14 Aug 201514 Aug 201514 Aug 2017
623juvex.comUniregistrar Corp7 Mar 200214 May 20257 Mar 2026
624juveon.comAnnulet LLC1 Jun 200319 Jul 20251 Jun 2026
625juvenum.comAnnulet LLC17 Aug 20064 Oct 202417 Aug 2025
626juventusdenmark.comWild West Domains, LLC9 Jan 20159 Jan 20159 Jan 2016
627juventudelucrativa.comOVH sas10 Jan 201510 Jan 201510 Jan 2016
628juventia.comDropCatch.com 1221 LLC1 May 20255 May 20251 May 2026
629juvensis.comAnnulet LLC27 Jun 200310 Aug 201727 Jun 2018
630juvenos.comDomain.com, LLC4 Sep 200510 Jan 20154 Sep 2015
631juvenilegranulosacelltumour.comSynergy Wholesale Pty Ltd10 Jan 201516 Jan 201910 Jan 2020
632juvenilegranulosacelltumor.comSynergy Wholesale Pty Ltd10 Jan 201516 Jan 201910 Jan 2020
633juvenileexcursions.comGoDaddy.com, LLC9 Jan 20159 Jan 20159 Jan 2016
634juvenic.comAnnulet LLC17 Aug 20064 Oct 202417 Aug 2025
635juvenface.comXin Net Technology Corporation9 Jan 20159 Jan 20159 Jan 2018
636juvenet.comDropCatch.com 445 LLC26 Nov 202417 Jan 202526 Nov 2025
637juvenent.comAnnulet LLC17 Aug 20064 Oct 202417 Aug 2025
638juvenec.comAnnulet LLC17 Aug 20064 Oct 202417 Aug 2025
639juvence.comAnnulet LLC17 Aug 20064 Oct 202417 Aug 2025
640juvelinet.comNameKing.com Inc.7 Dec 20048 Dec 20247 Dec 2025
641juveas.comGoDaddy.com, LLC5 Feb 202310 Feb 20255 Feb 2026
642juventusmedical.comGoDaddy.com, LLC11 Jan 201511 Jan 201511 Jan 2017
643juventudcarnavalera.comGoDaddy.com, LLC14 Jan 201514 Jan 201514 Jan 2016
644juventudactuamx.comGoDaddy.com, LLC13 Jan 201513 Jan 201513 Jan 2016
645juvennjeannie.comTucows Domains Inc.29 Dec 202229 Dec 202429 Dec 2025
646juvenilexml.comDropCatch.com 397 LLC13 Jan 201514 Jan 201713 Jan 2018
647juventusfilms.comGoDaddy.com, LLC14 Jan 201515 Jan 202514 Jan 2026
648juvemerda.comRegister.it SPA14 Jan 201513 Jan 202514 Jan 2026
649juveandsonslandscapemaintenance.comTucows Domains Inc.10 Jan 201214 Jan 201510 Jan 2016
650juvesta.comGoDaddy.com, LLC15 Jan 20151 Oct 202415 Jan 2026
651juventudcatolik.comNetwork Information Center Mexico, S.C.15 Jan 201516 Jan 201815 Jan 2018
652juvenisclothing.comTucows Domains Inc.11 Jan 201215 Jan 201511 Jan 2016
653juvenilessence.comGoDaddy.com, LLC16 Jan 201517 Jan 202416 Jan 2027
654juventudstereosevilla.comPSI-USA, Inc. dba Domain Robot14 Aug 201323 Aug 202114 Aug 2022
655juvederm.london-17 May 201517 May 201517 May 2017
656juvegalaxy.clickGMO Internet Inc.16 May 2015-16 May 2016
657juventus.clubTucows Domains Inc.7 Oct 20201 Aug 20257 Oct 2026
658juventus.workMinds + Machines Registrar Limited1 Jun 20151 Jun 20151 Jun 2016
659juvenilef.topGuangDong NaiSiNiKe Information Technology Co Ltd.30 May 201530 May 201530 May 2016
660juventus.schuleKey-Systems, LLC4 Jun 20154 Jun 20254 Jun 2026
661juvex.scienceAlpnames Limited8 Jun 2015-7 Jun 2016
662juventus.worldCommuniGal Communication Ltd.--4 Mar 2026
663juventus.casaMinds + Machines Registrar Limited13 Jun 201513 Jun 201513 Jun 2016
664juveler.casaMinds + Machines Registrar Limited13 Jun 201513 Jun 201513 Jun 2016
665juvert.scienceAlpnames Limited20 Jun 2015-19 Jun 2016
666juventus.london-18 Jun 201518 Jun 201518 Jun 2017
667juvederm.clubAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…10 Jan 201713 Apr 20179 Jan 2018
668juventus.pubAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…22 Jun 201522 Jun 201522 Jun 2016
669juventini.workMinds + Machines Registrar Limited11 Jun 201511 Jun 201511 Jun 2016
670juvenisskin.comWild West Domains, LLC16 Aug 201516 Jul 202516 Aug 2026
671juventus.siteCommuniGal Communication Ltd.10 Aug 202411 Aug 202510 Aug 2026
672juventus.newsNameCheap, Inc.22 Dec 202427 Dec 202422 Dec 2025
673juventud.newsName.com, Inc.15 Jul 201515 Jul 201715 Jul 2018
674juvena.topZhengzhou Century Connect Electronic Technology De…15 Jul 201520 Jul 201720 Jul 2017
675juvenilebot.xyzGMO Internet Inc.1 Aug 201529 Jul 20161 Aug 2017
676juventusclubmolfetta.orgTucows Domains Inc.12 Jan 201216 Jan 201512 Jan 2016
677juvenilgt.comGoDaddy.com, LLC19 Jan 201519 Jan 201519 Jan 2016
678juventuselbaclub.com35 Technology Co., Ltd.14 Jul 202222 Sep 202314 Jul 2023
679juventabiotech.comRegional Network Information Center, JSC dba RU-CE…18 Jun 201419 Jan 201518 Jun 2015
680juvenorpharma.comRegister NV dba Register.eu19 Jan 201518 Jan 202519 Jan 2026
681juvenilephotography.comeNom, Inc.20 Jan 201520 Jan 201520 Jan 2018
682juvenescentholidays.comTucows Domains Inc.16 Jan 201420 Jan 201516 Jan 2016
683juvebem.comGoDaddy.com, LLC19 Jan 201519 Jan 201519 Jan 2016
684juventusclublinygaetanoscirea.comGoDaddy.com, LLC20 Jan 201520 Jan 201520 Jan 2017
685juventpro.comGoDaddy.com, LLC20 Jan 201520 Jan 201520 Jan 2016
686juvent1000.comGoDaddy.com, LLC20 Jan 201520 Jan 201520 Jan 2016
687juvelabellasignora.comCV. Jogjacamp21 Jan 201521 Jan 201521 Jan 2016
688juvers.comIHS Telekom, Inc.30 Jan 201929 Jan 202530 Jan 2026
689juventudtriunfadora.comNamesilo, LLC12 Oct 202018 Aug 202512 Oct 2025
690juventudretalteca.comNameCheap, Inc.16 Jun 202219 May 202516 Jun 2026
691juventusfc.xyzeNom, Inc.17 Aug 201517 Nov 201617 Aug 2017
692juventude.orgSquarespace Domains LLC11 Sep 202511 Sep 202511 Sep 2026
693juvefe.dateAlpnames Limited17 Aug 2015-16 Aug 2016
694juvesiioreview.netName.com, Inc.19 Jan 201519 Jan 201519 Jan 2016
695juvenileproductsinsurance.comGoDaddy.com, LLC21 Jan 201521 Jan 201521 Jan 2017
696juvenile.asiaBigRock Solutions Ltd.21 Jan 201521 Jan 201521 Jan 2016
697juvelfattare.com-2 Aug 202220 Aug 20252 Aug 2026
698juvelyras.netNordreg AB20 Jan 20156 Nov 202420 Jan 2026
699juve-fan.comEranet International Limited14 Jun 202325 Jul 202414 Jun 2024
700juvezen.comGoDaddy.com, LLC22 Jan 20152 Jan 202522 Jan 2026
701juventusworld.comTucows Domains Inc.23 Jan 201518 Oct 202423 Jan 2026
702juventusclubandria.comTucows Domains Inc.23 Jan 201516 Jan 202523 Jan 2026
703juventus-jersey.comTucows Domains Inc.23 Jan 201518 Oct 202423 Jan 2026
704juvelius.comGoDaddy.com, LLC31 May 202212 Jul 202331 May 2023
705juveandsons.comTucows Domains Inc.20 Jan 201224 Jan 201520 Jan 2016
706juvernedivino.netTucows Domains Inc.23 Jan 201527 Jan 202023 Jan 2020
707juventud-deportes.org-22 Apr 201622 Apr 201622 Apr 2017
708juventudunida.orgTurnCommerce, Inc. DBA NameBright.com29 Dec 202123 Dec 202429 Dec 2025
709juventudconproposito.netNetwork Solutions, LLC25 Jan 201525 Jan 201525 Jan 2016
710juventudterritorialhidalgo.comGoDaddy.com, LLC27 Jan 201527 Jan 201527 Jan 2016
711juve-project.com1&1 Internet AG26 Jan 201526 Jan 201526 Jan 2016
712juventusclubdockw.comGoDaddy.com, LLC27 Jan 201527 Jan 201527 Jan 2016
713juventudecastelo.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Jan 201527 Jan 201527 Jan 2016
714juvencioconsultoriaemp.comRealtime Register B.V.27 Jan 201527 Jan 201527 Jan 2016
715juveaccion.comName.com, Inc.28 Jan 201528 Jan 202528 Jan 2026
716juvesiiouserreview.comGoDaddy.com, LLC29 Jan 201529 Jan 201529 Jan 2016
717juvesiiotruth.comGoDaddy.com, LLC29 Jan 201529 Jan 201529 Jan 2016
718juvesiioconsumerreview.comGoDaddy.com, LLC29 Jan 201529 Jan 201529 Jan 2016
719juvenileinternational.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Jan 201530 Jan 202530 Jan 2026
720juveniledelinquentdogs.comGoDaddy.com, LLC30 Jan 201530 Jan 201530 Jan 2016
721juvenilecontractors.comKey-Systems GmbH17 Jul 202330 Aug 202417 Jul 2024
722juventusfan.clubGoDaddy.com, LLC24 Dec 201624 Dec 201623 Dec 2017
723juventi.linkGMO Internet Inc.7 May 20157 May 20157 May 2016
724juvematrix.comregister.com, Inc.31 Jan 201531 Jan 201531 Jan 2018
725juvereskincare.comeNom, Inc.1 Feb 20151 Feb 20151 Feb 2016
726juventusclubsiliconvalley.orgGoDaddy.com, LLC19 Aug 201520 Aug 202519 Aug 2026
727juvenilenightscheme.netTucows Domains Inc.16 Aug 201220 Aug 201516 Aug 2016
728juvenalia.comEntorno Digital, S.A.21 Jul 201020 Jun 202521 Jul 2026
729juventudnacionalistahn.comGoDaddy.com, LLC2 Feb 20153 Feb 20152 Feb 2016
730juventusnotizie.comNameWeb BVBA5 Feb 20155 Feb 20155 Feb 2016
731juvellysarrcouture.com----
732juvedermvolumanj.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2016
733juvely.comDynadot, LLC16 Dec 20198 Jan 202516 Dec 2025
734juventus-host.netCronon AG7 Feb 20157 Feb 20157 Feb 2016
735juventushirts.comXin Net Technology Corporation9 Feb 20159 Feb 20159 Feb 2016
736juventafest.comTucows Domains Inc.8 Feb 201512 Feb 20178 Feb 2017
737juventusfootballfans.infoGoDaddy.com, LLC24 Apr 20205 Jun 202524 Apr 2025
738juvedermkaty.orgGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
739juvedermkaty.netGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
740juvedermkaty.infoGoDaddy.com, LLC20 Aug 2015-20 Aug 2016
741juvedermkaty.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
742juvestudios.comGoDaddy.com, LLC9 Feb 201510 Feb 20259 Feb 2026
743juvestudio.comGoDaddy.com, LLC9 Feb 201517 Feb 20259 Feb 2026
744juventusfcturkiye.comGMO Internet Inc.10 Feb 201510 Feb 201510 Feb 2016
745juventudpress.comNameCheap, Inc.26 Aug 202526 Aug 202526 Aug 2026
746juvensys.comCloudFlare, Inc.23 Aug 20212 Oct 202323 Aug 2023
747juvenilewelfareboard.comNetwork Solutions, LLC9 Feb 201511 Mar 20249 Feb 2029
748juveniste.netGoDaddy.com, LLC8 Feb 20159 Feb 20258 Feb 2026
749juventudintegral.comPorkbun, LLC30 Sep 202028 Sep 202430 Sep 2025
750juveniledefenselawfirm.comGoDaddy.com, LLC10 Feb 201511 Feb 202510 Feb 2026
751juvenilewelfareboard.orgNetwork Solutions, LLC9 Feb 201525 Mar 20249 Feb 2029
752juventudinmortal.com-1 May 20254 May 20251 May 2026
753juventudech.com-13 Jun 201613 Jun 201613 Jun 2017
754juveslandscaping.comDynadot, LLC5 Jul 20255 Jul 20255 Jul 2026
755juvenistebeauty.comGoDaddy.com, LLC12 Feb 201513 Feb 202512 Feb 2026
756juvenile-m2nsw.comGoDaddy.com, LLC13 Feb 201513 Feb 201513 Feb 2016
757juventusstadium.bizTucows Domains Inc.10 Feb 200713 Feb 20159 Feb 2015
758juventusarena.bizTucows Domains Inc.10 Feb 200713 Feb 20159 Feb 2015
759juventudcristiana.netGoDaddy.com, LLC13 Feb 201513 Feb 201513 Feb 2016
760juventusarena.infoTucows Domains Inc.10 Feb 200714 Feb 201510 Feb 2016
761juvenileparricide.comWild West Domains, LLC15 Feb 201515 Feb 201515 Feb 2016
762juventusarena.netTucows Domains Inc.10 Feb 200714 Feb 201510 Feb 2016
763juvelon.netDNC Holdings, Inc.12 Feb 201513 Feb 201512 Feb 2016
764juvesound.comNetwork Solutions, LLC21 Aug 201521 Aug 201521 Aug 2016
765juventudprolongada.clubDattatec.com SRL21 Aug 201511 Nov 201620 Aug 2017
766juventudenritmo.orgTucows Domains Inc.21 Aug 201525 Aug 201721 Aug 2018
767juventusarena.orgTucows Domains Inc.10 Feb 200714 Feb 201510 Feb 2016
768juvenonsettlement.comGoDaddy.com, LLC16 Feb 201516 Feb 20157 Jul 2016
769juvedermexpert.comGoDaddy.com, LLC17 Feb 201517 May 202417 Feb 2025
770juveukra.infoGMO Internet Inc.16 Feb 2015-16 Feb 2016
771juventasskinplus.comGoDaddy.com, LLC17 Feb 201517 Feb 201517 Feb 2017
772juventaseyeplus.comGoDaddy.com, LLC17 Feb 201517 Feb 201517 Feb 2017
773juvenilelaw-defense.comGoDaddy.com, LLC18 Feb 201518 Feb 201518 Feb 2016
774juventudeferreira.comeNom, Inc.19 Feb 201519 Feb 201519 Feb 2016
775juvenize.com-17 Sep 202325 Nov 202317 Sep 2026
776juvenecer.comHosting Concepts B.V. dba Openprovider26 Jun 20172 Jun 202026 Jun 2020
777juvefano.comGoDaddy.com, LLC19 Feb 201519 Feb 201519 Feb 2016
778juventudesud.orgGoDaddy.com, LLC18 Feb 201518 Feb 201518 Feb 2016
779juvenilesales.comGo China Domains, LLC10 May 201811 May 201810 May 2019
780juvenile-sales.comGoDaddy.com, LLC20 Feb 201520 Feb 201520 Feb 2016
781juventusblog.orgGMO Internet Inc.19 Feb 201519 Feb 201519 Feb 2016
782juvenilefunfair.orgNameCheap, Inc.27 Apr 201727 Jun 201727 Apr 2018
783juventusmuseo.comTucows Domains Inc.18 Feb 201122 Feb 201518 Feb 2016
784juventusmuseo.bizTucows Domains Inc.18 Feb 201121 Feb 201517 Feb 2015
785juventudespiertard.comeNom, Inc.21 Feb 201521 Feb 201521 Feb 2016
786juvelandaccessories.comregister.com, Inc.21 Feb 201521 Feb 201521 Feb 2017
787juvenreda.orgSoluciones Corporativas IP, SLU17 Aug 201619 Jul 201717 Aug 2018
788juventusmuseo.netTucows Domains Inc.18 Feb 201122 Feb 201518 Feb 2016
789juventusmuseo.infoTucows Domains Inc.18 Feb 201122 Feb 201518 Feb 2016
790juvenaliusville.netNetwork Solutions, LLC22 Feb 201522 Feb 201522 Feb 2016
791juventudplena.comDattatec.com SRL6 Feb 20236 Feb 20236 Feb 2028
792juveniz.comPDR Ltd. d/b/a PublicDomainRegistry.com14 May 202326 Jul 202414 May 2024
793juvenclub.comOVH sas23 Feb 201523 Feb 201523 Feb 2016
794juventudequeprevalece.comWild West Domains, LLC24 Feb 201524 Feb 201524 Feb 2016
795juvenil-lb.orgAscio Technologies, Inc. Danmark - Filial af Ascio…23 Feb 2015-23 Feb 2016
796juvenalcorkitalia.comInstra Corporation Pty Ltd.25 Feb 201525 Feb 201525 Feb 2016
797juventusfcsoccerclub.comGMO Internet Inc.26 Feb 201527 Feb 201526 Feb 2016
798juventudesonica.comMesh Digital Limited3 Jan 201729 Dec 20173 Jan 2020
799juveldesign.netRealtime Register B.V.25 Feb 201525 Feb 201525 Feb 2016
800juvesautoclinic.comNetwork Solutions, LLC17 Nov 202118 Sep 202517 Nov 2026
801juventusborussiadortmund.comGoDaddy.com, LLC27 Feb 201527 Feb 201527 Feb 2016
802juventuddemocratica.orgGoDaddy.com, LLC26 Feb 201526 Feb 201526 Feb 2016
803juvendesign.comGoDaddy.com, LLC27 Feb 201527 Feb 201527 Feb 2016
804juvelfatter.comTucows Domains Inc.24 Feb 201028 Feb 201524 Feb 2016
805juventud.orgGoDaddy.com, LLC27 Feb 201513 Apr 202527 Feb 2026
806juventuspartners.com1&1 Internet AG26 Sep 20195 Oct 202326 Sep 2024
807juventudparaellas.comGoDaddy.com, LLC1 Mar 20151 Mar 20151 Mar 2016
808juverokorea.comGabia, Inc.24 Aug 201514 Aug 202524 Aug 2026
809juventuslivenews.com-23 Aug 201523 Aug 201523 Aug 2017
810juventusfanaticshop.comDynadot, LLC15 Mar 202515 Mar 202515 Mar 2026
811juveriatextile.comGoDaddy.com, LLC2 Mar 20152 Mar 20152 Mar 2016
812juveninxu.comName.com, Inc.2 Mar 20152 Mar 20152 Mar 2016
813juvencitas.comGoDaddy.com, LLC2 Mar 20152 Mar 20152 Mar 2016
814juvenchina.comXin Net Technology Corporation3 Mar 20153 Mar 20153 Mar 2018
815juvedermsugarland.comGoDaddy.com, LLC24 Jun 201625 Jun 202524 Jun 2026
816juvenileamusements.com1&1 Internet AG3 Mar 201515 Apr 20253 Mar 2025
817juveamuse.com1&1 Internet AG3 Mar 20154 Mar 20173 Mar 2026
818juvenileredemption.com----
819juvenileredemption.orgGoDaddy.com, LLC4 Mar 20154 Mar 20174 Mar 2018
820juveluxe.comGoDaddy.com, LLC30 Oct 201619 Nov 202430 Oct 2025
821juvelito.comAutomattic Inc.28 Mar 202528 Mar 202528 Mar 2026
822juvedermtoronto.netDomain.com, LLC5 Mar 20155 Mar 20155 Mar 2016
823juventudporsiempre.comTucows Domains Inc.27 Dec 20228 Mar 202427 Dec 2023
824juventuden2minutos.comGoDaddy.com, LLC24 Aug 201524 Aug 201524 Aug 2016
825juvenileoenophile.comGoogle, Inc.24 Aug 201524 Aug 201524 Aug 2016
826juventudenred.comSoluciones Corporativas IP, SLU11 Mar 201511 Mar 201511 Mar 2016
827juvenileimmigration.comGoDaddy.com, LLC11 Mar 201511 Mar 201511 Mar 2016
828juvelojewelry.comGoogle, Inc.11 Mar 201511 Mar 201511 Mar 2016
829juvedermprofessionals.comGoDaddy.com, LLC13 Mar 201523 Apr 202513 Mar 2025
830juvedermlongislandny.comGoDaddy.com, LLC13 Mar 201513 Mar 202513 Mar 2027
831juvederminjector.comGoDaddy.com, LLC13 Mar 201513 Mar 202513 Mar 2027
832juventudbarbate.orgPSI-USA, Inc. dba Domain Robot11 Mar 20158 Mar 202511 Mar 2026
833juvelenclub.comNetwork Solutions, LLC13 Mar 201513 Mar 201513 Mar 2016
834juventudverbomexico.comGoDaddy.com, LLC14 Mar 201514 Mar 201514 Mar 2016
835juventudemergente.comInterplanet, S.A. De C.V.14 Mar 201514 Mar 201514 Mar 2016
836juventusweb.com-10 Oct 201610 Oct 201610 Oct 2017
837juventudesupla.orgPDR Ltd. d/b/a PublicDomainRegistry.com25 Aug 201510 Aug 201625 Aug 2017
838juvenilehomestudy.comWild West Domains, LLC25 Aug 201525 Aug 201525 Aug 2016
839juventudesanz.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Mar 201516 Mar 201516 Mar 2016
840juventusmemberchina.comDomain.com, LLC27 May 201627 May 201627 May 2017
841juvenilesaaaj.comDynadot, LLC17 Mar 202517 Mar 202517 Mar 2026
842juvezone.comTurnCommerce, Inc. DBA NameBright.com15 Aug 20179 Aug 202015 Aug 2025
843juventudequadrangular.comNetwork Solutions, LLC17 Mar 201515 Mar 201717 Mar 2018
844juventus-scfoundation.orgGoDaddy.com, LLC16 Mar 201516 Mar 201516 Mar 2017
845juvepeutics.comDreamHost, LLC10 Sep 201810 Sep 201810 Sep 2019
846juventusmania1897.comTucows Domains Inc.19 Mar 201523 Mar 201919 Mar 2019
847juvenilleproductmarketing.comGoDaddy.com, LLC20 Mar 201520 Mar 201520 Mar 2016
848juveniledecarie.comFabulous.com Pty Ltd.14 Feb 200214 Feb 200214 Feb 2017
849juventusclubtirona.comGoDaddy.com, LLC20 Mar 201520 Mar 201520 Mar 2016
850juventusclub.soccerServer Plan Srl26 Aug 201526 Aug 201526 Aug 2016
851juventus.soccerGoogle, Inc.16 Feb 201917 Apr 202316 Feb 2023
852juventusfze.netBigRock Solutions Ltd.27 Aug 201528 Jul 201727 Aug 2018
853juventud.onlineSoluciones Corporativas IP, SLU17 May 202522 May 202517 May 2028
854juveniles.onlineGMO Internet Inc.31 Dec 20245 Jan 202531 Dec 2025
855juvedio.comGoDaddy.com, LLC27 Aug 201527 Aug 201527 Aug 2016
856juvedermpuyallup.comGoDaddy.com, LLC21 Mar 201521 Mar 201521 Mar 2017
857juventudparaellas.usGoDaddy.com, LLC1 Mar 20152 Mar 201529 Feb 2016
858juventudzaragoza.com10dencehispahard, S.L.31 Mar 200323 Mar 201531 Mar 2033
859juvenile03.comGMO Internet Inc.23 Mar 201523 Mar 201523 Mar 2016
860juventuus.comPDR Ltd. d/b/a PublicDomainRegistry.com13 May 202313 May 202313 May 2024
861juventudedudelange.comTucows Domains Inc.22 Mar 201226 Mar 201522 Mar 2016
862juvenera.comNameCheap, Inc.18 Nov 202418 Nov 202418 Nov 2025
863juventusclubdocmalta.orgGoDaddy.com, LLC24 Mar 201524 Mar 201524 Mar 2016
864juventusclubdocmalta.netGoDaddy.com, LLC24 Mar 201524 Mar 201524 Mar 2016
865juventusclubdocmalta.infoGoDaddy.com, LLC24 Mar 2015-24 Mar 2016
866juvenileprediabetes.comTucows Domains Inc.26 Mar 201530 Mar 201726 Mar 2017
867juventudconvida.orgLaunchpad, Inc.25 Mar 201525 Mar 201525 Mar 2016
868juventus.online-12 Jan 202523 Mar 202512 Jan 2026
869juventudforever.comGoDaddy.com, LLC28 Aug 201528 Aug 201528 Aug 2017
870juvenbservices.comGoDaddy.com, LLC27 Aug 201527 Aug 201527 Aug 2016
871juvello.comGoogle, Inc.27 Mar 201512 Mar 202527 Mar 2026
872juvellen.comeNom, Inc.26 Mar 201526 Mar 201526 Mar 2016
873juventudrural.netDynadot, LLC15 Oct 202224 Nov 202315 Oct 2023
874juventudeglobal.comUniverso Online S/A (UOL)29 Mar 201529 Mar 201529 Mar 2016
875juventasorg.comGoDaddy.com, LLC30 Mar 201530 Mar 201530 Mar 2017
876juvernedivino.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Mar 201531 Mar 201531 Mar 2016
877juvenileview.comGoDaddy.com, LLC31 Mar 20151 Apr 202531 Mar 2026
878juventudiberoamericana.orgGMO Internet Inc.2 Dec 20242 Dec 20242 Dec 2025
879juventudeglobal.netUniverso Online S/A (UOL)29 Mar 201529 Mar 201529 Mar 2016
880juventudejpm.orgNetwork Solutions, LLC31 Mar 201531 Mar 201531 Mar 2017
881juventutemdc.orgTucows Domains Inc.28 Aug 201518 Aug 202528 Aug 2026
882juvenilecriminaldefensemarietta.comGoDaddy.com, LLC28 Aug 201528 Aug 201528 Aug 2016
883juvenilecriminaldefenselawyersmarietta.comGoDaddy.com, LLC28 Aug 201528 Aug 201528 Aug 2016
884juvenilecriminaldefenselawyerscobb.comGoDaddy.com, LLC28 Aug 201528 Aug 201528 Aug 2016
885juvenilecriminaldefensecobb.comGoDaddy.com, LLC28 Aug 201528 Aug 201528 Aug 2016
886juvenilecriminaldefenseattorneysmarietta.comGoDaddy.com, LLC28 Aug 201528 Aug 201528 Aug 2016
887juvenilecriminaldefenseattorneyscobb.comGoDaddy.com, LLC28 Aug 201528 Aug 201528 Aug 2016
888juventudboyacense.comTucows Domains Inc.2 Apr 20152 Apr 20152 Apr 2017
889juveniledrugamnesty.comGoDaddy.com, LLC3 Apr 20153 Apr 20153 Apr 2016
890juventeca.com1&1 Internet AG3 Apr 20158 Nov 20173 Apr 2018
891juveniletechnology.comTucows Domains Inc.16 Aug 202420 Aug 202516 Aug 2026
892juvetix.comKey-Systems GmbH4 Apr 20153 Apr 20174 Apr 2018
893juventudebelem.orgeNom, Inc.3 Apr 20153 Apr 20153 Apr 2016
894juveye.comGoDaddy.com, LLC15 Sep 201816 Sep 202415 Sep 2026
895juventud.infoDynadot, LLC1 Apr 20211 Apr 20211 Apr 2022
896juventour-us.com-1 Sep 20151 Sep 20151 Sep 2017
897juvewen9.netDynadot, LLC31 Aug 201531 Aug 201531 Aug 2016
898juvencus.comGoogle, Inc.18 Nov 202218 Nov 202218 Nov 2023
899juventusfcjersey.comDynadot, LLC22 Jun 202522 Jun 202522 Jun 2026
900juvenilejusticetraining.infoWild West Domains, LLC30 Aug 2015-30 Aug 2016
901juveniledefenseattorney.comTurnCommerce, Inc. DBA NameBright.com29 Aug 201523 Aug 202029 Aug 2025
902juvenilearthritisproject.orgeNom, Inc.29 Aug 201531 Jul 201729 Aug 2018
903juvenilearthritisproject.comeNom, Inc.29 Aug 201531 Jul 201629 Aug 2018
904juvefans.infoNameCheap, Inc.4 Oct 20234 Oct 20244 Oct 2025
905juvemtus.comTucows Domains Inc.31 Mar 201931 Mar 201931 Mar 2020
906juvenyouthserum.comeNom, Inc.8 Apr 20158 Apr 20158 Apr 2016
907juvenyouthcream.comeNom, Inc.8 Apr 20158 Apr 20158 Apr 2016
908juvenileinvoketeamsurvival.comGoDaddy.com, LLC9 Apr 20159 Apr 20159 Apr 2016
909juvenescence4u.comDomainsAtCost Corporation9 Apr 20159 Apr 20159 Apr 2016
910juvenalravelo.comGoDaddy.com, LLC9 Apr 201510 Apr 20249 Apr 2026
911juventasgroup.comBigRock Solutions Ltd.3 Sep 20153 Sep 20163 Sep 2017
912juventasciences.orgDreamHost, LLC3 Sep 20153 Sep 20153 Sep 2016
913juventasciences.comDreamHost, LLC3 Sep 20153 Sep 20153 Sep 2016
914juventudnazarena.comGMO Internet Inc.11 Apr 201529 Mar 201711 Apr 2018
915juventudcdmx.com1&1 Internet AG11 Apr 201511 Apr 201511 Apr 2016
916juvelfashion.comGoDaddy.com, LLC11 Apr 201511 Apr 201511 Apr 2016
917juvenilegames.comAnnulet LLC13 Apr 201531 May 202513 Apr 2026
918juvenessedobrasil.comGoDaddy.com, LLC4 Sep 20154 Sep 20154 Sep 2016
919juvetuttomercatoweb.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Sep 20154 Sep 20154 Sep 2016
920juventudenavivamiento.orgDomain.com, LLC13 Apr 201514 Apr 201513 Apr 2016
921juventuddelsalvador.orgGoDaddy.com, LLC13 Apr 201513 Apr 201513 Apr 2016
922juveri.comGoDaddy.com, LLC23 Aug 20204 Nov 202323 Aug 2023
923juventushome.comGoDaddy.com, LLC15 Apr 201515 Apr 201515 Apr 2016
924juvetopnews.comRegister.it SPA16 Apr 201519 May 201716 Apr 2018
925juvenilelawbradenton.comGoDaddy.com, LLC16 Apr 201516 Apr 201516 Apr 2016
926juventiclcolnodolapc.orgGoDaddy.com, LLC5 Sep 20155 Sep 20155 Sep 2016
927juvenciopano.comGoDaddy.com, LLC5 Sep 20155 Sep 20155 Sep 2016
928juventasmedia.comWild West Domains, LLC17 Apr 201517 Apr 201517 Apr 2016
929juvenileempowermentproject.comGoDaddy.com, LLC17 Apr 201517 Apr 201517 Apr 2016
930juvelyriniaidirbiniai.comTucows Domains Inc.14 Apr 201418 Apr 201514 Apr 2016
931juventudjeunesse.comCircle of Domains LLC17 Jun 201818 Jun 201817 Jun 2019
932juvenalmunubo.comTucows Domains Inc.20 Apr 201524 Apr 201820 Apr 2018
933juventuddivinotesoro.netGoDaddy.com, LLC20 Apr 201520 Apr 201520 Apr 2016
934juvenia-capital.comNamesilo, LLC25 Jun 201613 Mar 201725 Jun 2017
935juvesiioskin.orgName.com, Inc.21 Apr 201521 Apr 201521 Apr 2016
936juvemerda.org101domain, Inc.22 Apr 201522 Apr 201522 Apr 2016
937juvenciojimenez-valdez.com-11 Jul 202522 Sep 202511 Jul 2026
938juvecasertafuture.comTucows Domains Inc.21 Apr 201125 Apr 201521 Apr 2016
939juventusdailynews.comNameCheap, Inc.27 Apr 201828 Mar 202527 Apr 2026
940juventudeguerreira.comName.com, Inc.7 Sep 20157 Sep 20157 Sep 2016
941juvedermreview.comGoDaddy.com, LLC27 Apr 201527 Apr 201527 Apr 2016
942juvenilepress.netGoDaddy.com, LLC25 Apr 201525 Apr 201525 Apr 2016
943juvelstore.comTucows Domains Inc.27 Apr 201525 Apr 202527 Apr 2026
944juventudeeterna.comGoDaddy.com, LLC2 Sep 202426 Mar 20252 Sep 2025
945juventuszilina.comGransy s.r.o. d/b/a subreg.cz29 Apr 201529 Apr 201529 Apr 2016
946juventus-id.comCV. Jogjacamp29 Apr 20152 May 201729 Apr 2018
947juventusmedical.orgTucows Domains Inc.28 Apr 201530 Mar 201728 Apr 2018
948juventushotel.orgTucows Domains Inc.28 Apr 201530 Mar 201728 Apr 2018
949juventuscafe.orgTucows Domains Inc.28 Apr 201530 Mar 201728 Apr 2018
950juvenationgroup.orgDreamHost, LLC28 Apr 201528 Apr 201528 Apr 2016
951juventusreview.comGoDaddy.com, LLC8 Sep 20158 Sep 20158 Sep 2016
952juventours-us.com-8 Sep 20158 Sep 20158 Sep 2017
953juvenia.mobiBeijing Innovative Linkage Technology Ltd. dba dns…9 Sep 201519 Jun 20179 Sep 2017
954juvedermfaqs.comeNom, Inc.8 Sep 201525 Aug 20168 Sep 2017
955juventusclubdocmontegrossodasti.comTucows Domains Inc.26 Apr 201230 Apr 201526 Apr 2016
956juventatv.comFBS Inc.30 Apr 201530 Apr 201530 Apr 2016
957juvedermreviews.orgGoDaddy.com, LLC29 Apr 201530 Apr 201729 Apr 2018
958juventus-wallpapers.infoGandi SAS30 Apr 201530 Apr 201530 Apr 2016
959juvedermvoluma-cincinnati.com----
960juventudencristo.comGMO Internet Inc.3 May 20153 May 20153 May 2016
961juventaweightloss.comGoogle, Inc.3 May 20153 May 20153 May 2016
962juvesac.comGoDaddy.com, LLC4 May 20154 May 20154 May 2016
963juvenio.comNamesilo, LLC1 May 20132 Sep 20251 May 2026
964juvenilebooks.comAnnulet LLC4 May 201521 Jun 20254 May 2026
965juventudjoel21.comNetwork Solutions, LLC4 Jun 202317 Aug 20244 Jun 2024
966juveny.comTurnCommerce, Inc. DBA NameBright.com25 Jul 20184 Sep 202525 Jul 2026
967juventudnv.comGoDaddy.com, LLC6 May 20156 May 20156 May 2016
968juvenilejusticecameroon.comeNom, Inc.7 May 201518 Jun 20177 May 2017
969juvedeals.comName.com, Inc.7 May 20157 May 20157 May 2016
970juvenilexml.orgMesh Digital Limited6 May 20156 May 20156 May 2016
971juvenalcampos.comName.com, Inc.15 Jan 202014 Dec 202415 Jan 2026
972juventusclubusa.comGoDaddy.com, LLC10 Sep 201510 Sep 201510 Sep 2017
973juventusclubnyc.comGoDaddy.com, LLC10 Sep 201510 Sep 201510 Sep 2017
974juventudelivre.orgeNom, Inc.7 May 20157 May 20157 May 2016
975juventusmerchandising.comTucows Domains Inc.7 May 201311 May 20157 May 2016
976juvenista.comHongkong Domain Name Information Management Co., L…17 Jul 202117 Jul 202117 Jul 2022
977juvellodesign.comGoDaddy.com, LLC11 May 201511 May 201511 May 2016
978juventudymas.comName.com, Inc.12 May 201520 Apr 201712 May 2018
979juventudcanario.comWest263 International Limited21 Oct 202021 Oct 202021 Oct 2021
980juvenilejusticepanel.org-16 Jun 202331 Jul 202516 Jun 2026
981juvenybella.comGoDaddy.com, LLC11 Sep 201511 Sep 201511 Sep 2016
982juventusjuice.comGoDaddy.com, LLC11 Sep 201512 Sep 202511 Sep 2027
983juvenileinvestments.comGoDaddy.com, LLC11 Sep 201511 Sep 201511 Sep 2016
984juveka.comGoDaddy.com, LLC7 Nov 202319 Nov 20247 Nov 2025
985juvecard.comTucows Domains Inc.20 Jul 201824 Jul 201920 Jul 2019
986juvesalon.comPSI-USA, Inc. dba Domain Robot13 May 201514 May 202513 May 2026
987juventusmk.comGoDaddy.com, LLC13 May 201513 May 201513 May 2016
988juventudeshekinah.comCloud Yuqu LLC30 Sep 201930 Sep 201930 Sep 2020
989juventudeecidadania.comNetwork Solutions, LLC17 Feb 201817 Feb 201817 Feb 2020
990juventudshalom.orgGoDaddy.com, LLC12 May 201512 May 201512 May 2016
991juventudpositivaguate.orgOpenTLD B.V.12 May 201512 May 201512 May 2016
992juventusal.comPDR Ltd. d/b/a PublicDomainRegistry.com14 May 201514 May 201514 May 2016
993juventudactivateruel.comGMO Internet Inc.15 May 201531 May 201714 May 2018
994juventudedemocratica.orgVitalwerks Internet Solutions, LLC DBA No-IP8 May 201414 May 20158 May 2016
995juventudeimpacto.comGoDaddy.com, LLC16 May 201516 May 201516 May 2016
996juvenilejourneyman.comWild West Domains, LLC16 May 201516 May 201516 May 2016
997juventus2015.comGoDaddy.com, LLC17 May 201517 May 201517 May 2016
998juventudboschista.comPDR Ltd. d/b/a PublicDomainRegistry.com17 May 201517 May 201517 May 2016
999juvelir-master.comOnlineNIC, Inc.17 May 201517 May 201517 May 2016
1000juve2015.comGoDaddy.com, LLC17 May 201517 May 201517 May 2016

Displaying 1,000 out of 11,835 domains starting with the keyword "JUVE". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=juve

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now