Our database now contains whois records of 625 Million (625,579,590) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1589 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [625 Million Domains] $10,000 Details

Keyword: JEFFREYEPSTEIN

Reverse Whois » KEYWORD [jeffreyepstein ]  { 92 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1jeffreyepstein.orgNameCheap, Inc.16 Jun 201626 Jun 202516 Jun 2026
2jeffreyepstein.mobiNameCheap, Inc.24 Dec 202329 Nov 202424 Dec 2025
3jeffreyepstein.netTurnCommerce, Inc. DBA NameBright.com26 May 201620 May 202126 May 2025
4jeffreyepstein.comGoDaddy.com, LLC16 May 200026 Sep 202416 May 2026
5jeffreyepstein.websiteNameCheap, Inc.23 Jan 201723 Jan 201723 Jan 2018
6jeffreyepstein.infoNameCheap, Inc.19 Apr 202019 Apr 202019 Apr 2021
7jeffreyepstein.sucksRebel.com Corp.18 Mar 20201 Jul 202018 Mar 2021
8jeffreyepstein.storeTucows Domains Inc.12 Aug 201916 Aug 202012 Aug 2021
9jeffreyepstein.onlineCrazy Domains FZ-LLC7 Jul 20222 Jul 20237 Jul 2023
10jeffreyepstein.wtfNameCheap, Inc.15 Sep 202127 Oct 202315 Sep 2023
11jeffreyepstein.co.uk-15 Sep 202216 Sep 202415 Sep 2025
12jeffreyepstein.liveGoogle, Inc.9 Mar 20218 May 20249 Mar 2024
13jeffreyepstein.newsGoDaddy.com, LLC15 Aug 202326 Sep 202415 Aug 2024
14jeffreyepstein.bioName.com, Inc.1 Jan 202413 Feb 20251 Jan 2025
15jeffreyepstein.rocksName.com, Inc.22 Jan 20245 Apr 202522 Jan 2025
16jeffreyepstein.appCloudFlare, Inc.26 Mar 20245 May 202526 Mar 2025
17jeffreyepstein.coDynadot, LLC24 Sep 202429 Sep 202424 Sep 2025
18jeffreyepstein.funNameCheap, Inc.7 Dec 202416 Dec 20247 Dec 2025
19jeffreyepsteinfoundation.comNetwork Solutions, LLC27 Nov 20239 Feb 202527 Nov 2024
20jeffreyepsteininternational.comGoDaddy.com, LLC3 Mar 20237 Mar 20253 Mar 2026
21jeffreyepsteinnewyork.comNameCheap, Inc.24 Dec 202324 Nov 202424 Dec 2025
22jeffreyepsteineducation.comGoDaddy.com, LLC3 Mar 20237 Mar 20253 Mar 2026
23jeffreyepsteinscience.comNameCheap, Inc.9 Nov 202010 Oct 20249 Nov 2025
24jeffreyepsteinblog.comWeb Commerce Communications Limited dba WebNic.cc2 Oct 20242 Oct 20242 Oct 2025
25jeffreyepsteinusvi.comGoDaddy.com, LLC3 Mar 20237 Mar 20253 Mar 2026
26jeffreyepsteindershowitztrumpacosta.comGoDaddy.com, LLC26 Feb 201926 Feb 201926 Feb 2020
27jeffreyepsteinsucks.comGoDaddy.com, LLC8 Jul 20198 Jul 20248 Jul 2025
28jeffreyepsteinscandal.comGoDaddy.com, LLC9 Jul 201928 Mar 20259 Jul 2025
29jeffreyepsteinsexscandal.comGoDaddy.com, LLC10 Jul 201928 Mar 202510 Jul 2025
30jeffreyepsteinlawsuit.comGoDaddy.com, LLC12 Jul 201912 Jul 201912 Jul 2020
31jeffreyepsteinvictims.comGoDaddy.com, LLC22 Jul 201922 Jul 201922 Jul 2020
32jeffreyepsteinnews.comGoDaddy.com, LLC24 Jul 20195 Oct 202424 Jul 2024
33jeffreyepsteinforum.comGoDaddy.com, LLC3 Mar 20237 Mar 20253 Mar 2026
34jeffreyepsteincase.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
35jeffreyepsteindeath.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
36jeffreyepsteinsuicide.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
37jeffreyepsteinexposed.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
38jeffreyepsteinfounddead.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2021
39jeffreyepsteinssuicide.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
40jeffreyepsteindead.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
41jeffreyepsteindied.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
42jeffreyepsteinconspiracy.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
43jeffreyepsteincommittedsuicide.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
44jeffreyepsteinobituary.comNameCheap, Inc.10 Aug 2019-10 Aug 2020
45jeffreyepsteinthemovie.comHiChina Zhicheng Technology Limited11 Aug 201911 Aug 201911 Aug 2020
46jeffreyepsteinisdead.comTucows Domains Inc.10 Aug 20197 Aug 202410 Aug 2025
47jeffreyepsteinmovie.comGoogle, Inc.13 Aug 201912 Sep 202413 Aug 2024
48jeffreyepsteinblackbook.comGoDaddy.com, LLC15 Aug 201915 Aug 201915 Aug 2020
49jeffreyepsteinmurder.comGoDaddy.com, LLC17 Aug 201928 Sep 202417 Aug 2024
50jeffreyepsteinwasmurdered.comGoDaddy.com, LLC17 Aug 201917 Aug 201917 Aug 2020
51jeffreyepsteinclaims.comGoDaddy.com, LLC23 Aug 201923 Aug 201923 Aug 2020
52jeffreyepsteindidntkillhimself.comNameCheap, Inc.30 Oct 201930 Sep 202430 Oct 2025
53jeffreyepsteindidntkillhimself.fyiNameCheap, Inc.4 Nov 20194 Nov 20194 Nov 2020
54jeffreyepsteindidntcommitsuicide.comGoDaddy.com, LLC4 Nov 20194 Nov 20194 Nov 2020
55jeffreyepsteindidnotkillhimself.comFastDomain Inc.9 Nov 20199 Nov 20199 Nov 2020
56jeffreyepsteindidntkillhimself.netCrazy Domains FZ-LLC11 Jul 20229 Jul 202411 Jul 2026
57jeffreyepsteindidnthanghimself.comFastDomain Inc.18 Nov 201918 Nov 201918 Nov 2020
58jeffreyepsteindidnothanghimself.comGoDaddy.com, LLC8 Dec 20198 Dec 20198 Dec 2020
59jeffreyepsteinmobile.comGoDaddy.com, LLC7 Jan 20207 Jan 20207 Jan 2021
60jeffreyepsteinbook.comTucows Domains Inc.15 Jan 20201 Jan 202515 Jan 2026
61jeffreyepsteinpodcast.comGoDaddy.com, LLC14 Mar 202013 May 202514 Mar 2026
62jeffreyepsteindidntkillhimself.inforegister.com, Inc.13 Dec 201911 Feb 202013 Dec 2020
63jeffreyepsteinslittleblackbook.comKey-Systems GmbH1 Jun 20201 Jun 20201 Jun 2021
64jeffreyepsteingop.comGoDaddy.com, LLC12 Jul 202012 Jul 202012 Jul 2021
65jeffreyepsteinclaim.comGoDaddy.com, LLC14 Aug 202015 Aug 202314 Aug 2026
66jeffreyepsteinsettlements.comGoDaddy.com, LLC14 Aug 202015 Aug 202314 Aug 2026
67jeffreyepsteinsettlement.comGoDaddy.com, LLC14 Aug 202015 Aug 202314 Aug 2026
68jeffreyepsteinismybestfriend.comGoDaddy.com, LLC16 Sep 202016 Sep 202016 Sep 2021
69jeffreyepsteinlives.comGoDaddy.com, LLC22 Nov 202022 Nov 202022 Nov 2021
70jeffreyepsteinsfriends.comGoDaddy.com, LLC5 Aug 20216 Aug 20245 Aug 2025
71jeffreyepsteindidntkillhimselfcoin.comInternet Domain Services BS Corp10 Aug 202110 Aug 202110 Aug 2022
72jeffreyepsteinisntdead.loveGoDaddy.com, LLC9 Oct 20219 Oct 20219 Oct 2022
73jeffreyepsteinlinens.comGoDaddy.com, LLC15 Oct 202126 Nov 202415 Oct 2024
74jeffreyepsteinfanclub.comGoDaddy.com, LLC4 Jan 202217 Mar 20244 Jan 2024
75jeffreyepsteindidntkillhimself.onlineCrazy Domains FZ-LLC7 Jul 20227 Jul 20237 Jul 2024
76jeffreyepsteindidntkillhimself.orgCrazy Domains FZ-LLC7 Jul 202221 Aug 20247 Jul 2026
77jeffreyepsteinsblacklist.comEpik Inc.12 Jul 202223 Aug 202312 Jul 2023
78jeffreyepsteinhotel.comGoDaddy.com, LLC8 Jul 202219 Sep 20238 Jul 2023
79jeffreyepsteinblacklist.comNameKing.com Inc.14 Jul 202227 Aug 202314 Jul 2023
80jeffreyepsteinlist.comSquarespace Domains LLC23 Dec 20238 Dec 202423 Dec 2025
81jeffreyepsteinslist.comSquarespace Domains LLC23 Dec 20238 Dec 202423 Dec 2025
82jeffreyepsteincommunication.comNameCheap, Inc.24 Dec 202324 Nov 202424 Dec 2025
83jeffreyepsteinceleblist.com-1 Jan 20241 Jan 20241 Jan 2025
84jeffreyepsteinceleblist.online-5 Jan 202416 Feb 20255 Jan 2025
85jeffreyepsteinclientlist.online-5 Jan 202416 Feb 20255 Jan 2025
86jeffreyepsteindocuments.online-5 Jan 202416 Feb 20255 Jan 2025
87jeffreyepsteinjimmykimmel.comDynadot, LLC10 Jan 202422 Mar 202510 Jan 2025
88jeffreyepsteinsisland.comNetwork Solutions, LLC21 Apr 20243 Jun 202521 Apr 2025
89jeffreyepsteinyearbook.comGoDaddy.com, LLC31 Aug 202431 Aug 202431 Aug 2025
90jeffreyepsteinflightlogs.com-28 Feb 202527 Jun 202528 Feb 2026
91jeffreyepsteinguestbook.com-28 Feb 202527 Jun 202528 Feb 2026
92jeffreyepsteingpt.comNameCheap, Inc.28 Feb 202528 Feb 202528 Feb 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=jeffreyepstein

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now