Our database now contains whois records of 666 Million (666,157,476) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1595 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [666 Million Domains] $10,000 Details

Keyword: JAWLA

Reverse Whois » KEYWORD [jawla ]  { 281 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1jawla.orgNameCheap, Inc.16 Jul 202521 Jul 202516 Jul 2026
2jawla.comName.com, Inc.6 Jul 200227 Mar 20256 Jul 2027
3jawla.netDynadot, LLC13 Jul 200313 Oct 202513 Jul 2026
4jawla.fr-5 Sep 2017-5 Sep 2018
5jawla.info1&1 Internet AG9 Nov 202524 Nov 20259 Nov 2026
6jawla.toursNameCheap, Inc.19 Jan 202019 Jan 202019 Jan 2021
7jawla.worldNameCheap, Inc.19 Jan 202019 Jan 202019 Jan 2021
8jawla.cloudHostinger, UAB23 Oct 202528 Oct 202523 Oct 2026
9jawla.techGoDaddy.com, LLC15 Dec 202326 Jan 202515 Dec 2024
10jawla.xyzGoDaddy.com, LLC15 Apr 202424 Jun 202515 Apr 2026
11jawla.ma-2 Jun 20113 Jul 20252 Jun 2026
12jawla.ae----
13jawla.appGoDaddy.com, LLC8 Oct 201922 Nov 20258 Oct 2027
14jawla.artPorkbun, LLC11 Jun 202011 Jul 202511 Jun 2026
15jawla.co.uk-7 Jul 20257 Jul 20257 Jul 2030
16jawla.guideAutomattic Inc.26 Feb 202326 Feb 202326 Feb 2024
17jawla.ioNameCheap, Inc.22 Aug 202527 Aug 202522 Aug 2026
18jawla.link1API GmbH16 Aug 202329 Sep 202416 Aug 2024
19jawla.liveHostinger, UAB8 May 202218 Jul 20238 May 2023
20jawla.nl-28 Apr 20217 May 2025-
21jawla.onlineGoDaddy.com, LLC8 Oct 201920 Nov 20258 Oct 2027
22jawla.picsNameCheap, Inc.28 Jun 20228 Sep 202328 Jun 2023
23jawla.storeNameCheap, Inc.23 Feb 20246 May 202523 Feb 2025
24jawla.shopGoDaddy.com, LLC7 Oct 202318 Nov 20247 Oct 2024
25jawla.om----
26jawla.siteNameCheap, Inc.22 Aug 20251 Sep 202522 Aug 2026
27jawlany.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Nov 200622 Oct 20252 Nov 2027
28jawlanews.comGoDaddy.com, LLC12 Feb 201528 Mar 202512 Feb 2026
29jawla24.comNameKing.com Inc.25 May 201526 May 202525 May 2026
30jawlan.netHangzhou AiMing Network Co., LTD7 Feb 20158 Feb 20157 Feb 2018
31jawlabs.comNameKing.com Inc.29 Jan 201722 Jan 202529 Jan 2026
32jawlanorg.orgChengdu West Dimension Digital Technology Co., Ltd…1 Dec 2015-1 Dec 2016
33jawlany.netPDR Ltd. d/b/a PublicDomainRegistry.com2 Sep 20192 Sep 20192 Sep 2021
34jawlany.orgPDR Ltd. d/b/a PublicDomainRegistry.com28 Sep 201428 Sep 201428 Sep 2015
35jawlapress.comGoDaddy.com, LLC25 Nov 201425 Nov 201425 Nov 2015
36jawlawnj.comGoDaddy.com, LLC25 Nov 201426 Nov 202425 Nov 2026
37jawla1.comTucows Domains Inc.4 Feb 20158 Feb 20164 Feb 2017
38jawlan.bizHiChina Zhicheng Technology Limited9 Feb 201511 Sep 20178 Feb 2018
39jawlataddoha.comGMO Internet Inc.1 Oct 20214 Oct 20211 Oct 2022
40jawlawyer.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Sep 20151 Sep 20163 Sep 2017
41jawlawns.comGoDaddy.com, LLC12 Jun 201512 Jun 201512 Jun 2016
42jawla-syria.comOnlineNIC, Inc.16 Jun 201519 Jun 201716 Jun 2017
43jawlaty.comGoDaddy.com, LLC18 Jul 202328 Jul 202518 Jul 2026
44jawlainfo.comEntrust Domains, LLC12 Sep 201813 Sep 201812 Sep 2019
45jawlat.miamiHello Internet Corp.19 Oct 2015-19 Oct 2016
46jawlah.xyzHostinger, UAB21 Oct 201521 Oct 201521 Oct 2016
47jawlah.netGoDaddy.com, LLC29 Jul 20256 Aug 202529 Jul 2026
48jawlaweb.comOVH sas17 Dec 201517 Dec 201517 Dec 2016
49jawlati.comGoDaddy.com, LLC17 Jan 201618 Jan 202617 Jan 2027
50jawlafbladi.comGoDaddy.com, LLC31 Jan 201631 Jan 201631 Jan 2017
51jawlanyat.comGoDaddy.com, LLC1 Feb 201630 Aug 20211 Feb 2023
52jawlaengineering.netPDR Ltd. d/b/a PublicDomainRegistry.com23 May 20239 May 202523 May 2026
53jawlanews.netDomain.com, LLC8 Jun 20168 Jun 20168 Jun 2017
54jawlat.comGoDaddy.com, LLC5 Oct 200514 Sep 20255 Oct 2026
55jawlan.topJiangsu Bangning Science and technology Co. Ltd.23 Jul 2015-23 Jul 2016
56jawlakianlaw.comNameCheap, Inc.26 Jul 201618 Jul 202226 Jul 2026
57jawlan.comTurnCommerce, Inc. DBA NameBright.com12 Jan 20146 Jan 202112 Jan 2026
58jawlahtours.comGoDaddy.com, LLC31 May 20091 Jun 202531 May 2026
59jawlaf.comJiangsu Bangning Science and technology Co. Ltd.3 Jul 20203 Jul 20203 Jul 2021
60jawlah-tours.comGoDaddy.com, LLC1 Mar 20072 Mar 20251 Mar 2026
61jawlah.comeNom, Inc.9 Jul 20022 Jan 20259 Jul 2030
62jawlandbundon.comGoDaddy.com, LLC17 Jan 199817 Jan 202616 Jan 2027
63jawlatturkey.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Apr 20136 Jun 201729 Apr 2018
64jawlaengineering.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Sep 201129 Jun 202123 Sep 2026
65jawlawky.comGoDaddy.com, LLC18 Jul 200810 Jun 202518 Jul 2026
66jawlawgroup.comGoDaddy.com, LLC25 Apr 201326 Apr 202525 Apr 2026
67jawlawfirm.comGoDaddy.com, LLC4 Sep 202512 Sep 20254 Sep 2028
68jawlab.comGoDaddy.com, LLC17 Oct 20077 Jun 202417 Oct 2027
69jawlawdui.comGoDaddy.com, LLC23 Aug 201224 Aug 201623 Aug 2017
70jawlaa.comHostinger, UAB31 Jul 20244 Jul 202531 Jul 2026
71jawlattourkia.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Apr 20136 Jun 201729 Apr 2018
72jawlaw.comeNom, Inc.26 Jun 200327 Jun 202526 Jun 2026
73jawlands.comGoDaddy.com, LLC26 Mar 201427 Mar 202526 Mar 2026
74jawlaw.netGoDaddy.com, LLC26 Jan 200326 Jan 202526 Jan 2026
75jawlawpodcast.comGoDaddy.com, LLC15 Oct 201616 Oct 202515 Oct 2026
76jawlawshow.comGoDaddy.com, LLC15 Oct 201616 Oct 202515 Oct 2026
77jawlan.orgGoDaddy.com, LLC16 Nov 200331 Dec 202516 Nov 2026
78jawla-care.com-31 Oct 201631 Oct 201631 Oct 2017
79jawla-malaysia.comTucows Domains Inc.3 Nov 20167 Nov 20173 Nov 2017
80jawlawmusic.comMesh Digital Limited6 Nov 201611 Nov 20176 Nov 2017
81jawlate.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…5 Dec 20165 Dec 20175 Dec 2018
82jawland.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…8 Dec 20165 Dec 20178 Dec 2018
83jawlakhart.comHiChina Zhicheng Technology Limited9 Mar 201810 Mar 20189 Mar 2019
84jawlast.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…18 Dec 201620 Jan 201718 Dec 2018
85jawlay.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…20 Dec 201620 Jan 201720 Dec 2017
86jawlaw.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…20 Dec 201620 Dec 201620 Dec 2017
87jawlatechnology.comCronon AG4 May 20174 May 20174 May 2018
88jawlaadvancetechnology.infoGoDaddy.com, LLC13 May 201712 Jul 201713 May 2018
89jawlaadvancetechnology.orgGoDaddy.com, LLC13 May 201713 Jul 201713 May 2018
90jawlaadvancetechnology.netGoDaddy.com, LLC13 May 201713 May 201713 May 2018
91jawlaadvancetechnology.comHosting Concepts B.V. dba Openprovider19 Dec 202519 Dec 202519 Dec 2026
92jawlatyapp.comName.com, Inc.25 May 201728 May 201725 May 2018
93jawlax.com1API GmbH16 Jun 201721 Nov 202516 Jun 2026
94jawlacargopackers.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Aug 201723 Aug 201723 Aug 2018
95jawlattours.comNetwork Solutions, LLC1 Dec 20171 Dec 20171 Dec 2018
96jawlat360.comNamesilo, LLC6 Dec 20177 Dec 20176 Dec 2018
97jawlah-app.comLaunchpad, Inc.2 Mar 20182 Mar 20182 Mar 2019
98jawlapackers.comMat Bao Trading & Service Company Limited d/b/a Ma…28 Aug 202328 Oct 202428 Aug 2024
99jawlawtrial.comFastDomain Inc.7 Apr 20187 Apr 20187 Apr 2019
100jawlawoffice.comGoogle, Inc.1 May 201822 Apr 20251 May 2026
101jawlawoffice.netGoogle, Inc.1 May 201822 Apr 20251 May 2026
102jawlaw.legalGoDaddy.com, LLC21 Jun 20185 Aug 202521 Jun 2026
103jawla12.comName.com, Inc.23 Sep 201823 Sep 201823 Sep 2019
104jawlawllc.comNetwork Solutions, LLC24 Sep 201824 Sep 201824 Sep 2019
105jawlane.comGoDaddy.com, LLC26 Sep 201826 Sep 201826 Sep 2019
106jawla-today.comName.com, Inc.23 Oct 201823 Oct 201823 Oct 2019
107jawla-alyom.comGoDaddy.com, LLC2 Dec 20182 Dec 20182 Dec 2019
108jawlake.comGoDaddy.com, LLC11 Dec 201811 Dec 201811 Dec 2019
109jawlahby.infoGoDaddy.com, LLC7 Jan 20197 Jan 20197 Jan 2020
110jawlahby.netGoDaddy.com, LLC7 Jan 20197 Jan 20197 Jan 2020
111jawlahby.comGoDaddy.com, LLC7 Jan 20197 Jan 20197 Jan 2020
112jawlatcom.comTurnCommerce, Inc. DBA NameBright.com7 Apr 202218 Jun 20257 Apr 2025
113jawlatcom.neteNom, Inc.17 Jan 201917 Jan 201917 Jan 2020
114jawlasa.comHostinger, UAB17 Jan 202328 Mar 202417 Jan 2024
115jawla-awkawk.comGoogle, Inc.17 Mar 201917 Mar 201917 Mar 2020
116jawlahalamiyah.comeNom, Inc.14 Apr 201914 Apr 201914 Apr 2020
117jawla7.comHostinger, UAB26 Jul 20242 Jul 202526 Jul 2026
118jawlatte.comTop Pick Names LLC26 Dec 202430 Dec 202526 Dec 2026
119jawlah-tour.comNameCheap, Inc.28 May 201928 May 201928 May 2020
120jawla360.comGoDaddy.com, LLC13 Feb 202214 Feb 202413 Feb 2026
121jawlahbh.comGoDaddy.com, LLC29 Aug 201930 Aug 202529 Aug 2026
122jawlacollo.comNetwork Solutions, LLC17 Sep 201917 Sep 201917 Sep 2020
123jawlatech.comNameCheap, Inc.24 Nov 2021-24 Nov 2022
124jawlapp.netGoDaddy.com, LLC8 Oct 20198 Oct 20198 Oct 2021
125jawlapp.comGoDaddy.com, LLC8 Oct 20198 Oct 20198 Oct 2021
126jawla-tech.comNameCheap, Inc.27 Oct 2019-27 Oct 2020
127jawlah.clubTucows Domains Inc.22 Nov 201917 Nov 202522 Nov 2026
128jawland.comGoDaddy.com, LLC13 Aug 20223 Aug 202513 Aug 2026
129jawlatna.comNameCheap, Inc.8 Jun 20249 May 20258 Jun 2026
130jawlatourism.comregister.com, Inc.2 Jul 202214 Sep 20232 Jul 2023
131jawlatravel.comHostinger, UAB28 Jun 202429 Jun 202528 Jun 2026
132jawlandcindyfloral.comMarkMonitor Inc.17 Jan 202017 Jan 202017 Jan 2021
133jawlaapp.comNameCheap, Inc.19 Jan 2020-19 Jan 2021
134jawlacloud.netNameCheap, Inc.21 Jan 2020-21 Jan 2021
135jawlacloud.comNameCheap, Inc.21 Jan 2020-21 Jan 2021
136jawlahtasawk.comName.com, Inc.22 Jan 202024 Jan 202122 Jan 2021
137jawlaat.comGoDaddy.com, LLC11 May 202511 May 202511 May 2026
138jawladz.comOVH sas27 Mar 202027 Mar 202027 Mar 2021
139jawlaofficial.comGoDaddy.com, LLC18 Apr 202029 Apr 202418 Apr 2025
140jawlax-horse.com1API GmbH30 Apr 202021 Nov 202530 Apr 2026
141jawlashop.comNameCheap, Inc.30 Jul 202531 Jul 202530 Jul 2026
142jawlafilweb.comGoDaddy.com, LLC18 Jul 202018 Jul 202018 Jul 2021
143jawlanioun.netFastDomain Inc.24 Aug 202018 Nov 202324 Aug 2024
144jawla365.onlineHostinger, UAB19 Sep 20202 Nov 202519 Sep 2025
145jawlatoday.comGoDaddy.com, LLC4 Oct 202016 Oct 20244 Oct 2025
146jawlaso.icuAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…9 Oct 20209 Oct 20209 Oct 2021
147jawlani.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED3 Nov 20203 Nov 20203 Nov 2021
148jawlahstore.comGoDaddy.com, LLC24 Dec 202024 Dec 202024 Dec 2021
149jawlandscaping.comWix.com Ltd.16 Aug 202316 Aug 202316 Aug 2026
150jawlark.comWest263 International Limited20 Aug 20243 Nov 202520 Aug 2025
151jawlatinos.comGoDaddy.com, LLC30 Jan 202112 Mar 202430 Jan 2024
152jawlagroup.comGoDaddy.com, LLC8 Mar 202119 Apr 20238 Mar 2023
153jawlate.comLaunchpad, Inc.9 Mar 202121 Apr 20259 Mar 2025
154jawlands.netGoogle, Inc.15 Mar 202115 Mar 202115 Mar 2022
155jawlatt.comLaunchpad, Inc.12 Apr 202112 Feb 202512 Apr 2026
156jawlamedia.comTucows Domains Inc.28 Apr 20212 May 202228 Apr 2022
157jawlagarnos.techHostinger, UAB29 May 202129 May 202129 May 2022
158jawlaherbs.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Jun 202020 Jul 20238 Jun 2023
159jawladdesigns.com1&1 Internet AG8 Sep 20218 Sep 20218 Sep 2026
160jawlar.comNameCheap, Inc.7 Oct 2021-7 Oct 2022
161jawlab.techDOTSERVE INC.11 Nov 202111 Nov 202111 Nov 2022
162jawlabestnutrition.comGMO Internet Inc.8 Dec 20219 Dec 20218 Dec 2022
163jawlainvest.comHostinger, UAB10 Jan 202211 Jan 202610 Jan 2027
164jawlah.coGoDaddy.com, LLC30 Apr 201913 Jul 202530 Apr 2027
165jawlatfimalaysia.comPDR Ltd. d/b/a PublicDomainRegistry.com10 May 202211 May 202410 May 2025
166jawlaa.id-23 Nov 201928 Nov 202123 Nov 2022
167jawlatechnology.in-10 Jun 201710 Jun 202510 Jun 2026
168jawlavpn.appPorkbun, LLC18 Aug 202228 Aug 202318 Aug 2024
169jawla360.netNameCheap, Inc.22 Aug 20224 Sep 202522 Aug 2026
170jawlashop.onlineDynadot, LLC26 Aug 202226 Aug 202226 Aug 2023
171jawlataqar.comDNC Holdings, Inc.5 Sep 202217 Nov 20255 Sep 2025
172jawlat.netGoDaddy.com, LLC12 Oct 202214 Sep 202512 Oct 2026
173jawlaadvancepackagingmachines.comTucows Domains Inc.21 Feb 201825 Sep 202521 Feb 2027
174jawlattportal.comeNom, Inc.3 Nov 202215 Jan 20253 Nov 2024
175jawla360.onlineNameCheap, Inc.20 Dec 20221 Mar 202420 Dec 2023
176jawlatk.comGoDaddy.com, LLC13 Sep 202513 Sep 202513 Sep 2028
177jawlatinternational.comHostinger, UAB5 Jan 202316 Mar 20245 Jan 2024
178jawlaw.attorneyGoDaddy.com, LLC21 Jun 20185 Aug 202521 Jun 2026
179jawlawolf.comNetEarth One Inc. d/b/a NetEarth22 Jan 202322 Mar 202422 Jan 2024
180jawlatours.comGoDaddy.com, LLC7 May 201814 May 20247 May 2028
181jawlak.comGoDaddy.com, LLC26 Jan 20238 Mar 202426 Jan 2024
182jawla-tourism.comGoDaddy.com, LLC28 Jan 20233 Feb 202428 Jan 2026
183jawlathechuck.comNamesilo, LLC31 Jan 20231 Feb 202431 Jan 2025
184jawlaz.comLigne Web Services SARL10 Jul 202310 Jul 202310 Jul 2024
185jawlandservices.comWix.com Ltd.21 Feb 202322 Jan 202521 Feb 2026
186jawlat.appGoDaddy.com, LLC26 Feb 20239 Apr 202526 Feb 2025
187jawlamusic.comGMO Internet Inc.7 May 20257 May 20257 May 2026
188jawla365.comDropCatch.com 999 LLC29 Aug 202510 Nov 202529 Aug 2026
189jawla3d.comHostinger, UAB20 Mar 202321 Feb 202520 Mar 2026
190jawlahj.comHostinger, UAB13 Mar 202126 May 202513 Mar 2025
191jawlayn-shy.comGoDaddy.com, LLC12 Apr 202127 Apr 202412 Apr 2025
192jawlaatravel.comGoDaddy.com, LLC31 Mar 20221 Apr 202431 Mar 2026
193jawlah360.comDynadot, LLC13 Jan 202422 Dec 202513 Jan 2027
194jawlamarket.comNameCheap, Inc.18 Jun 202219 Jun 202518 Jun 2026
195jawlas.jp-24 Sep 20091 Oct 202530 Sep 2026
196jawlaw.lawyerGoDaddy.com, LLC21 Jun 20185 Aug 202521 Jun 2026
197jawlaty.neteNom, Inc.20 Feb 20246 Feb 202520 Feb 2026
198jawlaw.orgGoDaddy.com, LLC12 Apr 201910 Apr 202512 Apr 2026
199jawlah2030.comName.com, Inc.8 Jun 202321 Aug 20248 Jun 2024
200jawlashop.storeNameCheap, Inc.12 Jun 202324 Jul 202412 Jun 2024
201jawlat-almamlaka.siteHostinger, UAB27 Jun 202328 Jun 202527 Jun 2026
202jawlat-almamlaka-ksa.siteHostinger, UAB30 Jun 20236 Aug 202430 Jun 2024
203jawlat-almamlakas.onlineHostinger, UAB1 Jul 20232 Jul 20251 Jul 2026
204jawlat-almamlaksa.onlineHostinger, UAB2 Jul 20238 Aug 20242 Jul 2024
205jawlat-almamlaka-jadah.siteHostinger, UAB2 Jul 20238 Aug 20242 Jul 2024
206jawlat-almamlaka-jedeh.onlineHostinger, UAB4 Jul 202310 Aug 20244 Jul 2024
207jawlat-almamlak-jedeh.siteHostinger, UAB4 Jul 202310 Aug 20244 Jul 2024
208jawlat-almamlaka-ahsa.siteHostinger, UAB4 Jul 20235 Jul 20254 Jul 2026
209jawlat-almamlak.siteHostinger, UAB5 Jul 202311 Aug 20245 Jul 2024
210jawlavr.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Jul 202318 Aug 20247 Jul 2024
211jawlah.orgName.com, Inc.9 Jul 202320 Sep 20259 Jul 2025
212jawlanarchive.orgNetwork Solutions, LLC5 Aug 202326 Jul 20255 Aug 2026
213jawlat-iketmx.comHosting Concepts B.V. dba Openprovider2 Sep 202312 Sep 20242 Sep 2024
214jawlab.onlineNameCheap, Inc.12 Sep 202324 Oct 202412 Sep 2024
215jawlah-trip.comNameCheap, Inc.18 Sep 202330 Oct 202418 Sep 2024
216jawlandscaping.netGoDaddy.com, LLC19 Sep 202321 Sep 202519 Sep 2026
217jawlazhp.cfdGMO Internet Inc.17 Oct 202327 Dec 202417 Oct 2024
218jawlahonline.comGoDaddy.com, LLC12 Nov 202312 Nov 202312 Nov 2026
219jawlas.za.comNameKing.com Inc.16 Sep 202319 Sep 202416 Sep 2025
220jawlashop02.onlineGoDaddy.com, LLC13 Dec 202314 Dec 202513 Dec 2026
221jawlatalsabah.comHostinger, UAB22 Dec 202323 Dec 202422 Dec 2025
222jawlasp.comCloudFlare, Inc.1 Jan 20242 Dec 20251 Jan 2027
223jawlah-dr.comDynadot, LLC20 Jan 20241 Apr 202520 Jan 2025
224jawlap.comName.com, Inc.23 Jan 20247 Mar 202523 Jan 2025
225jawladubai.comRealtime Register B.V.13 Feb 202417 Jan 202513 Feb 2026
226jawlaty.infoeNom, Inc.20 Feb 202411 Feb 202520 Feb 2026
227jawlaom.comTucows Domains Inc.24 Feb 202424 Feb 202524 Feb 2026
228jawlahcapital.comRealtime Register B.V.25 Feb 202429 Jan 202525 Feb 2026
229jawlatestingequipment.comGMO Internet Inc.2 Mar 20248 Apr 20252 Mar 2025
230jawlaryartworld.comAutomattic Inc.25 Mar 202424 Nov 202525 Mar 2026
231jawlawnj.camNameCheap, Inc.27 Mar 20248 May 202527 Mar 2025
232jawlat.liveNameCheap, Inc.29 Mar 202410 May 202529 Mar 2025
233jawlakwcompany.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Apr 202413 Jun 20251 Apr 2025
234jawlat-almamlaka-jadah.shopHostinger, UAB3 Jul 202312 Sep 20243 Jul 2024
235jawlatripz.comHostinger, UAB26 Apr 20249 Jun 202526 Apr 2025
236jawlah.infoGoDaddy.com, LLC16 May 202427 Jun 202516 May 2025
237jawla15agustka.onlineHostinger, UAB12 Jul 202424 Sep 202512 Jul 2025
238jawlatak.comName.com, Inc.18 Jul 202418 Jul 202518 Jul 2026
239jawlandscape.comGoogle, Inc.7 Aug 202423 Jul 20257 Aug 2026
240jawlattravel.comGoDaddy.com, LLC28 Aug 20249 Sep 202528 Aug 2026
241jawlat.techPDR Ltd. d/b/a PublicDomainRegistry.com6 Sep 202430 Oct 20256 Sep 2026
242jawlaa.storeNameCheap, Inc.16 Sep 202427 Nov 202516 Sep 2025
243jawlatalmosafer.comHostinger, UAB12 Oct 202415 Sep 202512 Oct 2026
244jawlanparis.comTucows Domains Inc.24 Oct 20244 Dec 202524 Oct 2025
245jawlanfilim.cn-13 Aug 2022-13 Aug 2026
246jawlahjo.comGoDaddy.com, LLC18 Jan 202518 Jan 202518 Jan 2028
247jawlastore.comHostinger, UAB22 Jan 202522 Jan 202522 Jan 2026
248jawlapro.comGoDaddy.com, LLC15 Feb 202515 Feb 202515 Feb 2027
249jawlatsa.comGoogle, Inc.17 Feb 202517 Feb 202517 Feb 2026
250jawlatholland.comHostinger, UAB22 Feb 202522 Feb 202522 Feb 2027
251jawlaapplication.comGandi SAS6 Mar 20256 Dec 20256 Mar 2026
252jawlawncare.comWix.com Ltd.17 Mar 202517 Mar 202517 Mar 2026
253jawlageneral.storeHostinger, UAB26 Mar 20258 Sep 202526 Mar 2026
254jawlagame.comHostinger, UAB1 Apr 20251 Apr 20251 Apr 2026
255jawla3d-dz.comHostinger, UAB2 Apr 20252 Apr 20252 Apr 2026
256jawlahvr.comGoDaddy.com, LLC6 Apr 20256 Apr 20256 Apr 2028
257jawlawn.com1&1 Internet AG8 Apr 20258 Apr 20258 Apr 2026
258jawlaa.siteCV. Rumahweb Indonesia23 Apr 20259 May 202523 Apr 2026
259jawlaa.spaceCV. Rumahweb Indonesia23 Apr 20259 May 202523 Apr 2026
260jawlandscapingcle.comWix.com Ltd.27 Apr 202527 Apr 202527 Apr 2026
261jawlah.storeNameCheap, Inc.1 May 20251 Jun 20251 May 2026
262jawlamorocco.comHostinger, UAB12 May 202512 May 202512 May 2027
263jawlah.siteNetwork Solutions, LLC26 May 202531 May 202526 May 2027
264jawlaqatar.comTucows Domains Inc.8 Jun 20258 Jun 20258 Jun 2026
265jawlagame.buzzTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…13 Jun 202522 Oct 202513 Jun 2026
266jawlatprojects.comHosting Concepts B.V. dba Openprovider9 Jul 202524 Jul 20259 Jul 2026
267jawlabs.orgNameCheap, Inc.30 Jul 20254 Aug 202530 Jul 2026
268jawlastfocus.icuNameCheap, Inc.4 Aug 20251 Sep 20254 Aug 2026
269jawlatidelivery.comGoDaddy.com, LLC15 Aug 202515 Aug 202515 Aug 2026
270jawlaar.comHostinger, UAB28 Aug 202528 Aug 202528 Aug 2026
271jawlacars.comInstra Corporation Pty Ltd.1 Sep 202523 Nov 20251 Sep 2026
272jawlatalriyada.comGoogle, Inc.3 Sep 20253 Sep 20253 Sep 2026
273jawlaweb.clickNameCheap, Inc.8 Sep 202513 Sep 20258 Sep 2026
274jawlatna.siteNameCheap, Inc.15 Sep 20251 Oct 202515 Sep 2026
275jawlandiaspora.onlineNameCheap, Inc.19 Sep 20251 Oct 202519 Sep 2026
276jawlah.live-2 Oct 20252 Oct 2025-
277jawlanwassel.com1&1 Internet AG18 Nov 202518 Nov 202518 Nov 2026
278jawlahtrip.comNetwork Solutions, LLC2 Dec 20252 Dec 20252 Dec 2028
279jawlan.net.cn-3 Dec 2025-3 Dec 2026
280jawlanow.comNameCheap, Inc.3 Jan 20263 Jan 20263 Jan 2027
281jawlahsa.comNameCheap, Inc.19 Jan 202619 Jan 202619 Jan 2027

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=jawla

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now