Our database now contains whois records of 708 Million (708,801,947) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1596 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [708 Million Domains] $10,000 Details

Keyword: JAKEWILL

Reverse Whois » KEYWORD [jakewill ]  { 126 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1jakewill.net1&1 Internet AG22 Aug 201522 Aug 201522 Aug 2016
2jakewill.infoNetwork Solutions, LLC3 Jul 20161 Jul 20173 Jul 2018
3jakewill.comBeijing Lanhai Jiye Technology Co., Ltd21 May 200822 Jul 202621 May 2026
4jakewill.xyzCloudFlare, Inc.24 Dec 202529 Dec 202524 Dec 2026
5jakewillcox.comMesh Digital Limited17 Nov 201429 Oct 201717 Nov 2018
6jakewilliams.netGoogle, Inc.2 Oct 201417 Sep 20252 Oct 2026
7jakewillmert.comGoDaddy.com, LLC5 Dec 20145 Dec 20145 Dec 2016
8jakewilliamsart.comTucows Domains Inc.16 Dec 201430 Jan 202616 Dec 2026
9jakewillis.info1&1 Internet AG3 Jan 20159 Apr 20203 Jan 2021
10jakewills.orgName.com, Inc.9 Jan 20159 Jan 20159 Jan 2016
11jakewills.netName.com, Inc.9 Jan 20159 Jan 20159 Jan 2016
12jakewilliams.partyAlpnames Limited7 May 20157 May 20176 May 2017
13jakewilliamstutoring.comGoDaddy.com, LLC3 Apr 20153 Apr 20153 Apr 2016
14jakewilliamstraining.comFastDomain Inc.9 Apr 201531 Mar 20179 Apr 2018
15jakewilliamsonmodel.comeNom, Inc.21 May 201521 May 201521 May 2016
16jakewilliamheckey.comGoDaddy.com, LLC27 May 201527 May 201527 May 2016
17jakewilldesign.comTucows Domains Inc.3 Nov 201530 Jan 20263 Nov 2026
18jakewilliamsactor.comGoDaddy.com, LLC6 Dec 20156 Dec 20156 Dec 2017
19jakewilliamcapistran.comGoDaddy.com, LLC7 Dec 20158 Dec 20257 Dec 2027
20jakewillhelpyouunderstand.comGoDaddy.com, LLC8 Dec 20158 Dec 20158 Dec 2016
21jakewilliamsmusic.comNameCheap, Inc.19 Oct 20204 Oct 202519 Oct 2026
22jakewilliamsmusic.orgTucows Domains Inc.19 Jan 201623 Jan 202319 Jan 2024
23jakewillsmith.comSpaceship, Inc.21 Apr 202214 Apr 202621 Apr 2027
24jakewillswehoconfidentail.orgeNom, Inc.2 Mar 20162 Mar 20162 Mar 2017
25jakewillswehoconfidentail.neteNom, Inc.2 Mar 20162 Mar 20162 Mar 2017
26jakewillswehoconfidentail.comeNom, Inc.2 Mar 20162 Mar 20162 Mar 2017
27jakewillssandiego.comeNom, Inc.2 Mar 20162 Mar 20162 Mar 2017
28jakewillmott.comMesh Digital Limited6 May 201613 May 20176 May 2018
29jakewilliams.uk-8 Mar 20248 Mar 20268 Mar 2026
30jakewillettrealty.comGoDaddy.com, LLC24 Jun 201624 Jun 201624 Jun 2017
31jakewilliamsanders.bizGoDaddy.com, LLC13 Feb 201024 Feb 201712 Feb 2017
32jakewillson.co.uk-4 Mar 201417 Feb 20174 Mar 2018
33jakewilliams.infoPDR Ltd. d/b/a PublicDomainRegistry.com2 Aug 20168 Sep 20172 Aug 2018
34jakewilliamsphotography.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Mar 20234 May 202423 Mar 2024
35jakewillingham.com-27 Aug 201627 Aug 201627 Aug 2017
36jakewilliambaker.comGoDaddy.com, LLC14 Jan 201415 Jan 201614 Jan 2017
37jakewilliamsfitness.comFastDomain Inc.7 Jul 201022 Jul 20177 Jul 2018
38jakewillson.comNetwork Solutions, LLC12 Feb 200517 Jul 202612 Feb 2028
39jakewillis.comDynadot, LLC20 Jan 202121 Jan 202520 Jan 2026
40jakewillow.comMegazone Corp., dba HOSTING.KR25 May 20218 Apr 202625 May 2027
41jakewilliamson.comWebfusion Ltd.12 Jun 20025 Jun 202412 Jun 2033
42jakewillard.comTucows Domains Inc.24 Apr 20189 Apr 202624 Apr 2027
43jakewilloughby.comGandi SAS19 Jun 201315 May 202619 Jun 2027
44jakewills.comGoogle, Inc.22 Feb 20237 Feb 202622 Feb 2027
45jakewilliamsanders.comDomainwards.com LLC3 May 20183 May 20183 May 2019
46jakewilliam.comAnnulet LLC21 Mar 20136 Mar 202621 Mar 2027
47jakewilliamrichardson.comGoDaddy.com, LLC30 May 201431 May 201630 May 2018
48jakewillers.comDreamHost, LLC21 Nov 200721 Nov 202521 Nov 2026
49jakewilliams.comNameCheap, Inc.30 Aug 20015 Mar 202630 Aug 2035
50jakewilliamsanders.infoGoDaddy.com, LLC13 Feb 20104 Feb 201713 Feb 2018
51jakewilliamsanders.mobiGoDaddy.com, LLC13 Feb 201013 Feb 201613 Feb 2017
52jakewilliamsanders.netGoDaddy.com, LLC13 Feb 201021 Jan 201513 Feb 2017
53jakewilliams.orgGoDaddy.com, LLC26 Mar 200710 May 202626 Mar 2027
54jakewilliamsanders.orgGoDaddy.com, LLC13 Feb 201013 Feb 201613 Feb 2017
55jakewilliamsdesign.orgGoDaddy.com, LLC24 Apr 201411 Feb 201624 Apr 2018
56jakewilliams.tvGoDaddy.com, LLC18 Feb 202619 Apr 202618 Feb 2027
57jakewillphotography.comGoDaddy.com, LLC26 Nov 201626 Nov 201626 Nov 2018
58jakewilliamson.netGoDaddy.com, LLC10 Jan 201710 Jan 201710 Jan 2018
59jakewilliamsfilm.comTucows Domains Inc.4 Mar 20174 Mar 20174 Mar 2018
60jakewilliamshomeloans.comGoDaddy.com, LLC7 Mar 20177 Mar 20177 Mar 2018
61jakewilliamscreative.comTucows Domains Inc.4 May 201719 Apr 20264 May 2027
62jakewilliams-photography.comTucows Domains Inc.5 Sep 201725 Jan 20265 Sep 2026
63jakewilliamslandscapetreeservice.comNetwork Solutions, LLC25 Sep 201725 Sep 201725 Sep 2018
64jakewills.co.uk-7 Dec 20157 Nov 20257 Dec 2027
65jakewilliamson.co.uk-30 Apr 200317 Jun 202430 Apr 2028
66jakewilliamsweight.loanNameCheap, Inc.23 Jan 201823 Jan 201823 Jan 2019
67jakewilliamsstudio.comTucows Domains Inc.26 May 201830 May 201926 May 2019
68jakewillmoveyou.comGoDaddy.com, LLC22 Jun 201822 Jun 201822 Jun 2019
69jakewillsellit.comTLDs LLC dba SRSplus8 Jul 202320 Aug 20248 Jul 2024
70jakewillbuyit.comGoDaddy.com, LLC12 Apr 201912 Apr 201912 Apr 2021
71jakewilliamsimages.comGoDaddy.com, LLC20 Apr 201921 Apr 202520 Apr 2027
72jakewilliamschiro.comGoogle, Inc.29 Apr 201930 Apr 202429 Apr 2025
73jakewills.fitnessParagon Internet Group Ltd t/a Paragon Names14 May 201924 Jun 202014 May 2020
74jakewillrealtor.comGoDaddy.com, LLC13 May 201913 May 201913 May 2021
75jakewilliamsvisuals.comTucows Domains Inc.28 Sep 201929 Jan 202628 Sep 2026
76jakewilliamsoficial.comWix.com Ltd.8 Nov 20198 Nov 20198 Nov 2020
77jakewilliammeans.comHostinger, UAB28 Nov 201928 Nov 201928 Nov 2020
78jakewillismusic.comGoDaddy.com, LLC8 Jan 20209 Jan 20268 Jan 2029
79jakewillsmedia.comTucows Domains Inc.15 Mar 202028 Feb 202615 Mar 2027
80jakewilliamsautomotives.co.uk-17 Oct 201914 Oct 202417 Oct 2026
81jakewilliamsjr.comFastDomain Inc.15 Jul 202015 Jul 202015 Jul 2022
82jakewilliams.xyzTucows Domains Inc.27 May 20188 Jun 202627 May 2027
83jakewillfixit.comAutomattic Inc.24 Aug 202024 Nov 202524 Aug 2026
84jakewilliamson.restNameCheap, Inc.5 Jan 202029 Jan 20205 Jan 2021
85jakewillsellitquick.comGoDaddy.com, LLC30 Oct 202030 Oct 202030 Oct 2021
86jakewillsellitquickpolski.comGoDaddy.com, LLC31 Oct 202031 Oct 202031 Oct 2021
87jakewillhelp.comAmazon Registrar, Inc.23 Nov 20206 Jan 202523 Nov 2024
88jakewilliamstark.comGoogle, Inc.1 Jan 20211 Jan 20211 Jan 2022
89jakewilliamshq.comInstra Corporation Pty Ltd.18 Mar 202123 May 202418 Mar 2024
90jakewillis.designGoogle, Inc.22 Mar 202113 Mar 202622 Mar 2027
91jakewillsellyourhome.comTucows Domains Inc.18 Oct 202422 Oct 202518 Oct 2026
92jakewilliamsmusicpage.comSquarespace Domains LLC3 May 202118 Apr 20263 May 2027
93jakewilliswrites.com1&1 Internet AG3 May 20213 May 20213 May 2022
94jakewillis.artTucows Domains Inc.25 Aug 20214 Nov 202325 Aug 2023
95jakewilliamsonphotography.comNameCheap, Inc.3 Sep 202122 Aug 20253 Sep 2026
96jakewilliams.lifeGoogle, Inc.24 Aug 202224 Aug 202224 Aug 2023
97jakewillssailing.com1&1 Internet AG2 Sep 20229 Oct 20252 Sep 2026
98jakewillssailing.co.uk-2 Sep 20223 Aug 20242 Sep 2026
99jakewilliams.bizCommuniGal Communication Ltd.30 Sep 202227 Sep 202330 Sep 2023
100jakewilliamsfit.comGoogle, Inc.7 Oct 20223 Oct 20257 Oct 2026
101jakewilliamlieder.comActive Market Domains LLC29 Jan 202414 Mar 202529 Jan 2025
102jakewilliams.bioGoDaddy.com, LLC31 Mar 201911 Jun 202531 Mar 2025
103jakewilliams.devName.com, Inc.3 Mar 202310 Oct 20253 Mar 2027
104jakewilltraining.comWix.com Ltd.28 Mar 20218 May 202428 Mar 2024
105jakewillenstutoring.comSquarespace Domains LLC24 May 20229 May 202624 May 2027
106jakewilliamchilds.comGoogle, Inc.7 Jun 202227 Jun 20267 Jun 2026
107jakewillwerth.comGoDaddy.com, LLC18 Jun 202219 Jun 202518 Jun 2026
108jakewillsmith.rocksNameKing.com Inc.21 Apr 202221 Apr 202321 Apr 2024
109jakewillstark.comGoogle, Inc.2 Jun 20232 Aug 20242 Jun 2024
110jakewilliamsmusic.netSquarespace Domains LLC26 Jun 202311 Jun 202626 Jun 2027
111jakewilliambecker.comTucows Domains Inc.16 Aug 202320 Aug 202516 Aug 2026
112jakewillspoetry.comAutomattic Inc.1 Nov 20231 Nov 20231 Nov 2024
113jakewilliamsguitar.comGoDaddy.com, LLC12 Feb 202412 Feb 202412 Feb 2029
114jakewilley.comSquarespace Domains LLC19 Feb 20244 Feb 202619 Feb 2027
115jakewilliams.co.uk-13 May 201721 May 202613 May 2027
116jakewilliams.workTucows Domains Inc.5 Aug 201815 Oct 20255 Aug 2026
117jakewilliamsdesign.co.uk-26 Jul 202011 Jul 202326 Jul 2024
118jakewilliamsict.co.uk-13 Apr 20209 Apr 202513 Apr 2027
119jakewillroam.comGoDaddy.com, LLC7 Aug 202412 Aug 20257 Aug 2026
120jakewilliamscopy.comSquarespace Domains LLC9 Sep 202421 Oct 20259 Sep 2025
121jakewilliams.siteHostinger, UAB24 Mar 20256 Jun 202624 Mar 2026
122jakewilliams.ca-16 Jul 20251 Jul 202616 Jul 2027
123jakewilliamspt.comCloudFlare, Inc.15 Oct 202523 Oct 202515 Oct 2026
124jakewilliamsdesign.comGoDaddy.com, LLC9 Jan 20269 Jan 20269 Jan 2027
125jakewilliamsvisual.comGoDaddy.com, LLC6 May 20266 May 20266 May 2029
126jakewilliams.com.au--6 Jun 2026-

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=jakewill

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now