With support for 
Keyword: INDEPENDANT
Reverse Whois » KEYWORD [independant ] { 1,440 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | independant.info | CommuniGal Communication Ltd. | 30 Oct 2024 | 4 Nov 2024 | 30 Oct 2025 |
| 2 | independant.paris | Gandi SAS | 2 Dec 2014 | 1 Dec 2015 | 2 Dec 2016 |
| 3 | independant.immo | OVH sas | 10 Dec 2014 | 6 Dec 2024 | 10 Dec 2025 |
| 4 | independant.party | Name.com, Inc. | 11 Mar 2019 | 16 Mar 2019 | 11 Mar 2020 |
| 5 | independant.news | NameCheap, Inc. | 3 Feb 2025 | 8 Feb 2025 | 3 Feb 2026 |
| 6 | independant.expert | Hosting Concepts B.V. dba Openprovider | 31 Jul 2015 | 14 Sep 2024 | 31 Jul 2025 |
| 7 | independant.consulting | Hosting Concepts B.V. dba Openprovider | 31 Jul 2015 | 14 Sep 2024 | 31 Jul 2025 |
| 8 | independant.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 8 Mar 2024 | 16 May 2025 | 8 Mar 2025 |
| 9 | independant.financial | Crazy Domains FZ-LLC | 10 Sep 2015 | 6 Jan 2017 | 10 Sep 2017 |
| 10 | independant.film | united-domains AG | 6 Oct 2015 | 20 Nov 2016 | 6 Oct 2017 |
| 11 | independant.feedback | Reserved for non-billable transactions where Regis… | 15 Oct 2015 | 30 Nov 2024 | 15 Oct 2025 |
| 12 | independant.site | Gandi SAS | 6 Feb 2019 | 23 Mar 2023 | 6 Feb 2023 |
| 13 | independant.cloud | OVH sas | 11 Feb 2016 | 6 Feb 2025 | 11 Feb 2026 |
| 14 | independant.network | GoDaddy.com, LLC | 13 Aug 2016 | 29 Sep 2017 | 13 Aug 2017 |
| 15 | independant.com | GoDaddy.com, LLC | 13 Jan 1999 | 19 Jan 2024 | 13 Jan 2027 |
| 16 | independant.media | Gandi SAS | 26 Sep 2016 | 31 Aug 2024 | 26 Sep 2025 |
| 17 | independant.net | Epik Inc. | 17 Aug 2013 | 29 Mar 2023 | 17 Aug 2025 |
| 18 | independant.org | OVH sas | 6 Nov 1998 | 20 Dec 2024 | 5 Nov 2025 |
| 19 | independant.quebec | Go Montenegro Domains, LLC | 18 Nov 2014 | 2 Jan 2017 | 18 Nov 2017 |
| 20 | independant.ch | - | - | - | - |
| 21 | independant.de | - | - | 15 Sep 2016 | - |
| 22 | independant.co.uk | - | 19 Apr 1999 | 22 Mar 2017 | 19 Apr 2018 |
| 23 | independant.be | - | 9 Jan 2001 | - | - |
| 24 | independant.fr | - | 21 Aug 2009 | 26 Dec 2024 | 26 Jan 2026 |
| 25 | independant.team | Hosting Concepts B.V. dba Openprovider | 23 Oct 2017 | 28 Oct 2024 | 23 Oct 2025 |
| 26 | independant.ltd | GoDaddy.com, LLC | 26 Jun 2024 | 26 Jun 2025 | 26 Jun 2026 |
| 27 | independant.solutions | NameCheap, Inc. | 20 Apr 2018 | 25 Apr 2018 | 20 Apr 2019 |
| 28 | independant.life | NameCheap, Inc. | 1 Apr 2018 | 6 Apr 2018 | 1 Apr 2019 |
| 29 | independant.world | NameCheap, Inc. | 1 Apr 2018 | 6 Apr 2018 | 1 Apr 2019 |
| 30 | independant.pro | Hostinger, UAB | 3 Jun 2025 | 3 Jun 2025 | 3 Jun 2027 |
| 31 | independant.co | OVH sas | 9 Dec 2024 | 22 Feb 2025 | 9 Dec 2026 |
| 32 | independant.dev | TLD Registrar Solutions Ltd. | 15 Jun 2023 | 25 Aug 2024 | 15 Jun 2024 |
| 33 | independant.group | 1&1 Internet AG | 18 Feb 2019 | 23 Feb 2019 | 18 Feb 2020 |
| 34 | independant.digital | OVH sas | 12 Oct 2019 | 17 Oct 2019 | 12 Oct 2020 |
| 35 | independant.space | Squarespace Domains LLC | 16 Jul 2024 | 29 May 2025 | 16 Jul 2025 |
| 36 | independant.chat | GoDaddy.com, LLC | 20 Jul 2024 | 20 Oct 2024 | 20 Jul 2025 |
| 37 | independant.study | NameCheap, Inc. | 7 Feb 2021 | 7 Feb 2021 | 7 Feb 2022 |
| 38 | independant.school | NameCheap, Inc. | 17 Feb 2021 | 17 Feb 2021 | 17 Feb 2022 |
| 39 | independant.biz | OVH sas | 4 Nov 2021 | 2 Dec 2023 | 4 Nov 2023 |
| 40 | independant.club | Hosting Concepts B.V. dba Openprovider | 23 Oct 2017 | 28 Oct 2024 | 23 Oct 2025 |
| 41 | independant.tv | PlanetHoster Inc. | 21 Apr 2020 | 6 Apr 2025 | 21 Apr 2026 |
| 42 | independant.insure | 1&1 Internet AG | 2 Aug 2022 | 16 Sep 2024 | 2 Aug 2025 |
| 43 | independant.legal | Key-Systems, LLC | 26 Sep 2022 | 17 Sep 2024 | 26 Sep 2025 |
| 44 | independant.uk | - | 6 Oct 2022 | 14 Nov 2024 | 6 Oct 2025 |
| 45 | independant.wales | NameCheap, Inc. | 15 Oct 2022 | 26 Nov 2024 | 15 Oct 2025 |
| 46 | independant.io | Key-Systems GmbH | 6 Jun 2018 | 27 May 2025 | 6 Jun 2026 |
| 47 | independant.app | GoDaddy.com, LLC | 29 Jan 2022 | 10 Apr 2024 | 29 Jan 2024 |
| 48 | independant.ie | - | 25 Sep 2007 | 8 Nov 2024 | 26 Sep 2025 |
| 49 | independant.nl | EuroDNS S.A. | 4 Feb 2006 | 13 Mar 2025 | - |
| 50 | independant.co.nz | - | 26 Sep 2017 | 23 Sep 2024 | - |
| 51 | independant.observer | Tucows Domains Inc. | 23 Jun 2021 | 3 Aug 2024 | 23 Jun 2024 |
| 52 | independant.one | GoDaddy.com, LLC | 11 Jun 2018 | 12 Jun 2025 | 11 Jun 2026 |
| 53 | independant.online | OVH sas | 16 Sep 2015 | 1 Nov 2024 | 16 Sep 2025 |
| 54 | independant.watches | Porkbun, LLC | 5 Jul 2023 | 19 Aug 2024 | 5 Jul 2025 |
| 55 | independant.it | - | 23 Oct 2017 | 5 Feb 2025 | 20 Jan 2026 |
| 56 | independant.art | NameCheap, Inc. | 28 Mar 2024 | 9 May 2025 | 28 Mar 2025 |
| 57 | independant.store | Tucows Domains Inc. | 21 Sep 2024 | 10 Oct 2024 | 21 Sep 2025 |
| 58 | independant.watch | NameCheap, Inc. | 13 Jan 2025 | 18 Jan 2025 | 13 Jan 2026 |
| 59 | independant.com.au | - | - | 28 Oct 2024 | - |
| 60 | independants-tns.fr | - | 12 Jan 2024 | 20 Jan 2024 | 12 Jan 2026 |
| 61 | independantlivingassociation.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 62 | independantthinking.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 63 | independantastonmartinspecialist.com | Mesh Digital Limited | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 64 | independantfiduciary.com | GoDaddy.com, LLC | 22 May 2010 | 23 May 2015 | 22 May 2016 |
| 65 | independant-cosmetique-world.com | Tucows Domains Inc. | 29 Oct 2014 | 2 Nov 2015 | 29 Oct 2016 |
| 66 | independantexpert.com | GoDaddy.com, LLC | 5 Feb 2015 | 16 Apr 2015 | 5 Feb 2016 |
| 67 | independantexperts.com | GoDaddy.com, LLC | 5 Feb 2015 | 16 Apr 2015 | 5 Feb 2016 |
| 68 | independantiste.com | eNom, Inc. | 6 Jul 2012 | 18 Jul 2017 | 6 Jul 2018 |
| 69 | independantoffers.co.uk | - | - | - | - |
| 70 | independantexecutivefranchise.com | 1&1 Internet AG | 18 Aug 2014 | 19 Aug 2016 | 18 Aug 2017 |
| 71 | independantexecutivesfranchise.com | 1&1 Internet AG | 18 Aug 2014 | 19 Aug 2016 | 18 Aug 2017 |
| 72 | independanttubeandfittings.com | Webfusion Ltd. | 5 Nov 2014 | 1 Oct 2016 | 5 Nov 2018 |
| 73 | independantrelaxationservice.com | register.com, Inc. | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 74 | independantcosmetiqueworld.com | OVH sas | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 75 | independantbrokerresourcenetwork.com | GoDaddy.com, LLC | 8 Nov 2014 | 9 Nov 2016 | 8 Nov 2018 |
| 76 | independantmodeworld.com | Tucows Domains Inc. | 9 Nov 2014 | 13 Nov 2015 | 9 Nov 2016 |
| 77 | independantcars.com | NameCheap, Inc. | 14 Aug 2014 | 15 Jul 2024 | 14 Aug 2025 |
| 78 | independantfashion.com | Tucows Domains Inc. | 11 Aug 2013 | 14 Aug 2014 | 11 Aug 2015 |
| 79 | independantcare.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2016 |
| 80 | independantrestaurantcolumbusga.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 81 | independanttechniciansltd.com | Tucows Domains Inc. | 9 Sep 2010 | 12 Sep 2014 | 9 Sep 2015 |
| 82 | independantwines.com | NetRegistry Pty Ltd. | 31 Aug 2014 | 31 Jul 2016 | 31 Aug 2017 |
| 83 | independantlivingforseniors.com | GoDaddy.com, LLC | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2016 |
| 84 | independantcomplaints.com | enom375, Incorporated | 3 Dec 2018 | 4 Dec 2018 | 3 Dec 2019 |
| 85 | independanttribune.com | Fabulous.com Pty Ltd. | 5 Nov 2002 | 31 Oct 2017 | 5 Nov 2018 |
| 86 | independantsurveys.com | Webfusion Ltd. | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 87 | independant-produitdiscount.com | Tucows Domains Inc. | 17 Sep 2014 | 21 Sep 2015 | 17 Sep 2016 |
| 88 | independantstaffing.com | GoDaddy.com, LLC | 4 Sep 2014 | 22 Jun 2016 | 4 Sep 2017 |
| 89 | independantstaffingservice.com | GoDaddy.com, LLC | 4 Sep 2014 | 20 Jul 2018 | 4 Sep 2019 |
| 90 | independantstaffingservices.com | GoDaddy.com, LLC | 4 Sep 2014 | 20 Jul 2018 | 4 Sep 2019 |
| 91 | independantscotland.com | Webfusion Ltd. | 19 Nov 2021 | 19 Nov 2021 | 19 Nov 2022 |
| 92 | independantmidwifelondon.com | Tucows Domains Inc. | 20 Sep 2013 | 24 Sep 2014 | 20 Sep 2015 |
| 93 | independant-cosmetiqueworld.com | Tucows Domains Inc. | 23 Sep 2014 | 27 Sep 2015 | 23 Sep 2016 |
| 94 | independantdealersolutions.com | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2016 |
| 95 | independantcateringequipment.com | Tucows Domains Inc. | 15 Oct 2014 | 19 Oct 2018 | 15 Oct 2018 |
| 96 | independantsenior.us | eNom, Inc. | 4 Dec 2014 | 4 Dec 2014 | 3 Dec 2015 |
| 97 | independantrepairandtires.com | - | - | - | - |
| 98 | independantlivingsolutions.com | GoDaddy.com, LLC | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2015 |
| 99 | independantliving.xyz | GoDaddy.com, LLC | 13 May 2022 | 13 May 2022 | 13 May 2023 |
| 100 | independants.immo | OVH sas | 10 Dec 2014 | 6 Dec 2024 | 10 Dec 2025 |
| 101 | independant-en-immobilier.immo | Corehub, S.R.L. | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 102 | independantmortgage.guru | GoDaddy.com, LLC | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 103 | independants.wales | Tucows Domains Inc. | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2017 |
| 104 | independantliving.rocks | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 105 | independantmilitarysurplus.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2025 | 16 Jan 2026 |
| 106 | independantelectroniccigaretteguide.com | Webfusion Ltd. | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 107 | independantwork.com | OVH sas | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2016 |
| 108 | independantlivingproject.com | GoDaddy.com, LLC | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2016 |
| 109 | independantlivingfacilitynewsmyrna.com | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 110 | independantshoes.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2017 |
| 111 | independantbackupmonitoring.com | Tucows Domains Inc. | 30 Jan 2014 | 3 Feb 2015 | 30 Jan 2016 |
| 112 | independantartistawards.com | Network Solutions, LLC | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2017 |
| 113 | independantpokerleague.com | GoDaddy.com, LLC | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 114 | independantdampinspections.com | Webfusion Ltd. | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2017 |
| 115 | independantsfortrump.org | GoDaddy.com, LLC | 21 Aug 2015 | 22 Aug 2016 | 21 Aug 2017 |
| 116 | independantsfortrump.com | GoDaddy.com, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 117 | independantfuneralservice.com | Tucows Domains Inc. | 18 Aug 2010 | 22 Aug 2015 | 18 Aug 2016 |
| 118 | independantbenefits.com | GoDaddy.com, LLC | 21 Feb 2015 | 21 Feb 2015 | 21 Feb 2016 |
| 119 | independantstrykersunion.com | GoDaddy.com, LLC | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 120 | independantcme.com | register.com, Inc. | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 121 | independantjournalist57.com | - | - | - | - |
| 122 | independantsf.com | Fabulous.com Pty Ltd. | 24 Feb 2005 | 24 Feb 2005 | 24 Feb 2017 |
| 123 | independantboutiquealliance.com | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2017 |
| 124 | independantenergy.com | TurnCommerce, Inc. DBA NameBright.com | 6 Mar 2015 | 28 Feb 2021 | 6 Mar 2026 |
| 125 | independant76.com | - | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2017 |
| 126 | independantsforwalker.com | - | - | - | - |
| 127 | independantsforhillary.com | - | - | - | - |
| 128 | independantcelebstalk.com | TLD Registrar Solutions Ltd. | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 129 | independant-batiment-construction.com | OVH sas | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 130 | independanttradersnetwork.com | GoDaddy.com, LLC | 20 Mar 2015 | 21 Mar 2025 | 20 Mar 2030 |
| 131 | independantdealer.com | eNom, Inc. | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 132 | independantdirector.com | Net 4 India Limited | 1 Apr 2015 | 1 Apr 2015 | 1 Apr 2016 |
| 133 | independants-enligne.com | Gandi SAS | 4 Apr 2000 | 3 Apr 2017 | 4 Apr 2018 |
| 134 | independanthairdresserassociation.com | GoDaddy.com, LLC | 7 Apr 2015 | 8 Apr 2025 | 7 Apr 2027 |
| 135 | independanteducationgroup.net | GoDaddy.com, LLC | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2016 |
| 136 | independanteducationgroup.info | GoDaddy.com, LLC | 29 Aug 2015 | - | 29 Aug 2016 |
| 137 | independanteducationgroup.com | GoDaddy.com, LLC | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2017 |
| 138 | independanthomecare.com | Wix.com Ltd. | 6 Aug 2023 | 16 Sep 2024 | 6 Aug 2024 |
| 139 | independantadvisors.com | Tucows Domains Inc. | 25 Apr 2013 | 29 Apr 2015 | 25 Apr 2016 |
| 140 | independantoildealer.com | register.com, Inc. | 6 May 2015 | 6 May 2015 | 6 May 2016 |
| 141 | independantvaporcompany.com | GoDaddy.com, LLC | 12 Jul 2018 | 12 Jul 2018 | 12 Jul 2019 |
| 142 | independantelectricalcontractors.com | Mesh Digital Limited | 13 May 2015 | 13 May 2015 | 13 May 2020 |
| 143 | independantbiz.com | DomainAdministration.com, LLC | 24 Jul 2016 | 20 Jan 2025 | 24 Jul 2025 |
| 144 | independantmusic.com | GoDaddy.com, LLC | 2 May 2016 | 30 Dec 2024 | 2 May 2026 |
| 145 | independant-a-domicile.com | Key-Systems GmbH | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 146 | independant-services.com | Infomaniak Network SA | 14 Sep 2015 | 31 Aug 2024 | 14 Sep 2025 |
| 147 | independant-complementaire.com | OVH sas | 14 Sep 2015 | 15 Sep 2024 | 14 Sep 2025 |
| 148 | independantiron.com | GoDaddy.com, LLC | 29 May 2015 | 12 Jun 2025 | 29 May 2026 |
| 149 | independantescorts.com | GoDaddy.com, LLC | 30 May 2015 | 27 Apr 2025 | 30 May 2026 |
| 150 | independantiron.net | GoDaddy.com, LLC | 29 May 2015 | 12 Jun 2025 | 29 May 2026 |
| 151 | independantreview.com | NameKing.com Inc. | 18 Oct 2024 | 18 Oct 2024 | 18 Oct 2025 |
| 152 | independantoptions.com | - | - | - | - |
| 153 | independantartistmovement.com | GoDaddy.com, LLC | 10 Jun 2015 | 10 Jun 2015 | 10 Jun 2016 |
| 154 | independantretailer.com | GoDaddy.com, LLC | 23 Nov 2020 | 23 Nov 2020 | 23 Nov 2021 |
| 155 | independantsprayers.com | GoDaddy.com, LLC | 20 Sep 2015 | 20 Sep 2015 | 20 Sep 2016 |
| 156 | independanthotelier.info | OVH sas | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 157 | independanthotel.info | OVH sas | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 158 | independantarchitect.com | Domain.com, LLC | 8 Jul 2015 | 8 Jul 2015 | 8 Jul 2020 |
| 159 | independanttaxioftahoe.com | Tucows Domains Inc. | 15 Jul 2010 | 19 Jul 2015 | 15 Jul 2016 |
| 160 | independantfoodreviews.net | Tucows Domains Inc. | 16 Jul 2014 | 20 Jul 2015 | 16 Jul 2016 |
| 161 | independantlivingsupport.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 162 | independantfinancialadviser.com | DropCatch.com 431 LLC | 26 Jul 2015 | 27 Jul 2016 | 26 Jul 2017 |
| 163 | independantdrivers.com | Tucows Domains Inc. | 27 Sep 2005 | 1 Oct 2015 | 27 Sep 2016 |
| 164 | independantinsuranceagentsapp.com | GoDaddy.com, LLC | 1 Aug 2015 | 2 Aug 2024 | 1 Aug 2025 |
| 165 | independantinsuranceagentapp.com | GoDaddy.com, LLC | 1 Aug 2015 | 2 Aug 2024 | 1 Aug 2025 |
| 166 | independantinsuranceagencyapp.com | GoDaddy.com, LLC | 1 Aug 2015 | 2 Aug 2024 | 1 Aug 2025 |
| 167 | independantplastic.com | GoDaddy.com, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 168 | independantexaminer.com | GoDaddy.com, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 169 | independantbeauty.com | Wild West Domains, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 170 | independantlivingnashville.com | Tucows Domains Inc. | 4 Aug 2011 | 8 Aug 2015 | 4 Aug 2016 |
| 171 | independant-collector.com | GMO Internet Inc. | 9 Aug 2015 | 9 Aug 2015 | 9 Aug 2016 |
| 172 | independantgirondin.com | Online SAS | 30 Jul 2013 | 9 Aug 2023 | 30 Jul 2025 |
| 173 | independantcollector.net | GMO Internet Inc. | 10 Aug 2015 | 10 Aug 2015 | 10 Aug 2016 |
| 174 | independant-collector.net | GMO Internet Inc. | 10 Aug 2015 | 10 Aug 2015 | 10 Aug 2016 |
| 175 | independantsalescontractor.com | Google, Inc. | 5 Oct 2015 | 5 Oct 2015 | 5 Oct 2016 |
| 176 | independantsocialreviewconsultants.com | GoDaddy.com, LLC | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 177 | independantsentinal.com | GoDaddy.com, LLC | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 178 | independantonline.com | Name.com, Inc. | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 179 | independantprescriber.com | GoDaddy.com, LLC | 25 Oct 2015 | 25 Oct 2015 | 25 Oct 2016 |
| 180 | independantpharmacistprescriber.com | GoDaddy.com, LLC | 25 Oct 2015 | 25 Oct 2015 | 25 Oct 2016 |
| 181 | independant-hotels.com | OVH sas | 15 Jul 2024 | 15 Jul 2024 | 15 Jul 2025 |
| 182 | independant-review.com | Launchpad, Inc. | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 183 | independantfly.com | EvoPlus Ltd. | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 184 | independantfreedom.com | GoDaddy.com, LLC | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 185 | independantappraisals.com | register.com, Inc. | 16 Nov 2015 | 29 Mar 2020 | 16 Nov 2027 |
| 186 | independantfresh.com | DROPCATCH.COM 845 LLC | 28 Apr 2018 | 28 Apr 2018 | 28 Apr 2019 |
| 187 | independantwoman.org | GoDaddy.com, LLC | 21 Nov 2015 | 21 Nov 2015 | 21 Nov 2016 |
| 188 | independantintroverti.com | Gandi SAS | 22 Nov 2015 | 22 Nov 2015 | 22 Nov 2016 |
| 189 | independantartistcollective.com | eNom, Inc. | 22 Nov 2015 | 22 Nov 2015 | 22 Nov 2016 |
| 190 | independantmarinesurveyors.com | Tucows Domains Inc. | 27 Nov 2012 | 1 Dec 2015 | 27 Nov 2016 |
| 191 | independantcollectors.com | NEUDOMAIN LLC | 9 Aug 2015 | 30 Nov 2015 | 9 Aug 2016 |
| 192 | independantcollector.com | Domus Enterprises LLC | 9 Aug 2015 | 10 Aug 2017 | 9 Aug 2018 |
| 193 | independantpost.com | Crazy Domains FZ-LLC | 30 Sep 2017 | 22 Sep 2023 | 30 Sep 2025 |
| 194 | independantthirdparty.com | GoDaddy.com, LLC | 7 Dec 2015 | 7 Dec 2015 | 7 Dec 2016 |
| 195 | independantthirdparty.org | GoDaddy.com, LLC | 7 Dec 2015 | 7 Dec 2015 | 7 Dec 2016 |
| 196 | independantthirdparty.net | GoDaddy.com, LLC | 7 Dec 2015 | 7 Dec 2015 | 7 Dec 2016 |
| 197 | independantthirdparty.info | GoDaddy.com, LLC | 7 Dec 2015 | - | 7 Dec 2016 |
| 198 | independantsetsalaries.com | OVH sas | 10 Dec 2015 | 8 Sep 2016 | 10 Dec 2017 |
| 199 | independantetsalarie.com | OVH sas | 11 Dec 2015 | 8 Sep 2016 | 11 Dec 2017 |
| 200 | independantlifestyle.com | GoDaddy.com, LLC | 15 Jun 2018 | 15 Jun 2018 | 15 Jun 2019 |
| 201 | independantcontractorsid.com | Tucows Domains Inc. | 16 Dec 2010 | 20 Dec 2015 | 16 Dec 2016 |
| 202 | independanttoneawards.com | GoDaddy.com, LLC | 24 Dec 2015 | 24 Dec 2015 | 24 Dec 2016 |
| 203 | independantbeer.org | Google, Inc. | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2017 |
| 204 | independantbeer.com | Google, Inc. | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2017 |
| 205 | independantpress.com | GoDaddy.com, LLC | 11 Jan 2016 | 11 Jan 2016 | 11 Jan 2018 |
| 206 | independantrecruitment.com | 1&1 Internet AG | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 207 | independantjewlers.com | Tucows Domains Inc. | 9 Jan 2011 | 13 Jan 2016 | 9 Jan 2017 |
| 208 | independantvoters.com | GoDaddy.com, LLC | 11 Dec 2024 | 11 Dec 2024 | 11 Dec 2025 |
| 209 | independantinvestigators.net | GoDaddy.com, LLC | 14 Jan 2016 | 14 Jan 2016 | 14 Jan 2017 |
| 210 | independantdroneoperators.com | GoDaddy.com, LLC | 16 Jan 2016 | 16 Jan 2016 | 16 Jan 2018 |
| 211 | independantschools.com | GoDaddy.com, LLC | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 212 | independantportfolioconsultants.com | Network Solutions, LLC | 4 Feb 2016 | 4 Feb 2016 | 4 Feb 2017 |
| 213 | independant-administrator.com | - | - | - | - |
| 214 | independantwriters.com | Tucows Domains Inc. | 10 Mar 2018 | 10 Mar 2018 | 10 Mar 2019 |
| 215 | independantbar.net | Fabulous.com Pty Ltd. | 31 Jan 2006 | 17 Feb 2016 | 31 Jan 2017 |
| 216 | independantvoyages.com | Tucows Domains Inc. | 29 Feb 2016 | 29 Feb 2016 | 28 Feb 2017 |
| 217 | independantprogressiverevolution.com | Wild West Domains, LLC | 27 Feb 2016 | 27 Feb 2016 | 27 Feb 2017 |
| 218 | independantfundraising.com | Tucows Domains Inc. | 1 Mar 2016 | 5 Mar 2017 | 1 Mar 2017 |
| 219 | independantireland.com | GoDaddy.com, LLC | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2018 |
| 220 | independantstudios.com | GoDaddy.com, LLC | 6 Feb 2018 | 7 Feb 2025 | 6 Feb 2026 |
| 221 | independants.info | Porkbun, LLC | 5 Nov 2022 | 19 Dec 2024 | 5 Nov 2024 |
| 222 | independantaging.com | DomainsAtCost Corporation | 14 Mar 2016 | 13 Jul 2017 | 14 Mar 2018 |
| 223 | independantjournalreview.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 224 | independantbartampa.com | Tucows Domains Inc. | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 225 | independantbreakthrough.com | eNom, Inc. | 1 Apr 2016 | 28 Feb 2017 | 1 Apr 2018 |
| 226 | independantfinancialreview.com | GoDaddy.com, LLC | 14 Apr 2016 | 14 Apr 2016 | 14 Apr 2017 |
| 227 | independantinformatique.com | 1&1 Internet AG | 20 Apr 2016 | 20 Apr 2016 | 20 Apr 2018 |
| 228 | independantsalmonfishingforum.com | Register.it SPA | 22 Apr 2016 | 22 Apr 2017 | 22 Apr 2018 |
| 229 | independantescorts.net | - | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 230 | independants33.com | OVH sas | 25 Apr 2016 | 26 Apr 2024 | 25 Apr 2025 |
| 231 | independantfinancierement.com | Automattic Inc. | 26 Nov 2023 | 26 Nov 2023 | 26 Nov 2024 |
| 232 | independantbernie.com | Tucows Domains Inc. | 1 May 2016 | 5 May 2018 | 1 May 2018 |
| 233 | independantconservativeparty.org | GoDaddy.com, LLC | 4 May 2016 | 19 May 2025 | 4 May 2026 |
| 234 | independantconservativeparty.com | GoDaddy.com, LLC | 4 May 2016 | 19 May 2025 | 4 May 2026 |
| 235 | independantconservative.com | GoDaddy.com, LLC | 4 May 2016 | 1 May 2023 | 4 May 2026 |
| 236 | independantpropertygroup.com | GoDaddy.com, LLC | 21 May 2016 | 22 May 2025 | 21 May 2026 |
| 237 | independantpropertynetwork.com | GoDaddy.com, LLC | 21 May 2016 | 22 May 2025 | 21 May 2026 |
| 238 | independantgamereviews.com | eNom, Inc. | 20 May 2016 | 20 May 2016 | 20 May 2017 |
| 239 | independantlifestyle.org | GoDaddy.com, LLC | 4 Jun 2016 | 4 Jun 2016 | 4 Jun 2017 |
| 240 | independantlifestyle.info | GoDaddy.com, LLC | 4 Jun 2016 | 4 Jun 2016 | 4 Jun 2017 |
| 241 | independantsensemble.org | Gandi SAS | 8 Jun 2016 | 21 Aug 2017 | 8 Jun 2021 |
| 242 | independanttravel.com | Synergy Wholesale Pty Ltd | 8 Jun 2016 | 8 Jun 2016 | 8 Jun 2018 |
| 243 | independants-associes22.com | - | 11 Jun 2016 | 11 Jun 2016 | 11 Jun 2017 |
| 244 | independantprintsupply.com | Wild West Domains, LLC | 20 Jul 2011 | 21 Jul 2024 | 20 Jul 2025 |
| 245 | independantuk.com | Tucows Domains Inc. | 24 Jun 2016 | 28 Jun 2017 | 24 Jun 2017 |
| 246 | independantfinancialservices.com | GoDaddy.com, LLC | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2017 |
| 247 | independantbritain.com | GoDaddy.com, LLC | 24 Jun 2016 | 24 Jun 2016 | 24 Jun 2017 |
| 248 | independanttraveljapan.com | Domain.com, LLC | 26 Jun 2016 | 28 May 2025 | 26 Jun 2026 |
| 249 | independantradersassociation.org | GoDaddy.com, LLC | 29 Jul 2009 | 18 Jun 2024 | 29 Jul 2025 |
| 250 | independant-freedom.com | - | 4 Jul 2016 | 4 Jul 2016 | 4 Jul 2018 |
| 251 | independantmartialartsinstitute.xyz | GoDaddy.com, LLC | 20 Jun 2016 | 14 Sep 2016 | 20 Jun 2017 |
| 252 | independants.cloud | OVH sas | 11 Feb 2016 | 6 Feb 2025 | 11 Feb 2026 |
| 253 | independanthotels.com | OVH sas | 15 Jul 2024 | 15 Jul 2024 | 15 Jul 2025 |
| 254 | independantschools.london | 1&1 Internet AG | 27 Aug 2014 | 14 May 2016 | 27 Aug 2016 |
| 255 | independantdentists.biz | GoDaddy.com, LLC | 29 Jul 2013 | 14 Aug 2016 | 28 Jul 2019 |
| 256 | independantdentist.biz | GoDaddy.com, LLC | 29 Jul 2013 | 14 Aug 2016 | 28 Jul 2019 |
| 257 | independantlocksmiths.biz | Melbourne IT, Ltd | 11 Nov 2009 | 21 Dec 2024 | 10 Nov 2024 |
| 258 | independant-financierement.biz | OVH sas | 29 Dec 2012 | 26 Jan 2025 | 28 Dec 2024 |
| 259 | independantsolutions.biz | CSC Corporate Domains, Inc. | 31 Jan 2012 | 31 Jan 2025 | 30 Jan 2026 |
| 260 | independantphysicians.biz | GoDaddy.com, LLC | 8 Apr 2010 | 13 Apr 2020 | 7 Apr 2022 |
| 261 | independantlocksmith.biz | Melbourne IT, Ltd | 11 Nov 2009 | 21 Dec 2024 | 10 Nov 2024 |
| 262 | independantsecurity.biz | Melbourne IT, Ltd | 11 Nov 2009 | 21 Dec 2024 | 10 Nov 2024 |
| 263 | independantbikerwear.biz | Tucows Domains Inc. | 26 Apr 2012 | 2 May 2023 | 25 Apr 2023 |
| 264 | independantsfortrumppence.org | GoDaddy.com, LLC | 22 Jul 2016 | 23 Jul 2017 | 22 Jul 2018 |
| 265 | independantechateaurenard.com | Online SAS | 23 Jul 2014 | 17 Jul 2017 | 23 Jul 2018 |
| 266 | independantdrugtesting.com | register.com, Inc. | 29 Jul 2016 | 31 Jul 2017 | 29 Jul 2018 |
| 267 | independantlyou.com | - | 2 Aug 2016 | 2 Aug 2016 | 2 Aug 2021 |
| 268 | independantgiftshop.com | Tucows Domains Inc. | 3 Aug 2016 | 7 Aug 2017 | 3 Aug 2017 |
| 269 | independantlyme.com | GoDaddy.com, LLC | 3 Aug 2016 | 3 Aug 2016 | 3 Aug 2021 |
| 270 | independantboard.com | - | 26 Oct 2016 | 26 Oct 2016 | 26 Oct 2017 |
| 271 | independantoil.com | - | 17 Aug 2016 | 17 Aug 2016 | 17 Aug 2017 |
| 272 | independantmedia.com | TurnCommerce, Inc. DBA NameBright.com | 5 Nov 2020 | 26 Aug 2021 | 5 Nov 2025 |
| 273 | independantwebnews.com | - | 18 Aug 2016 | 18 Aug 2016 | 18 Aug 2017 |
| 274 | independantbusinessloans.com | - | 19 Aug 2016 | 19 Aug 2016 | 19 Aug 2021 |
| 275 | independantjournal.com | - | 19 Aug 2016 | 19 Aug 2016 | 19 Aug 2017 |
| 276 | independantvoice.org | Tucows Domains Inc. | 10 Aug 2017 | 10 Aug 2017 | 10 Aug 2018 |
| 277 | independantpolls.com | Tucows Domains Inc. | 22 Aug 2016 | 26 Aug 2018 | 22 Aug 2018 |
| 278 | independantmlo.com | - | 22 Aug 2016 | 22 Aug 2016 | 22 Aug 2017 |
| 279 | independantdistributionservices.com | - | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2017 |
| 280 | independantmusicday.com | - | 26 Aug 2016 | 26 Aug 2016 | 26 Aug 2018 |
| 281 | independantdentalhygienecare.com | - | 26 Aug 2016 | 26 Aug 2016 | 26 Aug 2017 |
| 282 | independantmusicday.net | - | 26 Aug 2016 | 26 Aug 2016 | 26 Aug 2018 |
| 283 | independantmusicday.org | GoDaddy.com, LLC | 26 Aug 2016 | 26 Oct 2016 | 26 Aug 2018 |
| 284 | independantwomanworldwide.com | eNom, Inc. | 24 Aug 2016 | 6 Oct 2017 | 24 Aug 2017 |
| 285 | independantmarketing.info | NameCheap, Inc. | 27 Aug 2016 | 28 Aug 2017 | 27 Aug 2018 |
| 286 | independantaircharter.com | Webfusion Ltd. | 21 Dec 2010 | 19 Mar 2015 | 21 Dec 2016 |
| 287 | independantdriver.com | Tucows Domains Inc. | 10 Oct 2011 | 10 Sep 2023 | 10 Oct 2025 |
| 288 | independanthiphop.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jul 2017 | 8 Jul 2017 | 8 Jul 2018 |
| 289 | independantgirls.com | Tucows Domains Inc. | 25 Mar 2024 | 25 Mar 2024 | 25 Mar 2025 |
| 290 | independantphysicians.com | GoDaddy.com, LLC | 8 Apr 2010 | 19 May 2025 | 8 Apr 2025 |
| 291 | independantliving.com | GoDaddy.com, LLC | 12 Dec 2001 | 22 Nov 2024 | 12 Dec 2025 |
| 292 | independantrecords.com | GoDaddy.com, LLC | 10 Oct 2004 | 11 Oct 2015 | 10 Oct 2016 |
| 293 | independanthome.com | GoDaddy.com, LLC | 29 Sep 2013 | 31 Jul 2024 | 29 Sep 2025 |
| 294 | independant-en-immobilier.com | Gandi SAS | 21 Sep 2012 | 21 Aug 2024 | 21 Sep 2025 |
| 295 | independantexecutive.com | 1&1 Internet AG | 26 Feb 2014 | 27 Feb 2017 | 26 Feb 2018 |
| 296 | independant-dotnet.com | 1&1 Internet AG | 29 Oct 2008 | 28 Oct 2010 | 29 Oct 2016 |
| 297 | independantfilm.com | TurnCommerce, Inc. DBA NameBright.com | 20 Oct 2011 | 29 Nov 2024 | 20 Oct 2024 |
| 298 | independantforeclosuresreviews.com | Network Solutions, LLC | 17 Nov 2011 | 18 Sep 2023 | 17 Nov 2025 |
| 299 | independantfinancialadvisor-uk.com | Internetters Limited | 2 Sep 2004 | 15 Sep 2015 | 2 Sep 2016 |
| 300 | independantinvestmentsolutions.com | 1&1 Internet AG | 14 Jul 2005 | 12 Mar 2018 | 14 Jul 2025 |
| 301 | independantforeclosuresreview.com | Network Solutions, LLC | 16 Nov 2011 | 19 Sep 2023 | 16 Nov 2025 |
| 302 | independant-bank.com | GoDaddy.com, LLC | 13 May 2024 | 18 May 2025 | 13 May 2026 |
| 303 | independantforeclosureview.com | Network Solutions, LLC | 17 Nov 2011 | 18 Sep 2023 | 17 Nov 2025 |
| 304 | independant-java.com | 1&1 Internet AG | 29 Oct 2008 | 28 Oct 2010 | 29 Oct 2016 |
| 305 | independantlabels.com | DomainExtreme LLC | 15 Dec 2013 | 16 Dec 2016 | 15 Dec 2017 |
| 306 | independant-immobilier.com | Gandi SAS | 8 Jan 2009 | 13 Jan 2020 | 8 Jan 2021 |
| 307 | independantcontractoronline.com | GoDaddy.com, LLC | 13 Sep 2001 | 1 Aug 2016 | 13 Sep 2017 |
| 308 | independantdamsafetyriskmonitors.com | Name.com, Inc. | 7 Oct 2008 | 16 Sep 2015 | 7 Oct 2016 |
| 309 | independanttrader.com | Mesh Digital Limited | 20 Dec 2010 | 17 Dec 2014 | 20 Dec 2016 |
| 310 | independant-way.com | 1&1 Internet AG | 31 Mar 2009 | 13 Jun 2025 | 31 Mar 2025 |
| 311 | independantstorage.com | Paknic (Private) Limited | 6 Jun 2022 | 16 May 2024 | 6 Jun 2025 |
| 312 | independantfuneraldirectors.com | GoDaddy.com, LLC | 28 Jan 2013 | 29 Jan 2015 | 28 Jan 2017 |
| 313 | independantexpress.com | NameCheap, Inc. | 20 May 2023 | 19 May 2025 | 20 May 2026 |
| 314 | independant-job.com | OVH sas | 8 Mar 2017 | 8 Mar 2017 | 8 Mar 2018 |
| 315 | independantmobility.com | GoDaddy.com, LLC | 17 Oct 2007 | 18 Oct 2024 | 17 Oct 2026 |
| 316 | independantmortgageconsultants.com | Uniregistrar Corp | - | - | - |
| 317 | independanttours.com | CSC Corporate Domains, Inc. | 16 Nov 1998 | 11 Nov 2024 | 15 Nov 2025 |
| 318 | independantwatches.com | GoDaddy.com, LLC | 29 Jul 2013 | 30 Jul 2024 | 29 Jul 2025 |
| 319 | independantdomesticenergyassessments.com | Webfusion Ltd. | 18 Jun 2007 | 16 Jun 2016 | 18 Jun 2018 |
| 320 | independantadult.com | Wild West Domains, LLC | 23 Mar 2006 | 24 Mar 2016 | 23 Mar 2017 |
| 321 | independantsolutions.com | Key-Systems GmbH | 8 Jul 2012 | 13 Aug 2024 | 8 Jul 2025 |
| 322 | independantfinancialadvisor.com | TurnCommerce, Inc. DBA NameBright.com | 27 Dec 2010 | 21 Dec 2020 | 27 Dec 2025 |
| 323 | independantmountain.com | Tucows Domains Inc. | 3 Jul 2007 | 7 Jul 2017 | 3 Jul 2017 |
| 324 | independant-domicile.com | OVH sas | 23 Mar 2012 | 24 Mar 2016 | 23 Mar 2017 |
| 325 | independantwebcamgirls.com | GoDaddy.com, LLC | 1 May 2009 | 25 Apr 2016 | 1 May 2017 |
| 326 | independant-words.com | DNC Holdings, Inc. | 12 Sep 2011 | 29 Jul 2017 | 12 Sep 2018 |
| 327 | independantgardenlandscapes.com | Network Solutions, LLC | 5 Dec 2013 | 30 Dec 2015 | 5 Dec 2016 |
| 328 | independantbattery.com | Crazy Domains FZ-LLC | 3 May 2014 | 14 Jun 2024 | 3 May 2024 |
| 329 | independantedge.com | Network Solutions, LLC | 19 Jan 2012 | 5 Mar 2017 | 19 Jan 2018 |
| 330 | independantinsurancebrokerage.com | GoDaddy.com, LLC | 13 Oct 2011 | 14 Oct 2015 | 13 Oct 2016 |
| 331 | independants-associes.com | 1&1 Internet AG | 15 Jun 2011 | 2 Oct 2018 | 15 Jun 2026 |
| 332 | independanttalentgroup.com | Webfusion Ltd. | 15 Jun 2007 | 11 May 2023 | 15 Jun 2026 |
| 333 | independantbackpackers.com | CSC Corporate Domains, Inc. | 6 Nov 2012 | 2 Nov 2024 | 6 Nov 2025 |
| 334 | independantbuyer.com | Key-Systems GmbH | 5 Nov 2022 | 18 Jan 2024 | 5 Nov 2023 |
| 335 | independantriders.com | GoDaddy.com, LLC | 14 Mar 2007 | 15 Mar 2016 | 14 Mar 2017 |
| 336 | independantretiree.com | GoDaddy.com, LLC | 24 Dec 2007 | 25 Dec 2015 | 24 Dec 2016 |
| 337 | independantdomesticenergyassessment.com | Webfusion Ltd. | 18 Jun 2007 | 16 Jun 2016 | 18 Jun 2018 |
| 338 | independantfinancialadvisers.com | eNom, Inc. | 13 Aug 2002 | 20 Apr 2016 | 13 Aug 2017 |
| 339 | independantnurse.com | Webfusion Ltd. | 15 Feb 2012 | 8 Feb 2016 | 15 Feb 2018 |
| 340 | independanthandling.com | eNom, Inc. | 23 Aug 2010 | 20 Aug 2024 | 23 Aug 2025 |
| 341 | independanthealth.com | Moniker Online Services LLC | 26 Nov 2005 | 27 Dec 2024 | 26 Nov 2025 |
| 342 | independanthealthcareprovider.com | GoDaddy.com, LLC | 11 Oct 2011 | 20 May 2016 | 11 Oct 2018 |
| 343 | independantforgings.com | Hosting Concepts B.V. dba Openprovider | 27 Mar 2023 | 27 Mar 2025 | 27 Mar 2026 |
| 344 | independantsworld.com | OVH sas | 21 Mar 2014 | 21 Mar 2017 | 21 Mar 2018 |
| 345 | independantphysicianreferral.com | GoDaddy.com, LLC | 21 Apr 2010 | 22 Apr 2016 | 21 Apr 2017 |
| 346 | independantgames.com | Fabulous.com Pty Ltd. | 1 Jan 2005 | 2 Jan 2018 | 1 Jan 2018 |
| 347 | independante.com | Fabulous.com Pty Ltd. | 18 Oct 2004 | 23 Sep 2024 | 18 Oct 2025 |
| 348 | independantsa.com | Namebay SAM | 23 Dec 2010 | 24 Sep 2017 | 23 Dec 2017 |
| 349 | independantcommercialservices.com | GoDaddy.com, LLC | 11 Jul 2007 | 12 Jul 2015 | 11 Jul 2017 |
| 350 | independantvaluationservices.com | Tucows Domains Inc. | 16 Feb 2010 | 18 Jan 2025 | 16 Feb 2026 |
| 351 | independantfinancialadvice.com | GoDaddy.com, LLC | 8 Oct 2007 | 18 Sep 2024 | 8 Oct 2025 |
| 352 | independantworldmoviedatabaseonline.com | Wild West Domains, LLC | 2 Feb 2003 | 3 Feb 2025 | 2 Feb 2026 |
| 353 | independantdistributiongroup.com | Crazy Domains FZ-LLC | 12 Aug 2014 | 12 Aug 2016 | 12 Aug 2018 |
| 354 | independantdentists.com | GoDaddy.com, LLC | 29 Jul 2013 | 28 Feb 2025 | 29 Jul 2025 |
| 355 | independantproductions.com | Network Solutions, LLC | 3 Feb 2011 | 5 Mar 2017 | 3 Feb 2017 |
| 356 | independant24.com | Webfusion Ltd. | 6 Oct 2011 | 29 Sep 2017 | 6 Oct 2019 |
| 357 | independantbillboards.com | GoDaddy.com, LLC | 30 Aug 2011 | 31 Aug 2016 | 30 Aug 2017 |
| 358 | independantsleep.com | GoDaddy.com, LLC | 24 Jan 2013 | 25 Jan 2016 | 24 Jan 2017 |
| 359 | independantsquare.com | Tucows Domains Inc. | 11 Nov 2009 | 15 Nov 2017 | 11 Nov 2017 |
| 360 | independantatheistmovement.com | GoDaddy.com, LLC | 6 Aug 2007 | 11 Aug 2016 | 6 Aug 2016 |
| 361 | independantrider.com | GoDaddy.com, LLC | 14 Mar 2007 | 15 Mar 2016 | 14 Mar 2017 |
| 362 | independantspecialistsurveys.com | 1&1 Internet AG | 26 Apr 2010 | 26 May 2025 | 26 Apr 2026 |
| 363 | independantaboriginalartists.com | Key-Systems GmbH | 9 Jun 2009 | 22 Aug 2024 | 9 Jun 2024 |
| 364 | independantlivingaids.com | Fabulous.com Pty Ltd. | 25 Sep 2004 | 1 Aug 2017 | 25 Sep 2018 |
| 365 | independanttradersassociation.com | GoDaddy.com, LLC | 29 Jul 2009 | 29 Jul 2023 | 29 Jul 2025 |
| 366 | independants.com | Gandi SAS | 17 Nov 1997 | 16 Oct 2024 | 16 Nov 2025 |
| 367 | independantriggers.com | eNom, Inc. | 15 Dec 2013 | 15 Dec 2013 | 15 Dec 2016 |
| 368 | independantgignetwork.com | 1&1 Internet AG | 26 Jan 2001 | 27 Jan 2017 | 26 Jan 2018 |
| 369 | independantfleetadvisors.com | Webfusion Ltd. | 27 Sep 2006 | 9 Dec 2024 | 27 Sep 2024 |
| 370 | independant-living.com | GoDaddy.com, LLC | 19 Sep 2012 | 19 Sep 2023 | 19 Sep 2025 |
| 371 | independantimmobilier.com | Gandi SAS | 8 Jan 2009 | 13 Jan 2020 | 8 Jan 2021 |
| 372 | independantpensionsolutions.com | 1&1 Internet AG | 14 Jul 2005 | 12 Mar 2018 | 14 Jul 2025 |
| 373 | independant4life.com | Easyspace LTD | 25 Aug 2012 | 24 Aug 2024 | 25 Aug 2026 |
| 374 | independantjewellers.com | GoDaddy.com, LLC | 4 Jul 2005 | 29 May 2025 | 4 Jul 2025 |
| 375 | independantphysician.com | GoDaddy.com, LLC | 8 Apr 2010 | 9 Apr 2016 | 8 Apr 2017 |
| 376 | independantmail.com | GoDaddy.com, LLC | 14 Dec 2021 | 14 Dec 2021 | 14 Dec 2022 |
| 377 | independantfilms.com | GoDaddy.com, LLC | 10 Jan 2003 | 21 Dec 2024 | 10 Jan 2026 |
| 378 | independantmedicalalert.com | Domain.com, LLC | 17 Aug 2017 | 17 Aug 2017 | 17 Aug 2022 |
| 379 | independantbroker.com | Wild West Domains, LLC | 9 Jun 2022 | 10 Jun 2025 | 9 Jun 2026 |
| 380 | independanthotelsales.com | 1&1 Internet AG | 6 Jan 2009 | 1 Mar 2016 | 6 Jan 2017 |
| 381 | independantworld.com | Wild West Domains, LLC | 2 Feb 2003 | 3 Feb 2025 | 2 Feb 2026 |
| 382 | independantpump.com | Rebel.com Corp. | 21 Jul 2004 | 27 May 2024 | 21 Jul 2025 |
| 383 | independanttrucks.com | GoDaddy.com, LLC | 12 Dec 2001 | 22 Nov 2024 | 12 Dec 2025 |
| 384 | independantforeclosurereveiw.com | Network Solutions, LLC | 16 Nov 2011 | 17 Sep 2023 | 16 Nov 2025 |
| 385 | independantcontainer.com | GoDaddy.com, LLC | 9 Dec 2013 | 31 Aug 2024 | 9 Dec 2025 |
| 386 | independanttimes.com | GoDaddy.com, LLC | 5 Jun 2008 | 6 Jun 2025 | 5 Jun 2026 |
| 387 | independantcsi.com | Register.it SPA | 4 Apr 2014 | 4 Apr 2014 | 4 Apr 2017 |
| 388 | independantinsurance.com | eNom, Inc. | 7 Apr 2001 | 26 Dec 2016 | 7 Apr 2019 |
| 389 | independantphysicianservices.com | GoDaddy.com, LLC | 21 Apr 2010 | 22 Apr 2016 | 21 Apr 2017 |
| 390 | independantpropertyconsultants.com | TierraNet Inc. d/b/a DomainDiscover | 9 Nov 2004 | 22 Oct 2024 | 8 Nov 2025 |
| 391 | independantreviews.com | TurnCommerce, Inc. DBA NameBright.com | 11 Jul 2011 | 15 Jan 2020 | 11 Jul 2025 |
| 392 | independantscooters.com | GoDaddy.com, LLC | 7 May 2014 | 8 May 2016 | 7 May 2017 |
| 393 | independanterts.com | 1&1 Internet AG | 13 Sep 2005 | 14 Sep 2016 | 13 Sep 2018 |
| 394 | independantaustralianescorts.com | eNom, Inc. | 10 Feb 2013 | 9 Jan 2014 | 10 Feb 2018 |
| 395 | independant-backpackers.com | CSC Corporate Domains, Inc. | 6 Nov 2012 | 2 Nov 2024 | 6 Nov 2025 |
| 396 | independantwelldrilling.com | NameCheap, Inc. | 5 Aug 2010 | 19 Jul 2022 | 5 Aug 2025 |
| 397 | independantconsultancy.com | Webfusion Ltd. | 10 Dec 2007 | 1 Aug 2017 | 10 Dec 2017 |
| 398 | independantappraisal.com | eNom, Inc. | 5 Mar 2008 | 23 Jun 2015 | 5 Mar 2017 |
| 399 | independantmortgage.com | Fabulous.com Pty Ltd. | 25 Sep 2004 | 1 Aug 2017 | 25 Sep 2018 |
| 400 | independant-financierement.com | OVH sas | 29 Dec 2012 | 31 Dec 2024 | 29 Dec 2024 |
| 401 | independantsyndication.com | GoDaddy.com, LLC | 25 Mar 2009 | 4 Nov 2015 | 17 Dec 2016 |
| 402 | independantburialandcremationnetwork.com | Network Solutions, LLC | 3 Dec 2008 | 4 Oct 2024 | 3 Dec 2026 |
| 403 | independantnursing.com | Fabulous.com Pty Ltd. | 25 Sep 2004 | 1 Aug 2017 | 25 Sep 2018 |
| 404 | independanttechnicalinspections.com | Webfusion Ltd. | 20 Mar 2009 | 21 Mar 2025 | 20 Mar 2027 |
| 405 | independantdaily.com | NameSector LLC | 15 Dec 2013 | 16 Dec 2016 | 15 Dec 2017 |
| 406 | independantphysicianreferralservice.com | GoDaddy.com, LLC | 21 Apr 2010 | 22 Apr 2016 | 21 Apr 2017 |
| 407 | independantat.com | GoDaddy.com, LLC | 10 May 2022 | 10 May 2022 | 10 May 2023 |
| 408 | independantsecurityguide.com | Mesh Digital Limited | 29 Nov 2010 | 24 Nov 2014 | 29 Nov 2016 |
| 409 | independantthought.com | Wild West Domains, LLC | 5 Jan 2022 | 6 Oct 2022 | 5 Jan 2027 |
| 410 | independantlivingseniors.com | 1&1 Internet AG | 22 Jan 2013 | 23 Jan 2017 | 22 Jan 2018 |
| 411 | independantcontractor.com | NameCheap, Inc. | 18 Feb 2025 | 16 May 2025 | 18 Feb 2026 |
| 412 | independantlivingnews.com | NameCheap, Inc. | 4 Feb 2022 | - | 4 Feb 2023 |
| 413 | independantbank.com | Media Elite Holdings Limited | 5 Nov 2002 | 5 Jul 2023 | 5 Nov 2027 |
| 414 | independantmonumentartisans.com | Network Solutions, LLC | 20 Dec 2010 | 12 Dec 2022 | 20 Dec 2025 |
| 415 | independantwomen.com | Tucows Domains Inc. | 15 Dec 2022 | 25 Feb 2024 | 15 Dec 2023 |
| 416 | independantflooringexperts.com | Tucows Domains Inc. | 28 Apr 2008 | 21 Mar 2025 | 28 Apr 2030 |
| 417 | independantcoach.com | 1&1 Internet AG | 22 Mar 2013 | 23 Mar 2016 | 22 Mar 2017 |
| 418 | independantstabilising.com | eNom, Inc. | 6 Sep 2008 | 18 Oct 2017 | 6 Sep 2017 |
| 419 | independantlivinginsurance.com | Tucows Domains Inc. | 9 Feb 2010 | 10 Jan 2025 | 9 Feb 2030 |
| 420 | independantradersassociation.com | GoDaddy.com, LLC | 29 Jul 2009 | 29 Jul 2023 | 29 Jul 2025 |
| 421 | independantamerica.com | GoDaddy.com, LLC | 11 Apr 2017 | 23 May 2024 | 11 Apr 2024 |
| 422 | independantwealth.com | Annulet LLC | 23 Aug 2004 | 19 Aug 2024 | 23 Aug 2025 |
| 423 | independantcordbloodservice.com | GoDaddy.com, LLC | 24 Nov 2008 | 24 Nov 2024 | 24 Nov 2025 |
| 424 | independantbikes.com | GoDaddy.com, LLC | 27 Jul 2005 | 7 Jul 2024 | 27 Jul 2025 |
| 425 | independantyetneveralone.com | CSC Corporate Domains, Inc. | 13 Aug 2010 | 9 Aug 2019 | 13 Aug 2020 |
| 426 | independantreferralservice.com | 1&1 Internet AG | 7 Oct 2006 | 8 Oct 2017 | 7 Oct 2018 |
| 427 | independantdirectors.com | eNom, Inc. | 14 Jun 2005 | 13 Jun 2025 | 14 Jun 2026 |
| 428 | independanttraveler.com | NameCheap, Inc. | 22 Apr 2025 | 22 Apr 2025 | 22 Apr 2026 |
| 429 | independantgrocer.com | GoDaddy.com, LLC | 4 Mar 2005 | 12 Feb 2025 | 4 Mar 2026 |
| 430 | independantloancompany.com | 1&1 Internet AG | 2 Mar 2009 | 3 Mar 2017 | 2 Mar 2018 |
| 431 | independanttravelexperts.com | Webfusion Ltd. | 9 Jun 2011 | 2 Jun 2017 | 9 Jun 2019 |
| 432 | independantplumber.com | GoDaddy.com, LLC | 16 Jun 2012 | 17 Jun 2016 | 16 Jun 2017 |
| 433 | independantmediafundsexpenditurecommitee.com | Tucows Domains Inc. | 2 Apr 2014 | 6 Apr 2018 | 2 Apr 2018 |
| 434 | independantbathing.com | GoDaddy.com, LLC | 12 Mar 2009 | 13 Mar 2025 | 12 Mar 2026 |
| 435 | independantpageants.com | Tucows Domains Inc. | 11 Apr 2012 | 15 Apr 2018 | 11 Apr 2018 |
| 436 | independantforeclosurereviews.com | Network Solutions, LLC | 16 Nov 2011 | 17 Sep 2023 | 16 Nov 2025 |
| 437 | independantartist.com | GoDaddy.com, LLC | 22 Dec 2008 | 23 Dec 2015 | 22 Dec 2016 |
| 438 | independantartists.com | GoDaddy.com, LLC | 13 Aug 2002 | 24 Jul 2024 | 13 Aug 2025 |
| 439 | independantbikerwear.com | Tucows Domains Inc. | 26 Apr 2012 | 7 Jul 2023 | 26 Apr 2023 |
| 440 | independantsetassocies.com | OVH sas | 9 Oct 2009 | 10 Oct 2024 | 9 Oct 2025 |
| 441 | independantforeclosurreveiw.com | Network Solutions, LLC | 16 Nov 2011 | 17 Sep 2023 | 16 Nov 2025 |
| 442 | independantplastics.com | register.com, Inc. | 14 Apr 2011 | 1 Apr 2024 | 14 Apr 2026 |
| 443 | independant-sante.com | OVH sas | 7 Jun 2012 | 8 Jun 2017 | 7 Jun 2018 |
| 444 | independantbrokerdealers.com | NameCheap, Inc. | 8 May 2013 | 20 Jul 2024 | 8 May 2024 |
| 445 | independant-library.com | 1&1 Internet AG | 26 Mar 2007 | 26 Mar 2017 | 26 Mar 2018 |
| 446 | independanttelevision.com | GoDaddy.com, LLC | 13 Oct 2009 | 10 Jan 2025 | 9 Jan 2027 |
| 447 | independantlocksmith.com | Melbourne IT, Ltd | 11 Nov 2009 | 21 Jan 2025 | 11 Nov 2024 |
| 448 | independantappointments.com | Webfusion Ltd. | 10 Apr 2007 | 3 Apr 2017 | 10 Apr 2019 |
| 449 | independantquote.com | GoDaddy.com, LLC | 15 Sep 2008 | 8 Oct 2015 | 15 Sep 2016 |
| 450 | independantdisclosurereview.com | Network Solutions, LLC | 17 Nov 2011 | 18 Sep 2023 | 17 Nov 2025 |
| 451 | independanttreeservice.com | GoDaddy.com, LLC | 14 Apr 2012 | 15 Apr 2015 | 14 Apr 2017 |
| 452 | independantappraiser.com | eNom, Inc. | 5 Mar 2008 | 23 Jun 2015 | 5 Mar 2017 |
| 453 | independantwoman.com | Tucows Domains Inc. | 14 Oct 2024 | 14 Oct 2024 | 14 Oct 2025 |
| 454 | independantdoctors.com | GoDaddy.com, LLC | 11 Oct 2011 | 23 Oct 2024 | 11 Oct 2025 |
| 455 | independantprofessionalresearch.com | Name.com, Inc. | 8 Aug 2008 | 25 Jul 2017 | 8 Aug 2018 |
| 456 | independantpartylaunch.com | GoDaddy.com, LLC | 8 Aug 2012 | 9 Aug 2016 | 8 Aug 2017 |
| 457 | independantmortgagesolutions.com | 1&1 Internet AG | 14 Jul 2005 | 12 Mar 2018 | 14 Jul 2025 |
| 458 | independantamericanart.com | FastDomain Inc. | 24 Aug 2013 | 25 Sep 2017 | 24 Aug 2017 |
| 459 | independantwater.com | Realtime Register B.V. | 27 Oct 2022 | 10 Nov 2023 | 27 Oct 2023 |
| 460 | independantsplasticiens33.com | Gandi SAS | 4 Sep 2013 | 3 Sep 2016 | 4 Sep 2016 |
| 461 | independantbrand.com | GoDaddy.com, LLC | 9 Aug 2013 | 10 Aug 2024 | 9 Aug 2025 |
| 462 | independantschoolscaterer.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 2 Oct 2008 | 10 Aug 2015 | 2 Oct 2016 |
| 463 | independantart.com | GoDaddy.com, LLC | 22 Apr 2006 | 22 Apr 2025 | 22 Apr 2026 |
| 464 | independantcloud.com | 1&1 Internet AG | 29 Jul 2011 | 28 Aug 2016 | 29 Jul 2017 |
| 465 | independantelevator.com | Domain.com, LLC | 27 Jan 1999 | 7 Jan 2025 | 27 Jan 2026 |
| 466 | independantlivingsenior.com | 1&1 Internet AG | 22 Jan 2013 | 23 Jan 2017 | 22 Jan 2018 |
| 467 | independantlivingbullion.com | Key-Systems GmbH | 14 Dec 2022 | 26 Jan 2024 | 14 Dec 2023 |
| 468 | independantconsultant.com | TurnCommerce, Inc. DBA NameBright.com | 17 Mar 2022 | 27 Apr 2025 | 17 Mar 2025 |
| 469 | independantgaming.com | eNom, Inc. | 28 May 2014 | 18 May 2017 | 28 May 2018 |
| 470 | independantgarden.com | GoDaddy.com, LLC | 20 May 2011 | 21 May 2025 | 20 May 2026 |
| 471 | independantbmwmotorcycletech.com | GoDaddy.com, LLC | 13 Feb 2008 | 17 Jan 2014 | 13 Feb 2017 |
| 472 | independantbmwmotorcycles.com | GoDaddy.com, LLC | 13 Feb 2008 | 17 Jan 2014 | 13 Feb 2017 |
| 473 | independant-booking-agency.com | OVH sas | 28 Jul 2022 | 29 Jul 2023 | 28 Jul 2024 |
| 474 | independanttrailers.com | Enetica Pty Ltd. | 16 Nov 2011 | 3 Nov 2015 | 16 Nov 2017 |
| 475 | independantpaintball.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Oct 2013 | 20 Oct 2014 | 20 Oct 2016 |
| 476 | independant-living-insurance.com | Tucows Domains Inc. | 9 Feb 2010 | 10 Jan 2025 | 9 Feb 2030 |
| 477 | independantlibrary.com | 1&1 Internet AG | 26 Mar 2007 | 26 Mar 2017 | 26 Mar 2018 |
| 478 | independantwords.com | DNC Holdings, Inc. | 12 Sep 2011 | 29 Jul 2024 | 12 Sep 2025 |
| 479 | independantbrokerdealer.com | GoDaddy.com, LLC | 27 Jul 2007 | 27 Jul 2016 | 27 Jul 2017 |
| 480 | independantcinema.com | Tucows Domains Inc. | 26 Oct 2011 | 25 Oct 2024 | 26 Oct 2025 |
| 481 | independantsongwriters.com | Wild West Domains, LLC | 14 Mar 2006 | 15 Mar 2016 | 14 Mar 2018 |
| 482 | independantlocksmiths.com | Melbourne IT, Ltd | 11 Nov 2009 | 21 Jan 2025 | 11 Nov 2024 |
| 483 | independant-freelance.com | 1&1 Internet AG | 29 Oct 2008 | 28 Oct 2010 | 29 Oct 2016 |
| 484 | independantartschool.com | GoDaddy.com, LLC | 12 Mar 2013 | 1 May 2015 | 12 Mar 2017 |
| 485 | independanttalent.com | Webfusion Ltd. | 6 Jun 2007 | 11 May 2023 | 6 Jun 2026 |
| 486 | independantdentist.com | GoDaddy.com, LLC | 29 Jul 2013 | 28 Feb 2025 | 29 Jul 2025 |
| 487 | independantstages.com | GoDaddy.com, LLC | 10 Jul 2012 | 10 Jul 2016 | 10 Jul 2018 |
| 488 | independantbmwtech.com | GoDaddy.com, LLC | 13 Feb 2008 | 17 Jan 2014 | 13 Feb 2017 |
| 489 | independantcordbloodregistry.com | GoDaddy.com, LLC | 24 Nov 2008 | 24 Nov 2024 | 24 Nov 2025 |
| 490 | independantdocs.com | GoDaddy.com, LLC | 11 Oct 2011 | 20 May 2016 | 11 Oct 2018 |
| 491 | independantadults.com | Tucows Domains Inc. | 1 Dec 2006 | 5 Dec 2018 | 1 Dec 2018 |
| 492 | independantforeclosurereview.com | Network Solutions, LLC | 25 Aug 2011 | 26 Jun 2023 | 25 Aug 2025 |
| 493 | independantsdubrc.com | Web Commerce Communications Limited dba WebNic.cc | 18 Feb 2024 | 30 Mar 2025 | 18 Feb 2025 |
| 494 | independantjobs.com | TLDs LLC dba SRSplus | 19 Apr 2012 | 12 Mar 2025 | 19 Apr 2026 |
| 495 | independantmovies.com | Fabulous.com Pty Ltd. | 28 Sep 2004 | 1 Aug 2017 | 28 Sep 2018 |
| 496 | independanthealthcareproviders.com | GoDaddy.com, LLC | 11 Oct 2011 | 20 May 2016 | 11 Oct 2018 |
| 497 | independantprintsupplies.com | Wild West Domains, LLC | 20 Jul 2011 | 21 Jul 2024 | 20 Jul 2025 |
| 498 | independantscientology.com | GoDaddy.com, LLC | 13 Jan 2011 | 25 Apr 2015 | 13 Jan 2017 |
| 499 | independantfoodserviceconsultants.com | Crazy Domains FZ-LLC | 9 Aug 2010 | 21 Jul 2016 | 9 Aug 2017 |
| 500 | independantmarketing.com | NameCheap, Inc. | 26 Nov 2019 | 29 Nov 2024 | 26 Nov 2025 |
| 501 | independantfilmproduction.com | Azdomainz LLC | 16 Oct 2011 | 1 Dec 2016 | 16 Oct 2017 |
| 502 | independantlifeinsurance.com | GoDaddy.com, LLC | 16 Mar 2014 | 17 Mar 2016 | 16 Mar 2017 |
| 503 | independantopinion.com | Namesilo, LLC | 16 Nov 2010 | 16 Nov 2024 | 16 Nov 2025 |
| 504 | independantwatch.com | GoDaddy.com, LLC | 29 Jul 2013 | 30 Jul 2023 | 29 Jul 2025 |
| 505 | independantcycle.com | Dynadot, LLC | 9 Nov 2021 | 12 Nov 2021 | 9 Nov 2022 |
| 506 | independantconsultants.com | TurnCommerce, Inc. DBA NameBright.com | 19 Oct 2009 | 2 Dec 2024 | 19 Oct 2025 |
| 507 | independantmerchandise.com | Annulet LLC | 15 Aug 2013 | 30 Sep 2017 | 15 Aug 2018 |
| 508 | independants-patrimoine.com | OVH sas | 6 Jun 2002 | 2 Jun 2017 | 6 Jun 2018 |
| 509 | independantrecord.com | Fabulous.com Pty Ltd. | 25 Sep 2004 | 1 Aug 2017 | 25 Sep 2018 |
| 510 | independantauthors.com | Tucows Domains Inc. | 3 Oct 2012 | 7 Oct 2017 | 3 Oct 2017 |
| 511 | independantnewspapers.com | GoDaddy.com, LLC | 8 Feb 2002 | 19 Jan 2025 | 8 Feb 2026 |
| 512 | independantmediation.com | Tucows Domains Inc. | 23 Jan 2013 | 27 Jan 2017 | 23 Jan 2017 |
| 513 | independantcontractors.com | GoDaddy.com, LLC | 21 Jun 2005 | 1 Jun 2025 | 21 Jun 2026 |
| 514 | independantagent.com | GoDaddy.com, LLC | 22 Nov 2002 | 2 Nov 2024 | 22 Nov 2025 |
| 515 | independantquotes.com | GoDaddy.com, LLC | 15 Sep 2008 | 8 Oct 2015 | 15 Sep 2016 |
| 516 | independantadvice.com | TurnCommerce, Inc. DBA NameBright.com | 21 Nov 2021 | 1 Feb 2025 | 21 Nov 2024 |
| 517 | independantretailcommunity.com | - | 4 Sep 2016 | 4 Sep 2016 | 4 Sep 2017 |
| 518 | independantcounsel.com | - | 3 Sep 2016 | 3 Sep 2016 | 3 Sep 2021 |
| 519 | independantartbookfair.com | - | 6 Sep 2016 | 6 Sep 2016 | 6 Sep 2017 |
| 520 | independantglass2000.com | GoDaddy.com, LLC | 7 Sep 2016 | 8 Sep 2024 | 7 Sep 2025 |
| 521 | independantcitytattoo.com | - | 8 Sep 2016 | 8 Sep 2016 | 8 Sep 2018 |
| 522 | independantgoldgroup.com | eNom, Inc. | 11 Sep 2016 | 13 Aug 2017 | 11 Sep 2018 |
| 523 | independantmusicawards.com | Crazy Domains FZ-LLC | 22 Jun 2022 | 5 Sep 2024 | 22 Jun 2024 |
| 524 | independantpartyrapeschildren.com | - | 12 Sep 2016 | 12 Sep 2016 | 12 Sep 2017 |
| 525 | independantoffshorescaffoldinginspections.com | Instra Corporation Pty Ltd. | 25 Sep 2016 | 25 Sep 2016 | 25 Sep 2018 |
| 526 | independantscaffoldinginginspections.com | Instra Corporation Pty Ltd. | 25 Sep 2016 | 25 Sep 2016 | 25 Sep 2018 |
| 527 | independantexpress.net | FastDomain Inc. | 27 Sep 2016 | 16 Oct 2024 | 27 Sep 2025 |
| 528 | independant-living-insurance.info | Tucows Domains Inc. | 9 Feb 2010 | 15 Jan 2025 | 9 Feb 2030 |
| 529 | independantdentist.info | GoDaddy.com, LLC | 29 Jul 2013 | 30 Jul 2016 | 29 Jul 2019 |
| 530 | independant-financierement.info | OVH sas | 29 Dec 2012 | 26 Jan 2025 | 29 Dec 2024 |
| 531 | independantdentists.info | GoDaddy.com, LLC | 29 Jul 2013 | 30 Jul 2016 | 29 Jul 2019 |
| 532 | independantexecutive.info | 1&1 Internet AG | 26 Feb 2014 | 25 Aug 2017 | 26 Feb 2018 |
| 533 | independanthealthcareproviders.info | GoDaddy.com, LLC | 11 Oct 2011 | 12 Oct 2018 | 11 Oct 2020 |
| 534 | independantreview.info | GoDaddy.com, LLC | 5 Feb 2007 | 18 Apr 2023 | 5 Feb 2023 |
| 535 | independantproductions.info | Network Solutions, LLC | 3 Feb 2011 | 30 Oct 2017 | 3 Feb 2018 |
| 536 | independantlivinginsurance.info | Tucows Domains Inc. | 9 Feb 2010 | 15 Jan 2025 | 9 Feb 2030 |
| 537 | independantdocs.mobi | GoDaddy.com, LLC | 11 Oct 2011 | 12 Oct 2018 | 11 Oct 2020 |
| 538 | independantdentist.mobi | GoDaddy.com, LLC | 29 Jul 2013 | 30 Jul 2016 | 29 Jul 2019 |
| 539 | independanthealthcareproviders.mobi | GoDaddy.com, LLC | 11 Oct 2011 | 12 Oct 2018 | 11 Oct 2020 |
| 540 | independanthealthcareprovider.mobi | GoDaddy.com, LLC | 11 Oct 2011 | 12 Oct 2018 | 11 Oct 2020 |
| 541 | independantdoctors.mobi | GoDaddy.com, LLC | 11 Oct 2011 | 12 Oct 2018 | 11 Oct 2020 |
| 542 | independantphysicians.mobi | GoDaddy.com, LLC | 8 Apr 2010 | 9 Apr 2020 | 8 Apr 2022 |
| 543 | independantnews.com | - | 9 Apr 2022 | 10 Apr 2023 | 9 Apr 2024 |
| 544 | independantsystems.com | - | 14 Oct 2016 | 14 Oct 2016 | 14 Oct 2021 |
| 545 | independantlivingsystems.com | GoDaddy.com, LLC | 14 Oct 2016 | 29 Sep 2022 | 14 Oct 2026 |
| 546 | independantphysicians.net | GoDaddy.com, LLC | 8 Apr 2010 | 8 Apr 2016 | 8 Apr 2017 |
| 547 | independantphysicianreferralservice.net | GoDaddy.com, LLC | 21 Apr 2010 | 22 Apr 2016 | 21 Apr 2017 |
| 548 | independantlocksmith.net | Melbourne IT, Ltd | 11 Nov 2009 | 21 Jan 2025 | 11 Nov 2024 |
| 549 | independantcommercialservices.net | GoDaddy.com, LLC | 11 Jul 2007 | 12 Jul 2015 | 11 Jul 2017 |
| 550 | independant-financierement.net | OVH sas | 29 Dec 2012 | 31 Dec 2024 | 29 Dec 2024 |
| 551 | independant-a-domicile.net | Hosteur SARL | 3 Apr 2014 | 3 Apr 2015 | 3 Apr 2017 |
| 552 | independantphysicianservices.net | GoDaddy.com, LLC | 21 Apr 2010 | 22 Apr 2016 | 21 Apr 2017 |
| 553 | independantphysicianreferral.net | GoDaddy.com, LLC | 21 Apr 2010 | 22 Apr 2016 | 21 Apr 2017 |
| 554 | independants.net | OVH sas | 6 Nov 1998 | 6 Nov 2024 | 5 Nov 2025 |
| 555 | independantdentist.net | GoDaddy.com, LLC | 29 Jul 2013 | 30 Jul 2016 | 29 Jul 2019 |
| 556 | independantreferralservice.net | 1&1 Internet AG | 7 Oct 2006 | 8 Oct 2016 | 7 Oct 2017 |
| 557 | independantphysician.net | GoDaddy.com, LLC | 8 Apr 2010 | 9 Apr 2016 | 8 Apr 2017 |
| 558 | independantlocksmiths.net | Melbourne IT, Ltd | 11 Nov 2009 | 21 Jan 2025 | 11 Nov 2024 |
| 559 | independantscientology.net | MarkMonitor Inc. | 13 Jan 2011 | 12 Dec 2024 | 13 Jan 2026 |
| 560 | independantdentists.net | GoDaddy.com, LLC | 29 Jul 2013 | 30 Jul 2016 | 29 Jul 2019 |
| 561 | independantexecutive.net | 1&1 Internet AG | 26 Feb 2014 | 29 Nov 2017 | 26 Feb 2018 |
| 562 | independantsecurity.net | Melbourne IT, Ltd | 11 Nov 2009 | 21 Jan 2025 | 11 Nov 2024 |
| 563 | independantliving.net | Wild West Domains, LLC | 7 May 2007 | 27 Apr 2025 | 7 May 2026 |
| 564 | independantriders.net | GoDaddy.com, LLC | 14 Mar 2007 | 15 Mar 2016 | 14 Mar 2017 |
| 565 | independantrider.net | GoDaddy.com, LLC | 14 Mar 2007 | 15 Mar 2016 | 14 Mar 2017 |
| 566 | independant-carolo04.net | Tucows Domains Inc. | 10 Sep 2010 | 14 Sep 2021 | 10 Sep 2021 |
| 567 | independantconsultants.net | GoDaddy.com, LLC | 13 Feb 2009 | 13 Feb 2025 | 13 Feb 2026 |
| 568 | independantdamsafetyriskmonitors.net | Name.com, Inc. | 7 Oct 2008 | 8 Oct 2016 | 7 Oct 2016 |
| 569 | independantplanet.org | EuroDNS S.A. | 14 Feb 2013 | 7 Mar 2015 | 14 Feb 2017 |
| 570 | independants-patrimoine.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 6 Jun 2002 | 7 Jun 2017 | 6 Jun 2018 |
| 571 | independantdentist.org | GoDaddy.com, LLC | 29 Jul 2013 | 30 Jul 2016 | 29 Jul 2019 |
| 572 | independant-financierement.org | OVH sas | 29 Dec 2012 | 31 Dec 2024 | 29 Dec 2025 |
| 573 | independantexecutive.org | 1&1 Internet AG | 26 Feb 2014 | 12 Oct 2017 | 26 Feb 2018 |
| 574 | independantphysicians.org | GoDaddy.com, LLC | 8 Apr 2010 | 5 Apr 2017 | 8 Apr 2018 |
| 575 | independantconsultant.org | Register.it SPA | 24 Apr 2013 | 25 Apr 2016 | 24 Apr 2017 |
| 576 | independantconseildesarts.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Oct 2013 | 2 Oct 2024 | 2 Oct 2025 |
| 577 | independantphysicianreferral.org | GoDaddy.com, LLC | 21 Apr 2010 | 5 Apr 2017 | 21 Apr 2018 |
| 578 | independantreferralservice.org | 1&1 Internet AG | 7 Oct 2006 | 19 Nov 2017 | 7 Oct 2018 |
| 579 | independantsector.org | Internet Domain Services BS Corp | 1 Feb 2006 | 2 Feb 2016 | 1 Feb 2017 |
| 580 | independantscientology.org | NetTuner Corp. dba Webmasters.com | 13 Jan 2011 | 2 Jan 2017 | 13 Jan 2018 |
| 581 | independantthought.org | register.com, Inc. | 31 Dec 2009 | 30 Jan 2017 | 31 Dec 2017 |
| 582 | independantphysicianreferralservice.org | GoDaddy.com, LLC | 21 Apr 2010 | 5 Apr 2017 | 21 Apr 2018 |
| 583 | independanthealthcareprovider.org | GoDaddy.com, LLC | 11 Oct 2011 | 20 May 2016 | 11 Oct 2018 |
| 584 | independantpartylaunch.org | GoDaddy.com, LLC | 8 Aug 2012 | 21 Sep 2016 | 8 Aug 2017 |
| 585 | independantes.org | NameCheap, Inc. | 18 Jan 2025 | 24 Jan 2025 | 18 Jan 2026 |
| 586 | independantage.org | Mesh Digital Limited | 11 Nov 2013 | 26 Dec 2024 | 11 Nov 2025 |
| 587 | independantboard.org | eNom, Inc. | 15 Jul 2013 | 31 May 2017 | 15 Jul 2018 |
| 588 | independants-ensemble.org | Gandi SAS | 26 Sep 2010 | 27 Sep 2016 | 26 Sep 2017 |
| 589 | independantbank.org | DNC Holdings, Inc. | 5 Mar 2006 | 14 Dec 2017 | 5 Mar 2019 |
| 590 | independantphysicianservices.org | GoDaddy.com, LLC | 21 Apr 2010 | 5 Apr 2017 | 21 Apr 2018 |
| 591 | independantadult.org | Wild West Domains, LLC | 23 Mar 2006 | 1 Oct 2016 | 23 Mar 2017 |
| 592 | independantdoctors.org | GoDaddy.com, LLC | 11 Oct 2011 | 23 Oct 2024 | 11 Oct 2025 |
| 593 | independants.org | OVH sas | 6 Nov 1998 | 20 Dec 2024 | 5 Nov 2025 |
| 594 | independanttradersassociation.org | GoDaddy.com, LLC | 29 Jul 2009 | 18 Jun 2024 | 29 Jul 2025 |
| 595 | independantdentists.org | GoDaddy.com, LLC | 29 Jul 2013 | 30 Jul 2016 | 29 Jul 2019 |
| 596 | independantphysician.org | GoDaddy.com, LLC | 8 Apr 2010 | 5 Apr 2017 | 8 Apr 2018 |
| 597 | independantinvestigations.com | GoDaddy.com, LLC | 27 May 2020 | 27 May 2020 | 27 May 2021 |
| 598 | independantes.quebec | Register.ca Inc. | 18 Nov 2014 | 16 Nov 2024 | 18 Nov 2025 |
| 599 | independants-patrimoine.fr | OVH sas | 25 Aug 2002 | 31 Oct 2024 | 27 Sep 2025 |
| 600 | independants.fr | OVH sas | 13 Jun 2019 | 30 Sep 2024 | 30 Aug 2025 |
| 601 | independantecomtoise.fr | OVH sas | 4 Apr 2008 | 31 May 2025 | 4 Apr 2026 |
| 602 | independantemauronnaise.fr | OVH sas | 7 Oct 2011 | 30 Nov 2024 | 7 Oct 2025 |
| 603 | independants-ensemble.fr | - | 26 Sep 2010 | 24 Oct 2016 | - |
| 604 | independante-stephanoise.fr | OVH sas | 7 Feb 2012 | 14 Dec 2022 | 7 Feb 2026 |
| 605 | independantgrocers.com | GoDaddy.com, LLC | 20 Jun 2017 | 20 Jun 2017 | 20 Jun 2018 |
| 606 | independantmarketingassociate.info | GoDaddy.com, LLC | 1 Nov 2016 | 13 Dec 2017 | 1 Nov 2018 |
| 607 | independantmarketingassociate.com | - | 1 Nov 2016 | 1 Nov 2016 | 1 Nov 2017 |
| 608 | independant-research.com | NamePal.com #8024 | 24 Jan 2019 | 25 Jan 2019 | 24 Jan 2020 |
| 609 | independantwriter.com | GoDaddy.com, LLC | 14 Nov 2016 | 14 Nov 2016 | 14 Nov 2017 |
| 610 | independantprogressiveparty.info | GoDaddy.com, LLC | 19 Nov 2016 | 19 Jan 2017 | 19 Nov 2018 |
| 611 | independantprogressiveparty.com | GoDaddy.com, LLC | 19 Nov 2016 | 19 Nov 2016 | 19 Nov 2018 |
| 612 | independantprogressiveparty.org | GoDaddy.com, LLC | 19 Nov 2016 | 19 Jan 2017 | 19 Nov 2018 |
| 613 | independantmedia.info | GoDaddy.com, LLC | 22 Nov 2016 | 23 Nov 2017 | 22 Nov 2018 |
| 614 | independant-media.info | GoDaddy.com, LLC | 22 Nov 2016 | 23 Nov 2017 | 22 Nov 2018 |
| 615 | independantmedia.net | GoDaddy.com, LLC | 22 Nov 2016 | 22 Nov 2016 | 22 Nov 2017 |
| 616 | independant-media.net | GoDaddy.com, LLC | 22 Nov 2016 | 22 Nov 2016 | 22 Nov 2017 |
| 617 | independant-media.com | GoDaddy.com, LLC | 22 Nov 2016 | 22 Nov 2016 | 22 Nov 2018 |
| 618 | independantmedia.biz | GoDaddy.com, LLC | 22 Nov 2016 | 22 Nov 2016 | 21 Nov 2017 |
| 619 | independant-media.org | GoDaddy.com, LLC | 22 Nov 2016 | 23 Nov 2017 | 22 Nov 2018 |
| 620 | independantmedia.org | GoDaddy.com, LLC | 22 Nov 2016 | 23 Nov 2017 | 22 Nov 2018 |
| 621 | independant-media.biz | GoDaddy.com, LLC | 22 Nov 2016 | 27 Nov 2017 | 21 Nov 2018 |
| 622 | independantfloralnetwork.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Nov 2016 | 23 Nov 2016 | 23 Nov 2017 |
| 623 | independant-salarie.info | Hosting Concepts B.V. dba Openprovider | 6 Dec 2016 | 20 Jan 2025 | 6 Dec 2025 |
| 624 | independant-salarie.net | Hosting Concepts B.V. dba Openprovider | 6 Dec 2016 | 6 Dec 2024 | 6 Dec 2025 |
| 625 | independant-salarie.online | Hosting Concepts B.V. dba Openprovider | 6 Dec 2016 | 28 Feb 2025 | 6 Dec 2025 |
| 626 | independant-salarie.com | Hosting Concepts B.V. dba Openprovider | 6 Dec 2016 | 6 Dec 2024 | 6 Dec 2025 |
| 627 | independant-et-salarie.com | Hosting Concepts B.V. dba Openprovider | 7 Dec 2016 | 7 Dec 2024 | 7 Dec 2025 |
| 628 | independant-et-salarie.info | Hosting Concepts B.V. dba Openprovider | 7 Dec 2016 | 21 Jan 2025 | 7 Dec 2025 |
| 629 | independant-salarie.org | Hosting Concepts B.V. dba Openprovider | 7 Dec 2016 | 21 Jan 2025 | 7 Dec 2025 |
| 630 | independant-et-salarie.net | Hosting Concepts B.V. dba Openprovider | 7 Dec 2016 | 7 Dec 2024 | 7 Dec 2025 |
| 631 | independant-et-salarie.online | Hosting Concepts B.V. dba Openprovider | 7 Dec 2016 | 28 Feb 2025 | 7 Dec 2025 |
| 632 | independant-et-salarie.org | Hosting Concepts B.V. dba Openprovider | 8 Dec 2016 | 22 Jan 2025 | 8 Dec 2025 |
| 633 | independantchemical.com | 1&1 Internet AG | 12 Dec 2016 | 12 Dec 2016 | 12 Dec 2017 |
| 634 | independant-research-agency.com | Dynadot, LLC | 14 Dec 2016 | 15 Dec 2017 | 14 Dec 2017 |
| 635 | independants-d-enfer.com | 1&1 Internet AG | 29 Dec 2016 | 29 Dec 2016 | 29 Dec 2018 |
| 636 | independantsocialworker.com | GoDaddy.com, LLC | 7 Jan 2017 | 7 Jan 2017 | 7 Jan 2019 |
| 637 | independant-news.com | Internet Domain Services BS Corp | 10 Jan 2017 | 11 Jan 2018 | 10 Jan 2018 |
| 638 | independantgirlsdelhi.com | GMO Internet Inc. | 19 Jun 2023 | 31 Aug 2024 | 19 Jun 2024 |
| 639 | independantinventoriesuk.com | Register.it SPA | 12 Jan 2017 | 12 Jan 2017 | 12 Jan 2018 |
| 640 | independantredistricting.com | GoDaddy.com, LLC | 13 Jan 2017 | 13 Jan 2017 | 13 Jan 2018 |
| 641 | independantimaging.com | GoDaddy.com, LLC | 13 Jan 2017 | 13 Jan 2017 | 13 Jan 2018 |
| 642 | independantproducts.com | GoDaddy.com, LLC | 11 Sep 2019 | 11 Sep 2019 | 11 Sep 2020 |
| 643 | independantdentalstaff.com | 1&1 Internet AG | 28 Jan 2017 | 28 Jan 2017 | 28 Jan 2019 |
| 644 | independantthinkers.com | eNom, Inc. | 2 Feb 2017 | 5 Jan 2018 | 2 Feb 2019 |
| 645 | independantthinker.com | GoDaddy.com, LLC | 9 Apr 2022 | 21 May 2024 | 9 Apr 2024 |
| 646 | independants-pro.com | Gandi SAS | 3 Feb 2017 | 19 Jan 2018 | 3 Feb 2018 |
| 647 | independant-pro.com | Infomaniak Network SA | 3 Feb 2017 | 10 Mar 2025 | 3 Feb 2025 |
| 648 | independante-messei.com | DropCatch.com 1505 LLC | 9 Apr 2020 | 9 Apr 2020 | 9 Apr 2021 |
| 649 | independantpro.com | Gandi SAS | 3 Feb 2017 | 19 Mar 2024 | 3 Feb 2024 |
| 650 | independantitsolutions.com | GoDaddy.com, LLC | 8 Feb 2017 | 8 Feb 2017 | 8 Feb 2018 |
| 651 | independantsforcommoncauses.com | GoDaddy.com, LLC | 7 Feb 2017 | 7 Feb 2017 | 7 Feb 2022 |
| 652 | independantfrontalier.com | Infomaniak Network SA | 13 Feb 2017 | 14 Feb 2025 | 13 Feb 2026 |
| 653 | independantparty.info | GoDaddy.com, LLC | 14 Feb 2017 | 15 Apr 2017 | 14 Feb 2018 |
| 654 | independantparty.net | GoDaddy.com, LLC | 14 Feb 2017 | 14 Feb 2017 | 14 Feb 2018 |
| 655 | independantgeneve.com | Infomaniak Network SA | 13 Feb 2017 | 14 Feb 2025 | 13 Feb 2026 |
| 656 | independantparty.com | TurnCommerce, Inc. DBA NameBright.com | 3 May 2018 | 4 May 2024 | 3 May 2025 |
| 657 | independantsuisse.com | Infomaniak Network SA | 13 Feb 2017 | 14 Feb 2025 | 13 Feb 2026 |
| 658 | independantimagerepubliq.com | GoDaddy.com, LLC | 14 Feb 2017 | 14 Feb 2017 | 14 Feb 2019 |
| 659 | independantmom.com | GoDaddy.com, LLC | 19 Feb 2017 | 19 Feb 2017 | 19 Feb 2019 |
| 660 | independantjournalist.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Oct 2023 | 29 Dec 2024 | 17 Oct 2024 |
| 661 | independantbanksolutions.com | GoDaddy.com, LLC | 24 Feb 2017 | 24 Feb 2017 | 24 Feb 2019 |
| 662 | independantteam.com | NameCheap, Inc. | 27 Feb 2017 | 27 Feb 2017 | 27 Feb 2018 |
| 663 | independantprogressives.com | GoDaddy.com, LLC | 27 Feb 2017 | 27 Feb 2017 | 27 Feb 2018 |
| 664 | independantprogressive.com | GoDaddy.com, LLC | 27 Feb 2017 | 27 Feb 2017 | 27 Feb 2018 |
| 665 | independant4x.com | GoDaddy.com, LLC | 2 Mar 2017 | 2 Mar 2017 | 2 Mar 2018 |
| 666 | independantannunity-guide.com | DNC Holdings, Inc. | 6 Mar 2017 | 6 Mar 2017 | 6 Mar 2018 |
| 667 | independantgaurdian.org | GoDaddy.com, LLC | 8 Mar 2017 | 8 May 2017 | 8 Mar 2018 |
| 668 | independantgaurdian.net | GoDaddy.com, LLC | 8 Mar 2017 | 8 Mar 2017 | 8 Mar 2018 |
| 669 | independantgaurdian.com | GoDaddy.com, LLC | 8 Mar 2017 | 8 Mar 2017 | 8 Mar 2018 |
| 670 | independantgaurdian.info | GoDaddy.com, LLC | 8 Mar 2017 | 7 May 2017 | 8 Mar 2018 |
| 671 | independantcatering.co.uk | - | 26 Dec 2009 | 3 Jun 2023 | 26 Dec 2024 |
| 672 | independantnaturalretailers.com | Tucows Domains Inc. | 18 Mar 2017 | 22 Mar 2020 | 18 Mar 2020 |
| 673 | independantviews.com | Automattic Inc. | 23 Mar 2017 | 23 Mar 2017 | 23 Mar 2018 |
| 674 | independantcertifie.com | 1&1 Internet AG | 25 Mar 2017 | 25 Mar 2017 | 25 Mar 2018 |
| 675 | independantdealers.com | Network Solutions, LLC | 29 Mar 2017 | 2 Dec 2017 | 28 Mar 2018 |
| 676 | independantlashes.com | GoDaddy.com, LLC | 31 Mar 2017 | 31 Mar 2017 | 31 Mar 2019 |
| 677 | independants.site | GMO Internet Inc. | 22 Nov 2023 | 3 Feb 2025 | 22 Nov 2024 |
| 678 | independant-product-discount.com | Tucows Domains Inc. | 5 Apr 2017 | 9 Apr 2019 | 5 Apr 2019 |
| 679 | independantamerican.com | GoDaddy.com, LLC | 11 Apr 2017 | 23 May 2024 | 11 Apr 2024 |
| 680 | independantwomanstruggles.com | FastDomain Inc. | 22 Apr 2017 | 22 Apr 2017 | 22 Apr 2018 |
| 681 | independantoldcatholicchurch.org | GoDaddy.com, LLC | 26 Apr 2017 | 26 Apr 2017 | 26 Apr 2018 |
| 682 | independant-trading-group.com | DNC Holdings, Inc. | 28 Apr 2017 | 28 Apr 2017 | 28 Apr 2018 |
| 683 | independantlife.com | Name.com, Inc. | 2 May 2017 | 15 Jun 2025 | 2 May 2025 |
| 684 | independantoak.com | GoDaddy.com, LLC | 7 May 2017 | 10 May 2024 | 7 May 2026 |
| 685 | independantcooperage.com | GoDaddy.com, LLC | 7 May 2017 | 10 May 2024 | 7 May 2026 |
| 686 | independantparts.com.au | - | - | 27 Aug 2024 | - |
| 687 | independantmovie.com | BigRock Solutions Ltd. | 21 May 2017 | 7 Jun 2020 | 21 May 2021 |
| 688 | independantproductions.net | Network Solutions, LLC | 25 May 2017 | 2 Feb 2018 | 25 May 2018 |
| 689 | independantreserve.com | Amazon Registrar, Inc. | 26 May 2017 | 21 Apr 2025 | 26 May 2026 |
| 690 | independant-kabyle.com | Namefinger.com LLC | 17 Aug 2018 | 18 Aug 2018 | 17 Aug 2019 |
| 691 | independant-travel-agent.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2017 | 2 Jun 2017 | 2 Jun 2018 |
| 692 | independantrichboys.com | Network Solutions, LLC | 6 Jun 2017 | 6 Jun 2017 | 6 Jun 2018 |
| 693 | independantparalegal.com | Google, Inc. | 24 Apr 2024 | 5 Jun 2025 | 24 Apr 2025 |
| 694 | independantonly.com | GoDaddy.com, LLC | 24 Jul 2023 | 25 Jul 2024 | 24 Jul 2025 |
| 695 | independanttobaco.com | GoDaddy.com, LLC | 13 Jun 2017 | 13 Jun 2017 | 13 Jun 2018 |
| 696 | independanttobacco.com | Wild West Domains, LLC | 14 Jun 2017 | 14 Jun 2017 | 14 Jun 2018 |
| 697 | independantrespiratory.com | GoDaddy.com, LLC | 17 Jun 2017 | 17 Jun 2017 | 17 Jun 2019 |
| 698 | independantconveyancinglawyers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jun 2017 | 20 Jun 2017 | 20 Jun 2018 |
| 699 | independantgroceries.com | GoDaddy.com, LLC | 20 Jun 2017 | 20 Jun 2017 | 20 Jun 2018 |
| 700 | independantbrands.com | Beijing Lanhai Jiye Technology Co., Ltd | 12 Sep 2021 | 13 Sep 2023 | 12 Sep 2024 |
| 701 | independantgiftshop.co.uk | - | 3 Aug 2016 | 22 Jul 2017 | 3 Aug 2017 |
| 702 | independantjewelrydesigns.com | 1&1 Internet AG | 5 Aug 2017 | 5 Aug 2017 | 5 Aug 2025 |
| 703 | independantdairynutrition.com | register.com, Inc. | 6 Aug 2017 | 6 Aug 2017 | 6 Aug 2018 |
| 704 | independanttaxi.com | Tucows Domains Inc. | 7 Aug 2017 | 11 Aug 2018 | 7 Aug 2018 |
| 705 | independantsalespro.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Aug 2017 | 18 Aug 2017 | 18 Aug 2018 |
| 706 | independantbmwservicing.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Aug 2017 | 22 Aug 2018 | 22 Aug 2018 |
| 707 | independantyou.com | Tucows Domains Inc. | 20 Feb 2019 | 24 Feb 2020 | 20 Feb 2020 |
| 708 | independantbackoffice.com | Advanced Internet Technologies, Inc. (AIT) | 26 Aug 2017 | 26 Aug 2017 | 26 Aug 2018 |
| 709 | independantnursepractice.org | GoDaddy.com, LLC | 10 Sep 2017 | 10 Sep 2017 | 10 Sep 2018 |
| 710 | independantlydrivingamerica.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Sep 2017 | 18 Sep 2017 | 18 Sep 2018 |
| 711 | independantbound.com | eNom, Inc. | 25 Sep 2017 | 25 Sep 2017 | 25 Sep 2018 |
| 712 | independant-france.com | OVH sas | 26 Dec 2021 | 1 Dec 2023 | 26 Dec 2024 |
| 713 | independantescortsinmumbai.com | NameCheap, Inc. | 30 Sep 2017 | 30 Sep 2017 | 30 Sep 2018 |
| 714 | independantexecutivesfranchise.co.uk | Reserved | 18 Aug 2014 | 30 Mar 2017 | 18 Aug 2018 |
| 715 | independantexecutivefranchise.co.uk | Reserved | 18 Aug 2014 | 30 Mar 2017 | 18 Aug 2018 |
| 716 | independantauthors.co.uk | - | 3 Oct 2012 | 6 Sep 2016 | 3 Oct 2017 |
| 717 | independantgo.com | Infomaniak Network SA | 5 Oct 2017 | 5 Oct 2017 | 5 Oct 2018 |
| 718 | independante-libre.com | Tucows Domains Inc. | 2 Nov 2017 | 6 Nov 2018 | 2 Nov 2018 |
| 719 | independant-estimators.net | Network Solutions, LLC | 6 Nov 2017 | 12 Sep 2023 | 6 Nov 2025 |
| 720 | independantestimators.net | Network Solutions, LLC | 6 Nov 2017 | 12 Sep 2023 | 6 Nov 2025 |
| 721 | independantmortgagefinder.com | Register.it SPA | 16 Nov 2017 | 16 Nov 2017 | 16 Nov 2018 |
| 722 | independantreferralservice.co.uk | Reserved | 7 Oct 2006 | 4 Nov 2016 | 7 Oct 2018 |
| 723 | independantsales.com | eNom, Inc. | 21 Nov 2017 | 14 Nov 2024 | 21 Nov 2025 |
| 724 | independantcomputers.com | Domain.com, LLC | 24 Nov 2017 | 24 Nov 2017 | 24 Nov 2018 |
| 725 | independant-borzoi-rescue.co.uk | Acens Technologies, S.L.U. | 2 Dec 2010 | 1 Dec 2016 | 2 Dec 2018 |
| 726 | independantlandroverservices.co.uk | - | 3 Sep 2010 | 26 Sep 2016 | 3 Sep 2018 |
| 727 | independantravelinsurance.co.uk | - | 12 Aug 2011 | 8 Aug 2024 | 12 Aug 2025 |
| 728 | independantdomesticenergyassessment.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 18 Jun 2007 | 12 Jun 2015 | 18 Jun 2019 |
| 729 | independantmedicalclinics.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 20 Mar 2005 | 13 Mar 2017 | 20 Mar 2019 |
| 730 | independantmedicalclinic.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 20 Mar 2005 | 13 Mar 2017 | 20 Mar 2019 |
| 731 | independantmortgagebroker.co.uk | - | 5 Apr 2017 | 5 Apr 2017 | 5 Apr 2018 |
| 732 | independantmusicawards.co.uk | - | 2 Oct 2017 | 2 Oct 2017 | 2 Oct 2018 |
| 733 | independantholidayinsurances.co.uk | - | 12 Aug 2011 | 8 Aug 2024 | 12 Aug 2025 |
| 734 | independantfinancialadvice.org.uk | - | 31 May 2008 | 16 Feb 2017 | 31 May 2018 |
| 735 | independantcloud.co.uk | Reserved | 29 Jul 2011 | 28 Jul 2017 | 29 Jul 2019 |
| 736 | independantebooks.co.uk | Reserved | 19 Sep 2013 | 19 Sep 2017 | 19 Sep 2019 |
| 737 | independantastonmartin.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 6 Dec 2016 | 29 Nov 2017 | 6 Dec 2018 |
| 738 | independantmartialartsportassociation.co.uk | eNom, Inc. | 26 Mar 2012 | 26 Jan 2017 | 26 Mar 2018 |
| 739 | independantdistributor.co.uk | - | 13 Aug 2008 | 16 Aug 2017 | 13 Aug 2018 |
| 740 | independantjobs.co.uk | Reserved | 4 Apr 2012 | 3 Apr 2016 | 4 Apr 2018 |
| 741 | independanttalentgroup.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 15 Jun 2007 | 9 May 2017 | 15 Jun 2020 |
| 742 | independantlivingservices-emltd.co.uk | Zog Media, Inc. DBA Zog Names | 5 Feb 2010 | 6 Jan 2016 | 5 Feb 2018 |
| 743 | independantco.co.uk | - | 9 Jul 2014 | 25 Jun 2017 | 9 Jul 2018 |
| 744 | independantbathing.co.uk | Freeparking Domain Registrars, Inc. | 12 Mar 2009 | 6 Jan 2017 | 12 Mar 2018 |
| 745 | independantenergy.co.uk | - | 16 Dec 2015 | 2 Dec 2016 | 16 Dec 2017 |
| 746 | independanttechnicalinspections.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 20 Mar 2009 | 10 May 2017 | 20 Mar 2019 |
| 747 | independanthealthcareni.co.uk | - | 23 Nov 2009 | 9 Nov 2017 | 23 Nov 2018 |
| 748 | independantschools.co.uk | - | 29 Oct 2003 | 29 Sep 2017 | 29 Oct 2018 |
| 749 | independantco.uk | - | 9 Jul 2014 | 24 Jun 2017 | 9 Jul 2018 |
| 750 | independanttravelexperts.co.uk | - | 9 Jun 2011 | 10 May 2016 | 9 Jun 2019 |
| 751 | independantscaffoldinginginspections.co.uk | Instra Corporation Pty Ltd. | 25 Sep 2016 | 18 Nov 2016 | 25 Sep 2018 |
| 752 | independantutilityadvice.org.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 11 Feb 2017 | 29 Sep 2017 | 11 Feb 2018 |
| 753 | independantspecialistsurveys.co.uk | Reserved | 26 Apr 2010 | 25 Apr 2016 | 26 Apr 2018 |
| 754 | independantfriendly.com | GoDaddy.com, LLC | 7 Jun 2019 | 7 Jun 2019 | 7 Jun 2020 |
| 755 | independantprivateinvestigator.com | 1&1 Internet AG | 4 Jan 2018 | 4 Jan 2018 | 4 Jan 2019 |
| 756 | independanttravelnews.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 3 Oct 2002 | 27 Sep 2016 | 3 Oct 2018 |
| 757 | independantmortgagesolutions.co.uk | Reserved | 14 Jul 2005 | 13 Jul 2017 | 14 Jul 2019 |
| 758 | independantinsuranceservices.co.uk | - | 15 Aug 2013 | 2 Aug 2017 | 15 Aug 2019 |
| 759 | independanttubeandfittings.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 5 Nov 2014 | 1 Oct 2016 | 5 Nov 2018 |
| 760 | independantfuneralservice.co.uk | - | 10 Apr 2013 | 22 May 2013 | 10 Apr 2023 |
| 761 | independantwalltiesurveys.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 2 Jul 2015 | 25 Jun 2017 | 2 Jul 2018 |
| 762 | independantmercedes.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 11 Mar 2014 | 4 Mar 2016 | 11 Mar 2018 |
| 763 | independantfinancialadvice.co.uk | - | 4 Feb 2006 | 28 Feb 2025 | 4 Feb 2026 |
| 764 | independantmortgageadvice.co.uk | - | 12 May 2004 | 3 Aug 2016 | 12 May 2018 |
| 765 | independantdemo.co.uk | - | 4 Nov 2010 | 21 Oct 2016 | 4 Nov 2018 |
| 766 | independantplans.co.uk | - | 8 Oct 2003 | 8 Sep 2017 | 8 Oct 2018 |
| 767 | independantravel.co.uk | LCN.COM Ltd. | 3 Jan 2008 | 4 Jan 2018 | 3 Jan 2018 |
| 768 | independanttalentgroup.uk | - | 12 Oct 2017 | 15 Aug 2024 | 12 Oct 2025 |
| 769 | independantfieldcompany.co.uk | Hello Internet Corp. | 26 Dec 2009 | 31 Dec 2017 | 26 Dec 2017 |
| 770 | independantschool.co.uk | - | 14 Jul 2009 | 14 Jun 2024 | 14 Jul 2025 |
| 771 | independantdating.co.uk | - | 30 Nov 2005 | 26 Nov 2017 | 30 Nov 2018 |
| 772 | independant-living-insurance.co.uk | - | 9 Feb 2010 | 10 Jan 2017 | 9 Feb 2018 |
| 773 | independantcottages.co.uk | EPAG Domainservices GmbH | 10 Oct 2009 | 12 Oct 2017 | 10 Oct 2018 |
| 774 | independantreclaimservices.co.uk | Reserved | 11 Apr 2014 | 11 Apr 2016 | 11 Apr 2018 |
| 775 | independantnurse.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 15 Feb 2012 | 8 Feb 2016 | 15 Feb 2018 |
| 776 | independantflooringsolutions.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 15 Nov 2017 | 15 Nov 2017 | 15 Nov 2018 |
| 777 | independanttalent.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 6 Jun 2007 | 9 May 2017 | 6 Jun 2020 |
| 778 | independanthostelsscotland.co.uk | - | 29 Jun 2006 | 29 Jun 2017 | 29 Jun 2018 |
| 779 | independantloancompany.co.uk | Reserved | 2 Mar 2009 | 5 Mar 2018 | 2 Mar 2019 |
| 780 | independantdomesticenergyassessments.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 18 Jun 2007 | 12 Jun 2015 | 18 Jun 2019 |
| 781 | independantfresh.co.uk | - | 22 Feb 2017 | 22 Feb 2017 | 22 Feb 2018 |
| 782 | independantforgings.co.uk | Reserved | 9 Sep 2011 | 8 Sep 2017 | 9 Sep 2019 |
| 783 | independantappointments.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 10 Apr 2007 | 3 Apr 2017 | 10 Apr 2019 |
| 784 | independantmusicday.co.uk | - | 26 Aug 2016 | 12 Aug 2017 | 26 Aug 2018 |
| 785 | independantscaffoldinginspections.co.uk | Instra Corporation Pty Ltd. | 25 Sep 2016 | 18 Nov 2016 | 25 Sep 2018 |
| 786 | independanthostels.co.uk | - | 30 Nov 2017 | 30 Nov 2017 | 30 Nov 2018 |
| 787 | independants-day.co.uk | - | 1 Aug 2013 | 4 Jul 2017 | 1 Aug 2018 |
| 788 | independantinvestmentsolutions.co.uk | Reserved | 14 Jul 2005 | 13 Jul 2017 | 14 Jul 2019 |
| 789 | independantliving.co.uk | - | 19 Nov 2005 | 18 Nov 2017 | 19 Nov 2018 |
| 790 | independantbmwservicing.co.uk | Click Registrar, Inc. d/b/a publicdomainregistry.c… | 22 Aug 2017 | 20 Nov 2017 | 22 Aug 2018 |
| 791 | independantmobility.co.uk | - | 20 Apr 2010 | 5 Apr 2016 | 20 Apr 2018 |
| 792 | independant-finance.co.uk | Dynadot, LLC | 6 Sep 2022 | 16 Apr 2023 | 6 Sep 2023 |
| 793 | independantmercedes.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 10 Jun 2014 | 3 Jun 2016 | 10 Jun 2018 |
| 794 | independantsocialcareassessment.co.uk | - | 7 Nov 2013 | 1 Nov 2017 | 7 Nov 2019 |
| 795 | independantdentalstaff.co.uk | Reserved | 28 Jan 2017 | 28 Jan 2017 | 28 Jan 2019 |
| 796 | independanttravelinsurance.co.uk | - | 12 Aug 2011 | 8 Aug 2024 | 12 Aug 2025 |
| 797 | independant-rsi.com | OVH sas | 8 Jan 2018 | 8 Jan 2018 | 8 Jan 2019 |
| 798 | independanttalent.uk | - | 17 Oct 2017 | 14 Aug 2024 | 17 Oct 2025 |
| 799 | independant-medical-clinics.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 20 Mar 2005 | 13 Mar 2017 | 20 Mar 2019 |
| 800 | independantguide.uk | - | 24 May 2017 | 24 May 2017 | 24 May 2018 |
| 801 | independantfuneraldirector.co.uk | - | 10 Apr 2013 | 22 May 2013 | 10 Apr 2023 |
| 802 | independantelectricalcontractors.co.uk | - | 13 May 2015 | 13 May 2015 | 13 May 2021 |
| 803 | independantastonmartinsales.co.uk | - | 11 Jan 2016 | 11 Apr 2017 | 11 Jan 2018 |
| 804 | independantdealer.co.uk | - | 27 Mar 2015 | 30 Mar 2015 | 27 Mar 2018 |
| 805 | independantcateringequipment.co.uk | - | 15 Oct 2014 | 15 Sep 2016 | 15 Oct 2018 |
| 806 | independantinsurancebureau.co.uk | - | 30 Jun 2017 | 30 Jun 2017 | 30 Jun 2018 |
| 807 | independantmercedesservice.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 11 Mar 2014 | 4 Mar 2016 | 11 Mar 2018 |
| 808 | independantholidayinsurance.co.uk | - | 12 Aug 2011 | 8 Aug 2024 | 12 Aug 2025 |
| 809 | independantmortgages.co.uk | - | 7 May 2014 | 1 Dec 2023 | 7 May 2024 |
| 810 | independantfleetadvisors.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 27 Sep 2006 | 20 Sep 2016 | 27 Sep 2018 |
| 811 | independantlivinginsurance.co.uk | - | 9 Feb 2010 | 10 Jan 2017 | 9 Feb 2018 |
| 812 | independantsocialworkers.co.uk | - | 6 Jan 2015 | 2 May 2015 | 6 Jan 2021 |
| 813 | independantfinancialadviser.co.uk | - | 18 Jun 2009 | 29 Feb 2016 | 18 Jun 2019 |
| 814 | independant4life.co.uk | - | 25 Aug 2012 | 25 Aug 2024 | 25 Aug 2026 |
| 815 | independantoptician.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 5 Jul 2012 | 4 Aug 2016 | 5 Jul 2018 |
| 816 | independanthomeinspectors.co.uk | - | 31 Jan 2005 | 27 Jan 2017 | 31 Jan 2018 |
| 817 | independantconsultants.org.uk | Reserved | 21 Nov 2016 | 20 Nov 2017 | 21 Nov 2018 |
| 818 | independantkartracingassociation.co.uk | - | 25 Oct 2016 | 25 Oct 2016 | 25 Oct 2018 |
| 819 | independantlearners.co.uk | Key-Systems GmbH | 11 May 2017 | 11 May 2017 | 11 May 2018 |
| 820 | independantfinancialadvisercornwall.co.uk | - | 5 Dec 2016 | 5 Dec 2017 | 5 Dec 2018 |
| 821 | independantgym.co.uk | - | 15 Jul 2010 | 1 Jul 2017 | 15 Jul 2018 |
| 822 | independantconsultancy.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 8 Sep 2000 | 28 Sep 2017 | 8 Sep 2018 |
| 823 | independantbathing.uk | Freeparking Domain Registrars, Inc. | 21 Aug 2017 | 21 Aug 2017 | 21 Aug 2019 |
| 824 | independant-medical-clinic.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 20 Mar 2005 | 13 Mar 2017 | 20 Mar 2019 |
| 825 | independantoffshorescaffoldinginspections.co.uk | Instra Corporation Pty Ltd. | 25 Sep 2016 | 18 Nov 2016 | 25 Sep 2018 |
| 826 | independantfinancialadvisor.org.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 31 May 2013 | 25 May 2017 | 31 May 2019 |
| 827 | independantsocialworker.co.uk | - | 7 Jan 2017 | 13 Mar 2017 | 7 Jan 2019 |
| 828 | independantpensionsolutions.co.uk | - | 14 Jul 2005 | 13 Jul 2023 | 14 Jul 2025 |
| 829 | independantbank.info | GoDaddy.com, LLC | 26 Jan 2018 | 26 Jan 2018 | 26 Jan 2019 |
| 830 | independantenterprises.com | Launchpad, Inc. | 31 Jan 2018 | 31 Jan 2018 | 31 Jan 2019 |
| 831 | independantpractitioners.co.uk | - | 5 Feb 2018 | 5 Feb 2018 | 5 Feb 2020 |
| 832 | independantauquotidien.com | Gandi SAS | 8 Feb 2018 | 8 Feb 2018 | 8 Feb 2019 |
| 833 | independantes.com | Dynadot, LLC | 8 Oct 2022 | 8 May 2025 | 8 Oct 2025 |
| 834 | independantsoulhomecare.co.uk | - | 9 Feb 2018 | 9 Feb 2018 | 9 Feb 2019 |
| 835 | independantcareconsultancy.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 15 Feb 2018 | 15 Feb 2018 | 15 Feb 2020 |
| 836 | independantpublicradio.com | Name.com, Inc. | 21 Feb 2018 | 21 Feb 2018 | 21 Feb 2019 |
| 837 | independantly-erotic.com | eNom, Inc. | 22 Feb 2018 | 22 Feb 2018 | 22 Feb 2019 |
| 838 | independant-news.de | - | - | 6 Jan 2016 | - |
| 839 | independant-ensemble.com | 1&1 Internet AG | 7 Mar 2018 | 7 Mar 2018 | 7 Mar 2026 |
| 840 | independantvet.care | Nordreg AB | 22 Mar 2018 | 4 Jun 2025 | 22 Mar 2026 |
| 841 | independantcopenhagen.com | Automattic Inc. | 11 Apr 2018 | 22 Mar 2025 | 11 Apr 2026 |
| 842 | independantporschespecialist.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Apr 2018 | 18 Apr 2018 | 18 Apr 2019 |
| 843 | independantporschespecialist.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 17 Apr 2018 | 17 Apr 2018 | 17 Apr 2020 |
| 844 | independantpublishers.com | Network Solutions, LLC | 20 Apr 2018 | 19 Feb 2025 | 20 Apr 2026 |
| 845 | independantproductions.online | Network Solutions, LLC | 30 Mar 2018 | 4 Apr 2018 | 30 Mar 2019 |
| 846 | independant-estimators.com | Network Solutions, LLC | 24 May 2018 | 9 Apr 2024 | 24 May 2026 |
| 847 | independantmindandbody.com | GoDaddy.com, LLC | 4 Jun 2018 | 4 Jun 2018 | 4 Jun 2020 |
| 848 | independantpizza.com | GoDaddy.com, LLC | 5 Jun 2018 | 16 Aug 2023 | 5 Jun 2023 |
| 849 | independanttravelcats.com | GoDaddy.com, LLC | 14 Oct 2019 | 14 Oct 2019 | 14 Oct 2020 |
| 850 | independantductcleaning.com | GoDaddy.com, LLC | 5 Jun 2018 | 5 Jun 2018 | 5 Jun 2020 |
| 851 | independantsilence.com | Google, Inc. | 11 Jun 2018 | 11 Jun 2018 | 11 Jun 2019 |
| 852 | independanttemps.com | NameCheap, Inc. | 17 Jun 2018 | 24 Jun 2019 | 17 Jun 2020 |
| 853 | independanttemp.com | NameCheap, Inc. | 17 Jun 2018 | 24 Jun 2019 | 17 Jun 2020 |
| 854 | independantefinanciere.com | Online SAS | 22 Jun 2018 | 20 Jun 2025 | 22 Jun 2026 |
| 855 | independantsolarenergy.com | GoDaddy.com, LLC | 12 Oct 2017 | 12 Oct 2017 | 12 Oct 2022 |
| 856 | independantrecording.net | GoDaddy.com, LLC | 25 Jun 2018 | 25 Jun 2018 | 25 Jun 2019 |
| 857 | independanttradingco.com | GoDaddy.com, LLC | 6 Jul 2018 | 12 Jul 2024 | 6 Jul 2025 |
| 858 | independanttech.com | NameCheap, Inc. | 10 Jul 2018 | 10 Jun 2024 | 10 Jul 2025 |
| 859 | independantprofessionalleaders.com | GoDaddy.com, LLC | 19 Jul 2018 | 19 Jul 2018 | 19 Jul 2019 |
| 860 | independantmarket.com | Google, Inc. | 23 Jul 2018 | 26 Apr 2019 | 23 Jul 2019 |
| 861 | independantcidermakers.com | eNom, Inc. | 24 Jul 2018 | 24 Jul 2018 | 24 Jul 2019 |
| 862 | independantfarmer.com | Name.com, Inc. | 4 Aug 2018 | 4 Aug 2018 | 4 Aug 2019 |
| 863 | independantwealthonline.com | Tucows Domains Inc. | 6 Aug 2018 | 10 Aug 2019 | 6 Aug 2019 |
| 864 | independantcomplementaire.com | OVH sas | 24 Aug 2018 | 25 Aug 2024 | 24 Aug 2025 |
| 865 | independantcurrencyconsultants.com | GoDaddy.com, LLC | 7 Sep 2018 | 7 Sep 2018 | 7 Sep 2019 |
| 866 | independantcurrencybrokers.com | GoDaddy.com, LLC | 7 Sep 2018 | 7 Sep 2018 | 7 Sep 2019 |
| 867 | independantpayments.com | GoDaddy.com, LLC | 12 Sep 2018 | 12 Sep 2018 | 12 Sep 2019 |
| 868 | independantpay.com | 1API GmbH | 1 Dec 2020 | 1 Dec 2020 | 1 Dec 2021 |
| 869 | independantmusicarmy.com | NameCheap, Inc. | 20 Sep 2018 | 20 Sep 2018 | 20 Sep 2019 |
| 870 | independantsnewlenox.com | GoDaddy.com, LLC | 22 Sep 2018 | 22 Sep 2018 | 22 Sep 2019 |
| 871 | independant-informatique.com | Ligne Web Services SARL | 8 Nov 2018 | 8 Nov 2018 | 8 Nov 2019 |
| 872 | independant-de-la-paie.com | OVH sas | 12 Nov 2018 | 12 Nov 2018 | 12 Nov 2019 |
| 873 | independantgirl.com | GoDaddy.com, LLC | 9 Jan 2019 | 9 Jan 2019 | 9 Jan 2020 |
| 874 | independantjewellery.com | - | 3 Apr 2023 | 5 May 2024 | 3 Apr 2024 |
| 875 | independantfuneralsdirect.com | GoDaddy.com, LLC | 14 Jan 2019 | 14 Jan 2019 | 14 Jan 2020 |
| 876 | independantcannabiscorporation.com | Google, Inc. | 20 Jan 2019 | 20 Jan 2019 | 20 Jan 2020 |
| 877 | independantstore.com | NameCheap, Inc. | 15 Mar 2023 | 27 May 2024 | 15 Mar 2024 |
| 878 | independantreeferservice.com | GoDaddy.com, LLC | 29 Jan 2019 | 29 Jan 2019 | 29 Jan 2020 |
| 879 | independantprowrestlers.com | Google, Inc. | 5 Feb 2019 | 5 Feb 2019 | 5 Feb 2020 |
| 880 | independantgood.com | GoDaddy.com, LLC | 8 Feb 2019 | 8 Feb 2019 | 8 Feb 2021 |
| 881 | independantri.com | Media Elite Holdings Limited | 15 Jan 2021 | 15 Jan 2021 | 15 Jan 2022 |
| 882 | independantstudio.com | Hostinger, UAB | 21 Apr 2022 | 29 May 2024 | 21 Apr 2026 |
| 883 | independantwoodworks.com | GoDaddy.com, LLC | 21 Feb 2019 | 21 Feb 2019 | 21 Feb 2021 |
| 884 | independant-group.com | GoDaddy.com, LLC | 1 Mar 2019 | 1 Mar 2019 | 1 Mar 2020 |
| 885 | independantathome.com | Domain.com, LLC | 3 Mar 2019 | 3 Mar 2019 | 3 Mar 2020 |
| 886 | independantandstrong.com | Synergy Wholesale Pty Ltd | 4 Mar 2019 | 4 Mar 2019 | 4 Mar 2020 |
| 887 | independantstrengthscoach.com | GoDaddy.com, LLC | 19 Mar 2019 | 19 Mar 2019 | 19 Mar 2020 |
| 888 | independantstrengthsconsultant.com | GoDaddy.com, LLC | 19 Mar 2019 | 19 Mar 2019 | 19 Mar 2020 |
| 889 | independantescort.club | GoDaddy.com, LLC | 3 Apr 2019 | 3 Apr 2019 | 3 Apr 2020 |
| 890 | independantescort.com | Hosting Concepts B.V. dba Openprovider | 16 Aug 2019 | 16 Aug 2019 | 16 Aug 2020 |
| 891 | independant-webpro.com | GoDaddy.com, LLC | 5 Apr 2019 | 5 Apr 2019 | 5 Apr 2020 |
| 892 | independantmortgagebroker.com | Crazy Domains FZ-LLC | 11 Apr 2019 | 11 Apr 2019 | 11 Apr 2020 |
| 893 | independantdiscountcode-ie.club | NameCheap, Inc. | 11 Apr 2019 | 11 Apr 2019 | 11 Apr 2020 |
| 894 | independantmortgagebrokers.com | Crazy Domains FZ-LLC | 11 Apr 2019 | 11 Apr 2019 | 11 Apr 2020 |
| 895 | independantmortgagebroking.com | Crazy Domains FZ-LLC | 11 Apr 2019 | 11 Apr 2019 | 11 Apr 2020 |
| 896 | independant-life-insurance-advisor.com | register.com, Inc. | 22 Apr 2019 | 22 Apr 2019 | 22 Apr 2020 |
| 897 | independantproduction.com | Namesilo, LLC | 26 Apr 2019 | 27 Apr 2019 | 26 Apr 2020 |
| 898 | independanttunes.com | Namesilo, LLC | 26 Apr 2019 | 27 Apr 2019 | 26 Apr 2020 |
| 899 | independantnoise.com | Namesilo, LLC | 26 Apr 2019 | 27 Apr 2019 | 26 Apr 2020 |
| 900 | independantfotografie.com | PSI-USA, Inc. dba Domain Robot | 14 May 2019 | 14 May 2019 | 14 May 2020 |
| 901 | independantphotography.com | PSI-USA, Inc. dba Domain Robot | 14 May 2019 | 14 May 2019 | 14 May 2020 |
| 902 | independantmovingconsultants.com | GoDaddy.com, LLC | 19 May 2019 | 19 May 2019 | 19 May 2021 |
| 903 | independantfacilitator.net | GoDaddy.com, LLC | 28 May 2019 | 28 May 2019 | 28 May 2020 |
| 904 | independantfacilitator.com | GoDaddy.com, LLC | 28 May 2019 | 28 May 2019 | 28 May 2020 |
| 905 | independantgoldbanker.com | GoDaddy.com, LLC | 29 May 2019 | 10 Aug 2024 | 29 May 2024 |
| 906 | independantpropertysolutions.co.uk | - | 28 May 2019 | 28 May 2019 | 28 May 2020 |
| 907 | independant-pro-industrie.com | Network Solutions, LLC | 5 Jun 2019 | 5 Jun 2019 | 5 Jun 2021 |
| 908 | independantkitcheninstallers.com | Webfusion Ltd. | 25 Jun 2019 | 25 Jun 2019 | 25 Jun 2020 |
| 909 | independantpresidentialcandidate.com | GoDaddy.com, LLC | 30 Jun 2019 | 30 Jun 2019 | 30 Jun 2020 |
| 910 | independantdentistry.com | GoDaddy.com, LLC | 13 Jul 2019 | 13 Jul 2019 | 13 Jul 2020 |
| 911 | independantcelebrants.com | GoDaddy.com, LLC | 17 Jul 2019 | 17 Jul 2019 | 17 Jul 2020 |
| 912 | independantwealthaudit.com | GoDaddy.com, LLC | 27 Jul 2019 | 27 Jul 2019 | 27 Jul 2020 |
| 913 | independantprepper.com | NameCheap, Inc. | 28 Jul 2019 | - | 28 Jul 2020 |
| 914 | independantsmiles.com | GoDaddy.com, LLC | 15 Aug 2019 | 15 Aug 2019 | 15 Aug 2020 |
| 915 | independantcottages.com | GoDaddy.com, LLC | 26 Aug 2019 | 26 Aug 2019 | 26 Aug 2020 |
| 916 | independantca.com | NameCheap, Inc. | 12 Sep 2019 | - | 12 Sep 2020 |
| 917 | independantshair.com | Name.com, Inc. | 6 Oct 2019 | 6 Oct 2019 | 6 Oct 2020 |
| 918 | independantcelebrant.com | 1&1 Internet AG | 29 Sep 2021 | 29 Sep 2021 | 29 Sep 2022 |
| 919 | independantconsulting.com | GoDaddy.com, LLC | 9 Nov 2019 | 9 Nov 2019 | 9 Nov 2021 |
| 920 | independantspeculator.com | Media Elite Holdings Limited | 23 Dec 2019 | 18 Jun 2023 | 23 Dec 2028 |
| 921 | independantpublicresearch.com | Name.com, Inc. | 24 Dec 2019 | 20 Dec 2024 | 24 Dec 2025 |
| 922 | independantprivateradio.com | Name.com, Inc. | 24 Dec 2019 | 6 Feb 2025 | 24 Dec 2024 |
| 923 | independantprivateresearch.com | Name.com, Inc. | 24 Dec 2019 | 6 Feb 2025 | 24 Dec 2024 |
| 924 | independantes-maids.com | GoDaddy.com, LLC | 3 Jan 2020 | 3 Jan 2020 | 3 Jan 2021 |
| 925 | independantstateofdesign.com | Webfusion Ltd. | 10 Jan 2020 | 10 Dec 2024 | 10 Jan 2026 |
| 926 | independantdtockbrokers.co.uk | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jan 2020 | 20 Jan 2020 | 20 Jan 2021 |
| 927 | independantlonger.com | Crazy Domains FZ-LLC | 23 Jan 2020 | 23 Jan 2020 | 23 Jan 2021 |
| 928 | independantlive.com | GoDaddy.com, LLC | 8 Feb 2020 | 8 Feb 2020 | 8 Feb 2021 |
| 929 | independantpodcast.com | GoDaddy.com, LLC | 13 Feb 2020 | 13 Feb 2020 | 13 Feb 2021 |
| 930 | independantpodcastnetwork.com | GoDaddy.com, LLC | 13 Feb 2020 | 13 Feb 2020 | 13 Feb 2021 |
| 931 | independantpodcast.network | GoDaddy.com, LLC | 13 Feb 2020 | 18 Feb 2020 | 13 Feb 2021 |
| 932 | independantpodcaster.com | GoDaddy.com, LLC | 13 Feb 2020 | 13 Feb 2020 | 13 Feb 2021 |
| 933 | independantcoolingtoweraudit.com | Synergy Wholesale Pty Ltd | 19 Feb 2020 | 5 Feb 2022 | 19 Feb 2023 |
| 934 | independantcoolingtoweraudits.com | Synergy Wholesale Pty Ltd | 19 Feb 2020 | 5 Feb 2022 | 19 Feb 2023 |
| 935 | independantphilly.com | GoDaddy.com, LLC | 21 Feb 2020 | 21 Feb 2020 | 21 Feb 2021 |
| 936 | independanttrading.com | GoDaddy.com, LLC | 21 Feb 2020 | 21 Feb 2020 | 21 Feb 2021 |
| 937 | independant2701.com | NameCheap, Inc. | 29 Feb 2020 | - | 28 Feb 2021 |
| 938 | independantdelyonne.com | Online SAS | 2 Mar 2020 | 13 Feb 2025 | 2 Mar 2026 |
| 939 | independantasianfuneraldirector.com | GoDaddy.com, LLC | 9 Mar 2020 | 10 Mar 2025 | 9 Mar 2026 |
| 940 | independantheavymachinery.com | GoDaddy.com, LLC | 13 Mar 2020 | 13 Mar 2020 | 13 Mar 2021 |
| 941 | independantbritishartist.com | GoDaddy.com, LLC | 15 Mar 2020 | 27 Mar 2023 | 15 Mar 2024 |
| 942 | independantbritishartists.com | GoDaddy.com, LLC | 15 Mar 2020 | 26 Apr 2023 | 15 Mar 2023 |
| 943 | independantsresponsables.com | OVH sas | 18 Mar 2020 | 19 Mar 2024 | 18 Mar 2025 |
| 944 | independant-bank.net | GoDaddy.com, LLC | 25 Mar 2020 | 26 Mar 2021 | 25 Mar 2022 |
| 945 | independantbaptistchurchsandiego.com | GoDaddy.com, LLC | 30 Mar 2020 | 30 Mar 2020 | 30 Mar 2021 |
| 946 | independantboss.com | eNom, Inc. | 3 Apr 2020 | 3 Apr 2020 | 3 Apr 2021 |
| 947 | independant-home.com | Tucows Domains Inc. | 24 Apr 2020 | 28 Apr 2021 | 24 Apr 2021 |
| 948 | independant-delivery-express.com | 1&1 Internet AG | 30 Apr 2020 | 30 Apr 2020 | 30 Apr 2021 |
| 949 | independantalert.com | GoDaddy.com, LLC | 3 May 2020 | 3 May 2020 | 3 May 2021 |
| 950 | independantalarms.com | GoDaddy.com, LLC | 3 May 2020 | 3 May 2020 | 3 May 2021 |
| 951 | independantlearningacademy.com | GoDaddy.com, LLC | 4 May 2020 | 4 May 2020 | 4 May 2021 |
| 952 | independantskinco.com | Tucows Domains Inc. | 6 May 2020 | 6 May 2020 | 6 May 2021 |
| 953 | independantfranchiseconsulting.com | GoDaddy.com, LLC | 1 Jun 2020 | 1 Jun 2020 | 1 Jun 2021 |
| 954 | independant-expertise-service.com | OVH sas | 5 Jun 2020 | 5 Jun 2024 | 5 Jun 2024 |
| 955 | independantexpertiseservice.com | OVH sas | 5 Jun 2020 | 6 Jun 2024 | 5 Jun 2025 |
| 956 | independantsecurity.co | GoDaddy.com, LLC | 8 Mar 2012 | 13 Mar 2025 | 7 Mar 2026 |
| 957 | independantlocksmith.co | GoDaddy.com, LLC | 8 Mar 2012 | 13 Mar 2025 | 7 Mar 2026 |
| 958 | independantlocksmiths.co | GoDaddy.com, LLC | 8 Mar 2012 | 13 Mar 2025 | 7 Mar 2026 |
| 959 | independantent.com | GoDaddy.com, LLC | 25 Jun 2020 | 25 Jun 2020 | 25 Jun 2021 |
| 960 | independantcelebrationservices.com | Mesh Digital Limited | 29 Jun 2020 | 29 Jun 2020 | 29 Jun 2022 |
| 961 | independantbiztrade.com | Dynadot, LLC | 2 Jul 2020 | 2 Jul 2020 | 2 Jul 2021 |
| 962 | independantplay.xyz | NameCheap, Inc. | 3 Jul 2020 | 3 Jul 2020 | 3 Jul 2021 |
| 963 | independantproperties.com | GoDaddy.com, LLC | 20 Jul 2020 | 20 Jul 2020 | 20 Jul 2021 |
| 964 | independantmovingsolution.com | GoDaddy.com, LLC | 24 Jul 2020 | 24 Jul 2020 | 24 Jul 2021 |
| 965 | independantclothingv.xyz | Hosting Concepts B.V. dba Openprovider | 2 Apr 2020 | 2 May 2020 | 2 Apr 2021 |
| 966 | independantclothingj.xyz | Hosting Concepts B.V. dba Openprovider | 2 Apr 2020 | 11 May 2020 | 2 Apr 2021 |
| 967 | independantmagasindejouetsh.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Feb 2020 | 3 Apr 2020 | 10 Feb 2021 |
| 968 | independantbabe.com | GoDaddy.com, LLC | 3 Aug 2020 | 3 Aug 2020 | 3 Aug 2021 |
| 969 | independantvintage.com | Wild West Domains, LLC | 5 Aug 2020 | 5 Aug 2020 | 5 Aug 2021 |
| 970 | independantweatherlaboratory.com | Gandi SAS | 11 Aug 2020 | 11 Aug 2020 | 11 Aug 2021 |
| 971 | independanttradingcompany.com | GoDaddy.com, LLC | 21 Aug 2020 | 21 Aug 2020 | 21 Aug 2021 |
| 972 | independantschoolhealthinstitute.com | Google, Inc. | 22 Aug 2020 | 22 Aug 2020 | 22 Aug 2021 |
| 973 | independant-services.co.uk | LCN.COM Ltd. | 21 Aug 2020 | 8 Jul 2023 | 21 Aug 2024 |
| 974 | independantfacilitator.info | GoDaddy.com, LLC | 28 May 2019 | 29 May 2020 | 28 May 2021 |
| 975 | independants-coronavirus.info | - | 20 Aug 2023 | 21 Aug 2024 | 20 Aug 2025 |
| 976 | independantfurniture.com | Domain.com, LLC | 9 Sep 2020 | 9 Sep 2020 | 9 Sep 2021 |
| 977 | independantsforericearly.com | GoDaddy.com, LLC | 9 Sep 2020 | 10 Sep 2024 | 9 Sep 2025 |
| 978 | independantdevelopment.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Sep 2020 | 24 Sep 2020 | 24 Sep 2021 |
| 979 | independantinvestor.com | GoDaddy.com, LLC | 5 Oct 2020 | 5 Oct 2020 | 5 Oct 2021 |
| 980 | independantfactcheckers.com | GoDaddy.com, LLC | 19 Oct 2020 | 19 Oct 2024 | 19 Oct 2026 |
| 981 | independantfactchecker.com | GoDaddy.com, LLC | 19 Oct 2020 | 19 Oct 2024 | 19 Oct 2026 |
| 982 | independantbookreview.com | GoDaddy.com, LLC | 19 Oct 2020 | 19 Oct 2020 | 19 Oct 2021 |
| 983 | independant-ci.com | GoDaddy.com, LLC | 21 Oct 2020 | 21 Oct 2020 | 21 Oct 2021 |
| 984 | independantrestaurantowners.com | GoDaddy.com, LLC | 24 Oct 2020 | 25 Oct 2024 | 24 Oct 2025 |
| 985 | independantdeliverydrivers.com | GoDaddy.com, LLC | 24 Oct 2020 | 25 Oct 2024 | 24 Oct 2025 |
| 986 | independant-inspections.com | Gandi SAS | 7 Nov 2020 | 22 Jan 2025 | 7 Nov 2024 |
| 987 | independantes.xyz | OVH sas | 10 Nov 2020 | 10 Nov 2020 | 10 Nov 2021 |
| 988 | independants.xyz | OVH sas | 10 Nov 2020 | 10 Nov 2020 | 10 Nov 2021 |
| 989 | independantes.online | OVH sas | 10 Nov 2020 | 10 Nov 2020 | 10 Nov 2021 |
| 990 | independantamericans.com | GoDaddy.com, LLC | 18 Nov 2020 | 18 Nov 2020 | 18 Nov 2021 |
| 991 | independantamericanparty.com | GoDaddy.com, LLC | 5 Nov 2022 | 5 Nov 2024 | 5 Nov 2026 |
| 992 | independantheslth.com | GoDaddy.com, LLC | 23 Nov 2020 | 23 Nov 2020 | 23 Nov 2021 |
| 993 | independantly.com | Porkbun, LLC | 13 Dec 2020 | 13 Dec 2020 | 13 Dec 2021 |
| 994 | independantautoservice.com | Tucows Domains Inc. | 30 Dec 2020 | 3 Jan 2022 | 30 Dec 2021 |
| 995 | independantiste.quebec | eNom, Inc. | 7 Sep 2019 | 11 Oct 2024 | 7 Sep 2025 |
| 996 | independantcatholics.com | GoDaddy.com, LLC | 5 Jan 2021 | 5 Jan 2021 | 5 Jan 2022 |
| 997 | independantbusinessclub.com | OVH sas | 25 Jan 2021 | 25 Nov 2024 | 25 Jan 2025 |
| 998 | independantbastard.com | GoDaddy.com, LLC | 1 Feb 2021 | 2 Feb 2025 | 1 Feb 2026 |
| 999 | independantsupportcoordination.com | 1&1 Internet AG | 3 Feb 2021 | 3 Feb 2021 | 3 Feb 2022 |
| 1000 | independanthelath.com | GoDaddy.com, LLC | 5 Feb 2021 | 5 Feb 2021 | 5 Feb 2022 |
Displaying 1,000 out of 1,440 domains starting with the keyword "INDEPENDANT". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=independant
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |