Our database now contains whois records of 643 Million (643,535,226) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [643 Million Domains] $10,000 Details

Keyword: IGREW

Reverse Whois » KEYWORD [igrew ]  { 168 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1igrew.orgGoDaddy.com, LLC25 Mar 201621 Mar 201725 Mar 2018
2igrew.netEranet International Limited1 Jun 202510 Jul 20251 Jun 2026
3igrew.comGoDaddy.com, LLC13 Feb 200522 Feb 202513 Feb 2026
4igrew.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…21 Jul 201621 Jul 201621 Jul 2018
5igrew.infoGoDaddy.com, LLC22 Aug 201923 Aug 202022 Aug 2021
6igrew.appGoDaddy.com, LLC16 Oct 202016 Oct 202316 Oct 2024
7igrew.onlineHostinger, UAB13 Mar 202319 May 202413 Mar 2024
8igrew.it-29 Jun 20188 Jul 20258 Jul 2026
9igrewupinroxbury.comGoDaddy.com, LLC24 Oct 201524 Oct 201524 Oct 2016
10igrew2inches.com1&1 Internet AG17 Sep 201417 Sep 201417 Sep 2015
11igrewupcountry.comGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2016
12igrewmine.comGoDaddy.com, LLC17 Dec 201417 Dec 201417 Dec 2015
13igrewproject.orgGoDaddy.com, LLC29 Dec 201429 Dec 201429 Dec 2016
14igrewupindetroit.cityGoogle, Inc.5 Oct 20183 Jun 20255 Oct 2025
15igrewupfine.comAscio Technologies, Inc. Danmark - Filial af Ascio…1 Feb 20151 Feb 20251 Feb 2025
16igrewabeard.comGoDaddy.com, LLC17 Feb 201517 Feb 201517 Feb 2016
17igrewupinatownwithoutjews.comGoDaddy.com, LLC18 Feb 201518 Feb 201518 Feb 2016
18igrewupinthe90s.comNameCheap, Inc.22 Feb 201520 Apr 202522 Feb 2026
19igreward.comNamesilo, LLC22 Mar 202422 May 202522 Mar 2025
20igrewupinroswell.comGoDaddy.com, LLC16 Apr 201516 Apr 201516 Apr 2016
21igrewupinlasvegas.cityGoDaddy.com, LLC5 Sep 20155 Sep 20155 Sep 2016
22igrewupinbradfordpa.comGoDaddy.com, LLC19 Apr 201519 Apr 201519 Apr 2016
23igrewupin.mobiGoDaddy.com, LLC29 May 20159 Aug 202429 May 2024
24igrewupindubai.comGoDaddy.com, LLC11 Jun 201511 Jun 201511 Jun 2016
25igrewupindetroit.comGoogle, Inc.5 Oct 201826 Apr 20245 Oct 2025
26igrewupindetroit.orgGoDaddy.com, LLC23 Jun 201523 Jun 201523 Jun 2016
27igrewupindetroit.netGoDaddy.com, LLC23 Jun 201523 Jun 201523 Jun 2016
28igrewthatmyslef.comRegister.it SPA23 Sep 201524 Sep 201523 Sep 2016
29igrewup.comTurnCommerce, Inc. DBA NameBright.com7 Oct 20161 Oct 20207 Oct 2025
30igrewmyhairback.comGoDaddy.com, LLC18 Jun 202318 Jun 202518 Jun 2026
31igrewupwiththat.orgOmnis Network, LLC18 Nov 2015-18 Nov 2016
32igrewupwiththat.netOmnis Network, LLC18 Nov 201518 Nov 201518 Nov 2016
33igrewupwiththat.comOmnis Network, LLC18 Nov 201518 Nov 201518 Nov 2016
34igrewupinusa.infoGMO Internet Inc.30 Jun 202029 Aug 202030 Jun 2021
35igrewu.comGoDaddy.com, LLC4 Dec 20154 Dec 20154 Dec 2016
36igrewupinusa.comeNom, Inc.7 Dec 20157 Dec 20157 Dec 2016
37igrewapair.comRegister.it SPA6 Jul 20228 Aug 20236 Jul 2023
38igrewupinusa.clubNameCheap, Inc.29 Mar 201711 Jul 201729 Mar 2018
39igrewonline.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Mar 20162 Mar 20175 Mar 2018
40igrewupontheinternet.comeNom, Inc.11 Mar 201613 Mar 201611 Mar 2017
41igrewupon.comeNom, Inc.27 Jun 201627 May 201727 Jun 2018
42igrewupinaustralia.comCrazy Domains FZ-LLC6 Aug 201620 Oct 20246 Aug 2024
43igrewupwithjunglelarry.com1&1 Internet AG1 Apr 20081 Apr 20171 Apr 2018
44igrewhemp.comTurnCommerce, Inc. DBA NameBright.com3 May 201727 Apr 20203 May 2026
45igrewupstarwars.comAutomattic Inc.18 Aug 200928 Aug 202417 Sep 2025
46igrewupinthesangabrielvalley.comGoDaddy.com, LLC8 Jul 20139 Jul 20158 Jul 2017
47igrewupfree.comGoDaddy.com, LLC13 Aug 201316 Aug 202513 Aug 2027
48igrewtaller.comGoDaddy.com, LLC23 Nov 20023 Nov 202423 Nov 2025
49igrewit.comTurnCommerce, Inc. DBA NameBright.com5 Aug 200713 Jul 20215 Aug 2026
50igrewardsclub.comChengdu West Dimension Digital Technology Co., Ltd…30 Aug 202231 Aug 202430 Aug 2025
51igrewthis.comFastDomain Inc.22 Oct 200822 Sep 202513 Nov 2025
52igrewal.comGoDaddy.com, LLC9 Mar 20259 Mar 20259 Mar 2026
53igrewmyhair.comDomain.com, LLC3 Feb 201114 Jan 20253 Feb 2026
54igrewupinconcord.comGoDaddy.com, LLC25 Aug 20115 Sep 201525 Aug 2016
55igrewupinprinceton.comeNom, Inc.20 Sep 202120 Sep 202120 Sep 2022
56igrewitlong.comBeijing Lanhai Jiye Technology Co., Ltd18 Mar 202419 Mar 202518 Mar 2026
57igrewuponafarm.comNetwork Solutions, LLC19 Apr 20053 Mar 202519 Apr 2026
58igrewupthere.comDynadot, LLC6 Oct 20216 Oct 20216 Oct 2022
59igrewupin.comGoDaddy.com, LLC20 Oct 200721 Oct 202320 Oct 2025
60igrewmycock.comGoDaddy.com, LLC28 Oct 201129 Oct 201528 Oct 2017
61igrewsome.comGoDaddy.com, LLC11 Oct 201312 Oct 201511 Oct 2016
62igrewupinmaghull.comNetwork Solutions, LLC18 Jun 20145 Jun 202418 Jun 2026
63igrewards.comTurnCommerce, Inc. DBA NameBright.com30 Nov 201724 Nov 202030 Nov 2025
64igrewhereyouflewhere.comGoogle, Inc.21 Sep 20162 Oct 202521 Sep 2026
65igrewupinswpa.comGoDaddy.com, LLC24 Jun 201924 Jun 201924 Jun 2020
66igrewthat.comAmazon Registrar, Inc.31 Jan 202027 Dec 202431 Jan 2026
67igrewupin.infoGoDaddy.com, LLC29 May 20139 Aug 202429 May 2024
68igrewhemp.netGoDaddy.com, LLC1 Mar 20117 Feb 20251 Mar 2026
69igrewupin.netGoDaddy.com, LLC20 Oct 200721 Oct 202320 Oct 2025
70igrewupin.orgGoDaddy.com, LLC20 Oct 200711 Jun 202420 Oct 2025
71igrewhemp.orgGoDaddy.com, LLC1 Mar 201112 Feb 20251 Mar 2026
72igrewupsikh.comGoDaddy.com, LLC27 Nov 20168 Jan 202527 Nov 2024
73igrewanewcherry.comBeijing Lanhai Jiye Technology Co., Ltd22 Feb 202426 Apr 202522 Feb 2025
74igrewards.winNameCheap, Inc.18 Dec 201620 Sep 201717 Dec 2017
75igrewmyown.comGoDaddy.com, LLC22 Dec 201622 Dec 201622 Dec 2017
76igrewupin.bizGoDaddy.com, LLC31 Jan 20175 Feb 202530 Jan 2026
77igrewupinsouthflorida.comInstra Corporation Pty Ltd.22 Apr 201722 Apr 201722 Apr 2018
78igrewardswheel.onlineNameCheap, Inc.25 Aug 201825 Aug 201825 Aug 2019
79igrewworldtravel.comDomain.com, LLC23 Jun 201723 Jun 201723 Jun 2018
80igrewardsluckywheel.siteNameCheap, Inc.28 Jun 201713 Jul 201728 Jun 2018
81igrewmybusinessonline.comHiChina Zhicheng Technology Limited17 Sep 201818 Sep 201817 Sep 2019
82igrewuphere.comTucows Domains Inc.23 Feb 20209 Feb 202523 Feb 2026
83igrewupin.co.uk-28 Mar 20127 Apr 201728 Mar 2018
84igrewupnowwhat.comFastDomain Inc.8 Jan 20188 Jan 20188 Jan 2019
85igrewupinnelson.comGoDaddy.com, LLC29 May 201829 May 201829 May 2020
86igrewmybusiness.comGoDaddy.com, LLC20 Jul 201820 Jul 201820 Jul 2020
87igrewupstarwarsfilms.comGoDaddy.com, LLC23 Jul 201823 Jul 201823 Jul 2020
88igrewthisgrape.comAmazon Registrar, Inc.15 Apr 201915 Apr 201915 Apr 2020
89igrewstrong.comGoDaddy.com, LLC27 Apr 201927 Apr 202527 Apr 2027
90igrewityoublewit.comGoDaddy.com, LLC14 Jun 201914 Jun 201914 Jun 2021
91igrewuplikethis.comDynadot, LLC28 Jun 201928 Jun 201928 Jun 2020
92igrewitmyself.comTucows Domains Inc.20 Aug 201918 Aug 202520 Aug 2026
93igrewupwhen.netGoogle, Inc.22 Oct 201922 Oct 201922 Oct 2020
94igrewupindaytona.comGoDaddy.com, LLC17 Nov 201917 Nov 202417 Nov 2025
95igrewupwhenapparel.comTucows Domains Inc.18 Nov 20195 Nov 202418 Nov 2025
96igrewupin.mediaGoDaddy.com, LLC15 Jan 20201 Mar 202515 Jan 2026
97igrew-old.comGoDaddy.com, LLC7 Feb 20207 Feb 20207 Feb 2021
98igrewupintheusa.comDomain.com, LLC28 Apr 202013 Apr 202528 Apr 2026
99igrewuponit.comGoDaddy.com, LLC2 Jul 20252 Jul 20252 Jul 2026
100igrewupwhen.comGoogle, Inc.2 Sep 202118 Aug 20252 Sep 2026
101igrewzoo.comGoDaddy.com, LLC20 Jun 202020 Jun 202020 Jun 2022
102igrewthathair.comregister.com, Inc.9 Aug 20209 Aug 20209 Aug 2021
103igrewupinthesuburb.comGoDaddy.com, LLC30 Sep 202030 Sep 202030 Sep 2021
104igrewupo30.comDreamHost, LLC11 Oct 202011 Oct 202011 Oct 2021
105igrewthis4u.comTucows Domains Inc.31 Dec 20204 Jan 202231 Dec 2021
106igrewmyshow.comGoDaddy.com, LLC27 Jan 20219 Mar 202427 Jan 2024
107igrewthisfood.comGoDaddy.com, LLC27 Apr 202120 Aug 202527 Apr 2026
108igrewinx.comNamesilo, LLC2 Sep 20213 Sep 20212 Sep 2022
109igrewthisforyou.comTucows Domains Inc.31 Dec 20204 Jan 202231 Dec 2021
110igrew1.comAutomattic Inc.25 May 20227 Jul 202325 May 2023
111igrewthat.moneyNameCheap, Inc.14 Jul 202225 Aug 202314 Jul 2023
112igrewthisearlier.co.uk-15 Jul 202220 Jun 202315 Jul 2023
113igrewmymind.comGoDaddy.com, LLC18 Jul 202219 Jul 202518 Jul 2028
114igrewthat.co.uk-20 Oct 202216 Aug 202420 Oct 2025
115igrewupona.farmNetwork Solutions, LLC15 Nov 202215 Nov 202215 Nov 2023
116igrewupwiththem.comNameCheap, Inc.29 Dec 202229 Dec 202229 Dec 2032
117igrewdat.comAutomattic Inc.29 Jan 202312 Mar 202429 Jan 2024
118igrewathing.comGoogle, Inc.31 Jan 202316 Jan 202531 Jan 2026
119igrewupinthenineties.comWild West Domains, LLC7 Feb 20237 Feb 20257 Feb 2026
120igrewupin.coGoDaddy.com, LLC6 Feb 201111 Feb 20255 Feb 2026
121igrewaforest.comSquarespace Domains LLC27 Feb 202312 Feb 202527 Feb 2026
122igrewtransportation.comGoDaddy.com, LLC6 Mar 202315 Mar 20256 Mar 2026
123igrewupontapwater.comGoDaddy.com, LLC13 Apr 201814 Apr 202513 Apr 2026
124igrewupasian.comNameCheap, Inc.21 Jul 201921 Jul 202521 Jul 2026
125igrewthese.comGoDaddy.com, LLC28 Jul 20218 Sep 202428 Jul 2024
126igrewuponmangoes.comGoDaddy.com, LLC5 Aug 20215 Jun 20245 Aug 2024
127igrewculture.comGoDaddy.com, LLC4 Apr 202216 May 20244 Apr 2024
128igrewhempnft.comGoDaddy.com, LLC13 Apr 20224 May 202313 Apr 2023
129igrewup80s.comWebfusion Ltd.7 Jun 202221 Aug 20237 Jun 2023
130igrewup.orgAutomattic Inc.8 Jul 202123 Jun 20258 Jul 2026
131igrewuv.comNameCheap, Inc.28 Apr 202310 Jul 202528 Apr 2025
132igrewapair.co.uk-6 Jul 20226 Jul 20226 Jul 2023
133igrewupin.socialGoDaddy.com, LLC19 Sep 201831 Oct 202419 Sep 2024
134igrewupontapes.comGoDaddy.com, LLC1 Aug 202312 Sep 20241 Aug 2024
135igrewupwithoutatv.comTucows Domains Inc.22 Jan 20244 Mar 202522 Jan 2025
136igrewupal.shopNameCheap, Inc.24 May 20244 Jun 202424 May 2025
137igrewupfancyingbothmaleandfemaleleadsofhighschoolmusical.com1&1 Internet AG28 Jun 202431 Jul 202528 Jun 2025
138igrewupandlost.onlineGoDaddy.com, LLC26 Jul 202431 Jul 202526 Jul 2026
139igrewupandlost.shopGoDaddy.com, LLC26 Jul 20248 Aug 202426 Jul 2025
140igrewupandlost.storeGoDaddy.com, LLC26 Jul 202431 Jul 202526 Jul 2026
141igrewupandlost.worldGoDaddy.com, LLC26 Jul 202431 Jul 202526 Jul 2026
142igrewandlost.comGoDaddy.com, LLC26 Jul 202431 Jul 202526 Jul 2026
143igrewupandloss.comGoDaddy.com, LLC26 Jul 202431 Jul 202526 Jul 2026
144igrewuplost.comGoDaddy.com, LLC26 Jul 202431 Jul 202526 Jul 2026
145igrewupandlost.netGoDaddy.com, LLC26 Jul 202431 Jul 202526 Jul 2026
146igrewupwithoutatv.co.uk-9 Sep 20249 Sep 20249 Sep 2025
147igrewupindetroitmi.comSquarespace Domains LLC6 Oct 20246 Oct 20246 Oct 2025
148igrewupinvermont.comCloudFlare, Inc.15 Oct 202422 Oct 202415 Oct 2025
149igrewupinamiddleclassfilipinofamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
150igrewupinamiddleclassfamily.actorGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
151igrewupinamiddleclassfamily.comGoDaddy.com, LLC2 Nov 20242 Nov 20242 Nov 2025
152igrewupinamiddleclasschinesefamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
153igrewupinamiddleclassfrenchfamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
154igrewupinamiddleclassindianfamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
155igrewupinamiddleclassitalianfamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
156igrewupinamiddleclassjapanesefamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
157igrewupinamiddleclassjewishfamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
158igrewupinamiddleclasskoreanfamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
159igrewupinamiddleclassmexicanfamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
160igrewupinamiddleclassvietnamesefamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
161igrewupinamiddleclasswhitefamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
162igrewupinamiddleclassblackfamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
163igrewupinamiddleclassportuguesefamily.comGoDaddy.com, LLC3 Nov 20243 Nov 20243 Nov 2025
164igrewhealthy.comGoDaddy.com, LLC15 Jan 202515 Jan 202515 Jan 2026
165igrewards.xyzGoDaddy.com, LLC10 Mar 202525 Apr 202510 Mar 2026
166igrewupinprussia.comGoDaddy.com, LLC19 Jun 202519 Jun 202519 Jun 2026
167igrewthatllc.comTucows Domains Inc.9 Jul 202518 Jul 20259 Jul 2026
168igrewitmyself.lifeGoDaddy.com, LLC23 Aug 202523 Aug 202523 Aug 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=igrew

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now