Our database now contains whois records of 620 Million (620,816,456) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1577 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [620 Million Domains] $10,000 Details

Keyword: HYDRAS

Reverse Whois » KEYWORD [hydras ]  { 1,770 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1hydras.orgPSI-USA, Inc. dba Domain Robot2 Oct 201416 Nov 20242 Oct 2025
2hydras.systemsPSI-USA, Inc. dba Domain Robot2 Oct 201416 Nov 20172 Oct 2018
3hydras.solutionsPSI-USA, Inc. dba Domain Robot2 Oct 201416 Nov 20172 Oct 2018
4hydras.netGoDaddy.com, LLC7 Dec 20247 Dec 20247 Dec 2025
5hydras.sexy1&1 Internet AG30 Nov 201514 Jan 201730 Nov 2017
6hydras.oneOne.com A/S17 May 2020-17 May 2021
7hydras.infoName.com, Inc.7 Oct 20227 Oct 20237 Oct 2024
8hydras.comeNom, Inc.14 May 200315 May 202514 May 2025
9hydras.onlineGoDaddy.com, LLC13 Dec 202013 Dec 202013 Dec 2021
10hydras.xyzALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED19 May 202519 May 202519 May 2026
11hydras.de--8 Jan 2019-
12hydras.co.ukGandi SAS1 Oct 201427 Aug 20171 Oct 2018
13hydras.centerURL Solutions, Inc.2 Jul 20182 Jul 20182 Jul 2019
14hydras.clubPorkbun, LLC21 Jun 201921 Jun 201921 Jun 2020
15hydras.bizPorkbun, LLC21 Jun 201923 Jun 201921 Jun 2020
16hydras.networkHostinger, UAB27 Jul 202027 Jul 202027 Jul 2021
17hydras.spacePapaki Ltd.21 Sep 202021 Sep 202421 Sep 2025
18hydras.earthNameCheap, Inc.27 Apr 202212 May 202327 Apr 2023
19hydras.ioNameCheap, Inc.22 Jan 202128 Dec 202422 Jan 2026
20hydras.liveGoDaddy.com, LLC7 May 202512 May 20257 May 2026
21hydras.devGoogle, Inc.24 Jun 20238 Aug 202424 Jun 2025
22hydras.ro-12 Jan 2010-10 Jun 2025
23hydras.storeGoDaddy.com, LLC10 Apr 202423 Apr 202510 Apr 2026
24hydras.shopGoDaddy.com, LLC10 Apr 202422 May 202510 Apr 2025
25hydras.techHostinger, UAB13 Apr 202414 Apr 202513 Apr 2026
26hydras.ru-3 Nov 2013-3 Nov 2025
27hydras.com.plhome.pl S.A.3 Jan 20244 Jan 2024-
28hydras.worksName.com, Inc.15 Oct 202420 Oct 202415 Oct 2025
29hydras.se-19 Nov 201124 Oct 202419 Nov 2025
30hydras.topNamesilo, LLC14 Nov 202416 Nov 202414 Nov 2025
31hydrasensecontest.ca-25 Sep 20129 Nov 201725 Sep 2018
32hydrasocialmedia.comDropCatch.com 872 LLC15 Nov 202424 Jan 202515 Nov 2025
33hydraservers.netNameCheap, Inc.18 May 202018 Apr 202518 May 2026
34hydrasolutions.it-16 Nov 20102 Dec 202416 Nov 2025
35hydrasale.comGoDaddy.com, LLC7 Sep 201128 Feb 20257 Sep 2025
36hydrascape.net-13 May 202513 May 202513 May 2026
37hydrasystemsllc.comNameCheap, Inc.24 Sep 20225 Nov 202324 Sep 2023
38hydrasan.netRegister.it SPA27 Oct 201427 Oct 201427 Oct 2015
39hydrasonic.comGoDaddy.com, LLC28 Jan 20123 Mar 202528 Jan 2026
40hydrasave.comNetwork Solutions, LLC31 Oct 20137 Feb 202431 Oct 2030
41hydrastart.comGoDaddy.com, LLC30 Oct 201320 Jan 202530 Oct 2025
42hydrasystem.comGoDaddy.com, LLC15 Oct 200625 Sep 202415 Oct 2025
43hydrasynol.comDynadot, LLC22 Sep 202122 Sep 202122 Sep 2022
44hydraserv.comGoDaddy.com, LLC6 Feb 20152 Feb 20256 Feb 2026
45hydrasign.comGoDaddy.com, LLC24 Sep 201416 Apr 201524 Sep 2015
46hydrastorm.comGoDaddy.com, LLC21 Jun 200026 Dec 202421 Jun 2026
47hydrasled.comGoDaddy.com, LLC10 Nov 201318 Apr 201510 Nov 2015
48hydrasip.com-17 Jun 202418 Jun 202417 Jun 2025
49hydraspring.comGoDaddy.com, LLC1 Feb 20212 Feb 20251 Feb 2026
50hydrashade.com1&1 Internet AG29 Sep 201016 Aug 202229 Sep 2025
51hydrasites.comTucows Domains Inc.2 Nov 20116 Nov 20142 Nov 2015
52hydrasolution.orgGoDaddy.com, LLC20 Jun 20142 Jul 201520 Jun 2016
53hydrasolution.infoGoDaddy.com, LLC20 Jun 201420 Jun 201520 Jun 2016
54hydraslides.comGoDaddy.com, LLC23 Aug 201424 Aug 201623 Aug 2017
55hydrasin.comGoDaddy.com, LLC24 Oct 202424 Oct 202424 Oct 2025
56hydrasuns.com-29 Apr 202230 Apr 202329 Apr 2024
57hydrastash.comGoDaddy.com, LLC28 Aug 201429 Aug 202428 Aug 2025
58hydraserums.comGoDaddy.com, LLC30 Dec 201931 Dec 202430 Dec 2025
59hydrascale.orgTucows Domains Inc.11 Sep 201315 Sep 201411 Sep 2015
60hydraslab.comeNom, Inc.17 Jan 202328 Feb 202517 Jan 2025
61hydrastudio.netHostinger, UAB17 Apr 202421 Mar 202517 Apr 2026
62hydraservices.netGoogle, Inc.28 Mar 202113 Mar 202528 Mar 2026
63hydrasd.comWild West Domains, LLC18 Sep 201418 Sep 201418 Sep 2015
64hydraspac.comNetwork Solutions, LLC19 Sep 201415 Aug 202419 Sep 2025
65hydrasportsboats.comTucows Domains Inc.16 Sep 201221 Sep 201416 Sep 2015
66hydrasro.com-26 Aug 201626 Aug 201626 Aug 2017
67hydrashieldusa.comGoDaddy.com, LLC9 Sep 201410 Sep 20249 Sep 2025
68hydrasi.comTurnCommerce, Inc. DBA NameBright.com19 Dec 201513 Dec 202019 Dec 2025
69hydrascreen.netPSI-USA, Inc. dba Domain Robot2 Oct 201421 Nov 20242 Oct 2025
70hydrasportssales.comGoDaddy.com, LLC1 Oct 20141 Oct 20161 Oct 2017
71hydraseafood.comTucows Domains Inc.22 Sep 201426 Sep 201522 Sep 2016
72hydrasuurunleri.comTucows Domains Inc.22 Sep 201426 Sep 201522 Sep 2016
73hydrascs.comGoDaddy.com, LLC24 Mar 202225 Mar 202524 Mar 2026
74hydrastresser.comGoDaddy.com, LLC7 Jun 20177 Jun 20177 Jun 2018
75hydrasona.comGoDaddy.com, LLC28 Sep 201428 Sep 201428 Sep 2015
76hydraskin-plus.comNamesilo, LLC8 Oct 20148 Nov 20188 Oct 2019
77hydrasia.infoTucows Domains Inc.7 Oct 201111 Oct 20147 Oct 2015
78hydrasia.netSquarespace Domains LLC20 Oct 202420 Oct 202420 Oct 2025
79hydrasia.orgTucows Domains Inc.7 Oct 201111 Oct 20147 Oct 2015
80hydrasteamcarpetcare.comeNom, Inc.14 Oct 201414 Oct 201414 Oct 2015
81hydraspis.comeNom, Inc.16 Sep 20146 Sep 201616 Sep 2018
82hydraservicios.comArsys Internet, S.L. dba NICLINE.COM28 Nov 201428 Nov 201428 Nov 2015
83hydrastorage.comDynadot, LLC1 Dec 201430 Nov 20241 Dec 2025
84hydrascapehd.netPDR Ltd. d/b/a PublicDomainRegistry.com2 Dec 20142 Dec 20142 Dec 2015
85hydrasorber.comGoDaddy.com, LLC8 Dec 20149 Dec 20248 Dec 2027
86hydraserver.comNameKing.com Inc.9 Nov 201028 Feb 20259 Nov 2025
87hydrasourceinnovations.comGoDaddy.com, LLC12 Aug 201512 Aug 201512 Aug 2017
88hydrasonics.comGoDaddy.com, LLC14 Aug 201515 Aug 202414 Aug 2025
89hydraspecinc.comGoDaddy.com, LLC13 Dec 202115 Jul 202413 Dec 2026
90hydrastis.comDynadot, LLC28 Nov 202428 Nov 202428 Nov 2025
91hydrasource.usNameCheap, Inc.28 Oct 201628 Oct 201727 Oct 2017
92hydrastis.reviewAlpnames Limited6 Aug 2015-5 Aug 2016
93hydrasystemsas.comGoDaddy.com, LLC19 Jan 201519 Jan 201519 Jan 2016
94hydrasociety.comTurnCommerce, Inc. DBA NameBright.com11 Apr 20195 Apr 202111 Apr 2026
95hydrasnaketongs.comGoDaddy.com, LLC26 May 201626 May 201626 May 2017
96hydrasnaketongs.netGoogle, Inc.21 Jan 201521 Jan 201521 Jan 2016
97hydraset.netGoDaddy.com, LLC26 Jan 201526 Jan 201526 Jan 2016
98hydrasportsplus.com-18 Aug 201518 Aug 201518 Aug 2017
99hydrasportplus.com-18 Aug 201518 Aug 201518 Aug 2017
100hydrasystembologna.comRegister.it SPA30 Jan 201531 Dec 201630 Jan 2018
101hydrashoedryer.comAscio Technologies, Inc. Danmark - Filial af Ascio…30 Jan 201530 Jan 201530 Jan 2017
102hydraspirit.comAscio Technologies, Inc. Danmark - Filial af Ascio…2 Feb 20152 Feb 20152 Feb 2016
103hydrasportswear.comGoDaddy.com, LLC30 Jan 202015 Jan 202530 Jan 2026
104hydraskin-buymenow.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
105hydrasec.infoGoDaddy.com, LLC2 Sep 20202 Sep 20202 Sep 2021
106hydrasync-group.comNetEarth One Inc. d/b/a NetEarth17 Feb 201517 Jan 202517 Feb 2026
107hydrasoccer.comTucows Domains Inc.27 Jul 201731 Jul 201927 Jul 2019
108hydrasario.comWebfusion Ltd.23 Feb 201516 Feb 201723 Feb 2019
109hydraskin-plusnow.comGoDaddy.com, LLC24 Feb 201524 Feb 201524 Feb 2016
110hydrastrike.comAmazon Registrar, Inc.27 Feb 201523 Jan 202527 Feb 2026
111hydrastrike.netAmazon Registrar, Inc.27 Feb 201523 Jan 202527 Feb 2026
112hydrastumper.comDynadot5 LLC22 May 202423 May 202522 May 2026
113hydrasfate.comHetzner Online AG10 Mar 20159 Mar 202510 Mar 2026
114hydrasfate.org1&1 Internet AG10 Mar 201524 Apr 202510 Mar 2026
115hydraspear.netGoDaddy.com, LLC25 Aug 201525 Aug 201525 Aug 2016
116hydrasupport.netGoogle, Inc.19 Mar 201519 Mar 201519 Mar 2016
117hydrastation.netTucows Domains Inc.27 Aug 20156 Sep 202427 Aug 2025
118hydrastation.comTucows Domains Inc.27 Aug 20156 Sep 202427 Aug 2025
119hydrastress.comeNom, Inc.24 Mar 201524 Mar 201524 Mar 2016
120hydraserver.netNameCheap, Inc.18 Jan 202524 Jan 202518 Jan 2026
121hydrastream.comTurnCommerce, Inc. DBA NameBright.com12 Jun 20181 Nov 202412 Jun 2025
122hydraswisse.comGoDaddy.com, LLC31 Aug 201531 Aug 201531 Aug 2016
123hydrastemcellserum.comDropCatch.com 896 LLC9 Nov 20179 Nov 20179 Nov 2018
124hydraseeding.comGoDaddy.com, LLC8 Apr 201522 Apr 20258 Apr 2026
125hydrastine.comNameCheap, Inc.5 Feb 202520 Feb 20255 Feb 2026
126hydraspan.comFabulous.com Pty Ltd.18 Apr 201518 Apr 201518 Apr 2016
127hydrastrategy.comGoDaddy.com, LLC23 Apr 201523 Apr 202523 Apr 2026
128hydrasolution.comTurnCommerce, Inc. DBA NameBright.com7 Sep 20151 Sep 20207 Sep 2025
129hydraskinsciences.com-6 Dec 20249 Dec 20246 Dec 2025
130hydraskinscience.comWild West Domains, LLC8 Sep 20158 Sep 20158 Sep 2016
131hydrasourcing.comeNom, Inc.30 Apr 201520 Apr 201730 Apr 2018
132hydrasw.comGoDaddy.com, LLC30 May 202030 May 202530 May 2026
133hydrasociale.orgKey-Systems GmbH9 Sep 201515 Jan 20259 Sep 2025
134hydrastop.comPSI-USA, Inc. dba Domain Robot26 Aug 199714 Oct 202425 Aug 2025
135hydraspin.comGoDaddy.com, LLC17 Nov 201624 Dec 202417 Nov 2025
136hydrastop.usGoDaddy.com, LLC13 May 201513 May 201712 May 2018
137hydrascout.comGoDaddy.com, LLC12 Sep 201513 Sep 202412 Sep 2027
138hydrasurf.comFastDomain Inc.10 Jun 201926 May 202410 Jun 2025
139hydrasg.comGoDaddy.com, LLC30 Jan 201731 Jan 202330 Jan 2026
140hydrasubsea.comGoDaddy.com, LLC17 Feb 201812 Feb 202417 Feb 2029
141hydraskills.comKey-Systems GmbH28 Jun 200421 Jan 202528 Jun 2025
142hydrast.comGoDaddy.com, LLC1 Sep 202412 Apr 20251 Sep 2025
143hydrasenergy.comPSI-USA, Inc. dba Domain Robot8 Jul 20159 Jul 20178 Jul 2018
144hydrasat.netEpik Inc.7 Jul 201521 Jun 20247 Jul 2026
145hydrasourcecorporation.comGoDaddy.com, LLC11 Jul 201518 Sep 202211 Jul 2025
146hydraswimming.comGandi SAS21 Jul 201522 May 202521 Jul 2025
147hydraskn.comGoDaddy.com, LLC28 Jul 201528 Jul 201528 Jul 2016
148hydrasportboats.comTurnCommerce, Inc. DBA NameBright.com3 Aug 20214 Sep 20243 Aug 2024
149hydrasport.miamiWild West Domains, LLC2 Oct 20152 Oct 20152 Oct 2016
150hydrascapehd.comHiChina Zhicheng Technology Limited20 Dec 201920 Dec 201920 Dec 2020
151hydrasolutionsinc.comLaunchpad, Inc.8 Aug 20157 Oct 20158 Aug 2018
152hydrassconstruction.comTurnCommerce, Inc. DBA NameBright.com7 Oct 20157 Oct 20157 Oct 2016
153hydrasongsandtalesofbohemia.comCrazy Domains FZ-LLC7 Oct 201518 Oct 20187 Oct 2018
154hydrasec.netNameCheap, Inc.13 Mar 202513 Mar 202513 Mar 2026
155hydrasolation.comGMO Internet Inc.23 Jul 202423 Jul 202423 Jul 2025
156hydrasia.comLigne Web Services SARL28 Nov 202328 Nov 202328 Nov 2024
157hydrastinine.winAlpnames Limited16 Oct 2015-15 Oct 2016
158hydrastar4u.comNetwork Solutions, LLC6 Aug 201124 Jul 20176 Aug 2018
159hydrasvoice.comeNom, Inc.25 Oct 201525 Oct 201525 Oct 2016
160hydrastables.comTucows Domains Inc.26 Oct 201519 Oct 202426 Oct 2025
161hydrastoproofingmemphis.comGoDaddy.com, LLC27 Oct 201527 Oct 201527 Oct 2016
162hydrascore.comGoDaddy.com, LLC27 Oct 201511 Oct 202427 Oct 2025
163hydrastic.comGoDaddy.com, LLC31 Oct 201531 Oct 201531 Oct 2016
164hydrasportscanvas.comGoDaddy.com, LLC7 Nov 20158 Nov 20247 Nov 2025
165hydrasonline.comregister.com, Inc.20 Nov 201520 Nov 201520 Nov 2017
166hydrastrail.comPapaki Ltd.14 Nov 201918 Oct 202414 Nov 2025
167hydraskinsciencesreviews.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
168hydraskinsciencesreview.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
169hydraskinsciencesnews.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
170hydraskinscienceskincreamreview.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
171hydraskinscienceskincareadvice.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
172hydraskinsciencesinfo.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
173hydraskinsciencescream.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
174hydraskinsciencescompany.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
175hydraskinsciencescare.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
176hydraskinsciencesantiagingcreamsite.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
177hydraskinsciencesantiaging.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
178hydraskinsciencesantiageing.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
179hydraskinsciencesallinonecream.comWild West Domains, LLC24 Nov 201524 Nov 201524 Nov 2016
180hydrasoul.comNameCheap, Inc.25 Apr 20201 Apr 202525 Apr 2026
181hydrasounds.comAscio Technologies, Inc. Danmark - Filial af Ascio…7 Jul 20226 Aug 20237 Jul 2023
182hydrastemcellserum.orgName.com, Inc.10 Dec 20153 Aug 201710 Dec 2017
183hydrastemcellserum.netName.com, Inc.10 Dec 20153 Aug 201710 Dec 2017
184hydraswing.comGoDaddy.com, LLC15 Jan 201616 Jan 202515 Jan 2028
185hydraspa-miami.comOVH sas16 Dec 201518 Nov 201616 Dec 2017
186hydrasolveforums.orgNetwork Solutions, LLC23 Dec 201524 Oct 201623 Dec 2017
187hydrasolveforums.netNetwork Solutions, LLC23 Dec 201523 Dec 201523 Dec 2016
188hydrasolveforums.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Mar 202114 Mar 202114 Mar 2022
189hydrastemcellserumtrial.comGoDaddy.com, LLC28 Dec 201528 Dec 201528 Dec 2016
190hydrasaudi.comGoDaddy.com, LLC6 Jan 20166 Jan 20166 Jan 2021
191hydraspac.infoNetwork Solutions, LLC18 Jan 201618 Jan 201618 Jan 2017
192hydrasight.comTurnCommerce, Inc. DBA NameBright.com10 Apr 201720 May 202510 Apr 2026
193hydrasep.infoNetwork Solutions, LLC5 Aug 20215 Aug 20215 Aug 2022
194hydrastemcells.orgName.com, Inc.26 Jan 201626 Jan 201626 Jan 2017
195hydrastemcells.netName.com, Inc.26 Jan 201626 Jan 201626 Jan 2017
196hydrastemcells.comName.com, Inc.26 Jan 201626 Jan 201626 Jan 2017
197hydrasmartlabs.comeNom, Inc.26 Jan 201616 Jul 201626 Jan 2018
198hydrasmartlab.comGoDaddy.com, LLC26 Jan 201626 Jan 201626 Jan 2017
199hydraserver.xyzHostinger, UAB1 Feb 201618 Apr 20161 Feb 2017
200hydrases.comeNom, Inc.2 Feb 20162 Feb 20162 Feb 2017
201hydrasunengineering.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Feb 201611 Feb 20238 Feb 2026
202hydrastreams.comDropCatch.com 1174 LLC10 Jul 202310 Aug 202410 Jul 2024
203hydrastemcelltrial.comInternet Domain Services BS Corp10 Feb 201610 Feb 201610 Feb 2017
204hydraservice.netregister.com, Inc.11 Feb 200011 Jan 202511 Feb 2026
205hydrasolutions.cloudTucows Domains Inc.17 Feb 201621 Feb 201717 Feb 2017
206hydrasens.usKey-Systems GmbH28 Feb 201612 Feb 201727 Feb 2018
207hydraspec.comTurnCommerce, Inc. DBA NameBright.com28 Feb 201622 Feb 202128 Feb 2026
208hydrasens.comInfomaniak Network SA28 Feb 201614 Feb 202528 Feb 2026
209hydrashots.orgGoDaddy.com, LLC2 Mar 20163 Mar 20172 Mar 2018
210hydrashots.netGoDaddy.com, LLC2 Mar 20162 Mar 20162 Mar 2017
211hydrasea.infoNetwork Solutions, LLC2 Mar 20162 Mar 20162 Mar 2017
212hydrashots.comNameCheap, Inc.8 Jan 20258 Jan 20258 Jan 2026
213hydraspec.netPDR Ltd. d/b/a PublicDomainRegistry.com26 Feb 20164 Apr 201726 Feb 2018
214hydrasmoother.comGoDaddy.com, LLC8 Mar 20168 Mar 20168 Mar 2017
215hydrascreen.infoPSI-USA, Inc. dba Domain Robot9 Mar 20169 Mar 20179 Mar 2018
216hydraseis.comGoDaddy.com, LLC13 Mar 201613 Mar 201613 Mar 2017
217hydrasteer.netNetwork Solutions, LLC16 Mar 201610 Aug 202216 Mar 2026
218hydrasmark.comeNom, Inc.28 Mar 201628 Mar 201628 Mar 2017
219hydrascreen.comTurnCommerce, Inc. DBA NameBright.com31 Mar 201625 Mar 202131 Mar 2026
220hydraspulse.comDropCatch.com 1411 LLC17 Jun 201817 Jun 201817 Jun 2019
221hydrashit.comGoDaddy.com, LLC5 Apr 20165 Apr 20165 Apr 2017
222hydrasmootherserum.comGoDaddy.com, LLC8 Apr 20168 Apr 20168 Apr 2017
223hydrasmoothercs.comGoDaddy.com, LLC8 Apr 20168 Apr 20168 Apr 2017
224hydrasafebrake.netGoDaddy.com, LLC9 Apr 201621 Sep 20229 Apr 2026
225hydrasafebrake.comGoDaddy.com, LLC9 Apr 201621 Sep 20229 Apr 2026
226hydrascan.comGoDaddy.com, LLC7 Mar 200215 Feb 20257 Mar 2026
227hydrasalud.comGoDaddy.com, LLC2 May 20162 May 20162 May 2017
228hydrasweep.comTurnCommerce, Inc. DBA NameBright.com18 Apr 201818 Apr 201818 Apr 2019
229hydraspray.comTurnCommerce, Inc. DBA NameBright.com18 Jul 201712 Jul 202018 Jul 2025
230hydrastonenow.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Aug 20249 Aug 20249 Aug 2025
231hydrastoneus.comGoDaddy.com, LLC7 May 20167 May 20167 May 2017
232hydraseed.netNamesilo, LLC18 May 201618 Jul 202418 May 2024
233hydrasnake.comGoDaddy.com, LLC21 May 201621 May 201621 May 2026
234hydrasup.comTucows Domains Inc.17 Jan 20225 Jan 202517 Jan 2026
235hydrasciences.com1&1 Internet AG27 Apr 202028 Apr 202527 Apr 2026
236hydraskinproducts.comWild West Domains, LLC14 Jun 201614 Jun 201614 Jun 2017
237hydrashear.comNetwork Solutions, LLC7 Oct 19998 Aug 20217 Oct 2026
238hydrasport.nl----
239hydraswim.comGoDaddy.com, LLC6 Sep 20167 Sep 20246 Sep 2025
240hydraserver.org-26 Jun 201626 Jun 201626 Jun 2017
241hydraslair.comTurnCommerce, Inc. DBA NameBright.com14 Sep 202224 Oct 202414 Sep 2024
242hydrastixs.comregister.com, Inc.13 Dec 20129 Mar 201613 Dec 2016
243hydrasa.xyzPDR Ltd. d/b/a PublicDomainRegistry.com3 Jul 201614 Sep 20163 Jul 2017
244hydrash.top-7 Jul 20167 Jul 20167 Jul 2017
245hydraspex.comCronon AG7 Jun 20168 Jun 20247 Jun 2025
246hydrastor.bizMarkMonitor Inc.3 Oct 200631 Aug 20162 Oct 2018
247hydrasource.bizNetwork Solutions, LLC9 Aug 201014 Aug 20158 Aug 2016
248hydrasecurity.bizTLD Registrar Solutions Ltd.5 Dec 201817 Dec 20185 Dec 2019
249hydrashave.bizGoDaddy.com, LLC17 Nov 201028 Dec 201716 Nov 2017
250hydraspace.bizArsys Internet, S.L. dba NICLINE.COM22 Mar 20076 May 201721 Mar 2018
251hydraswitch.bizGoDaddy.com, LLC2 Feb 20132 Feb 20171 Feb 2020
252hydrasportscustomboats.comGoDaddy.com, LLC17 Jul 201618 Jul 202417 Jul 2025
253hydrasportscustomboats.usGoDaddy.com, LLC17 Jul 201617 Jul 201716 Jul 2018
254hydrasky.comGoDaddy.com, LLC20 Jul 201630 Jul 202420 Jul 2025
255hydrastix.biz-21 Jul 201621 Jul 201620 Jul 2017
256hydrastix.comSquarespace Domains LLC20 Jan 20245 Jan 202520 Jan 2026
257hydrastix.infoGoDaddy.com, LLC21 Jul 201621 Jul 201621 Jul 2017
258hydrastix.mobiGoDaddy.com, LLC21 Jul 201621 Jul 201621 Jul 2017
259hydrastix.net-21 Jul 201621 Jul 201621 Jul 2017
260hydrastix.orgGoDaddy.com, LLC21 Jul 20161 Sep 201721 Jul 2018
261hydrasea.netOVH sas16 Jul 201320 Jun 202416 Jul 2026
262hydrasunpools.com-24 May 20235 Aug 202424 May 2024
263hydrasomes.comTurnCommerce, Inc. DBA NameBright.com22 Oct 20211 Dec 202422 Oct 2024
264hydrasomes.infoGoDaddy.com, LLC4 Aug 20165 Aug 20184 Aug 2020
265hydrasomes.net-4 Aug 20164 Aug 20164 Aug 2018
266hydrasomes.orgGoDaddy.com, LLC4 Aug 20164 Oct 20164 Aug 2018
267hydrasafetyshowers.comMarcaria.com International, Inc.8 Aug 201618 Sep 20178 Aug 2017
268hydraskinfacial.comOVH sas13 Oct 202013 Oct 202013 Oct 2021
269hydrasafetyshowers.netMarcaria.com International, Inc.8 Aug 201618 Sep 20178 Aug 2017
270hydraskinsystems.com-9 Aug 20169 Aug 20169 Aug 2017
271hydrasport.infoGoDaddy.com, LLC10 Aug 201621 Sep 201710 Aug 2018
272hydrasport.orgGoDaddy.com, LLC6 Dec 202216 Feb 20256 Dec 2024
273hydrastrider.com-19 Aug 201619 Aug 201619 Aug 2017
274hydraskate.comWild West Domains, LLC19 Aug 201620 Aug 201719 Aug 2018
275hydraski.comWild West Domains, LLC19 Aug 201630 Sep 202419 Aug 2024
276hydrascooter.comWild West Domains, LLC25 Aug 201625 Aug 201625 Aug 2017
277hydrasan.comPSI-USA, Inc. dba Domain Robot9 May 200610 May 20259 May 2026
278hydrashop.comTurnCommerce, Inc. DBA NameBright.com18 Dec 201212 Dec 202018 Dec 2025
279hydrassage.comGoDaddy.com, LLC10 Oct 200513 Aug 202410 Oct 2025
280hydrastoneusa.comGoogle, Inc.5 Jun 200821 May 20255 Jun 2026
281hydrasoftwaresystems.comWebfusion Ltd.13 Mar 20136 Mar 201513 Mar 2017
282hydraservices.comGoDaddy.com, LLC14 Nov 200415 Nov 202414 Nov 2026
283hydrasleep.comGoDaddy.com, LLC5 Jun 20205 Jun 20245 Jun 2026
284hydrasportstraining.comGoDaddy.com, LLC14 May 200715 May 202514 May 2026
285hydrasearch.comNetwork Solutions, LLC16 Oct 199616 Aug 202315 Oct 2026
286hydrasports.comGoDaddy.com, LLC7 Oct 19998 Oct 20247 Oct 2025
287hydrassure.comNameCheap, Inc.12 Dec 202323 Jan 202512 Dec 2024
288hydrastore.comGoDaddy.com, LLC29 Sep 200118 Nov 202429 Sep 2025
289hydrashield.comUniregistrar Corp13 Apr 200319 Mar 202513 Apr 2026
290hydrasys.comGoDaddy.com, LLC3 May 201723 Apr 20253 May 2026
291hydrashot.comGoDaddy.com, LLC2 Aug 20073 Aug 20242 Aug 2025
292hydrasolveny.comGoDaddy.com, LLC6 May 201210 May 20246 May 2026
293hydrasync.comGoDaddy.com, LLC29 Jan 201430 Jan 202529 Jan 2027
294hydrasatch.comNetwork Solutions, LLC28 Apr 20145 Mar 201728 Apr 2018
295hydraserve.comTurnCommerce, Inc. DBA NameBright.com22 May 199829 Apr 202321 May 2026
296hydrastem.comDropCatch.com 1040 LLC7 May 20248 May 20247 May 2025
297hydrasoluciones.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Jun 202226 Jul 202314 Jun 2023
298hydrasol.comGoDaddy.com, LLC15 Dec 200923 Jan 202515 Dec 2025
299hydrasteam.comTurnCommerce, Inc. DBA NameBright.com30 Jan 201411 Mar 202530 Jan 2025
300hydrasales.comGoDaddy.com, LLC7 Sep 201128 Feb 20257 Sep 2025
301hydrasyn.comHangzhou Best Domain Technology Co., LTD1 Aug 20222 Aug 20231 Aug 2024
302hydrasoap.comGoDaddy.com, LLC25 May 200226 May 202525 May 2026
303hydrastep.comNetEarth One Inc. d/b/a NetEarth18 Aug 19993 Aug 202418 Aug 2025
304hydrasportbeheer.comHosting Concepts B.V. dba Openprovider6 Jun 20125 Jun 20176 Jun 2018
305hydrashark.comRealtime Register B.V.14 Feb 202418 Jan 202514 Feb 2026
306hydrasafe.comKey-Systems GmbH2 Nov 200921 Jan 20252 Nov 2025
307hydrasunnig.comOnlineNIC, Inc.22 Jun 201118 Apr 202522 Jun 2025
308hydrasworld.comAnnulet LLC30 May 20076 Jun 202530 May 2025
309hydrasite.comTucows Domains Inc.30 Jun 201415 Jun 202430 Jun 2025
310hydrasteel.comGoDaddy.com, LLC4 Oct 20231 Oct 20244 Oct 2025
311hydrasurgical.comGoDaddy.com, LLC2 May 20123 May 20162 May 2017
312hydrasentials.comGoDaddy.com, LLC15 Dec 201016 Dec 202415 Dec 2027
313hydraspread.comTurnCommerce, Inc. DBA NameBright.com20 Nov 201226 Aug 202120 Nov 2025
314hydrastone.comGoDaddy.com, LLC20 Apr 200719 Sep 202220 Apr 2030
315hydrashine.comAnnulet LLC25 Apr 201119 Aug 202425 Apr 2025
316hydrashok.comNameCheap, Inc.24 Aug 200125 Jul 202424 Aug 2025
317hydrasmooth.comAlpine Domains Inc.8 Nov 20108 Aug 20248 Nov 2026
318hydrasportsclub.comWild West Domains, LLC4 Dec 20075 Dec 20244 Dec 2025
319hydrasolvenyc.comGoDaddy.com, LLC6 May 201210 May 20246 May 2026
320hydraslide.comGoDaddy.com, LLC28 Jan 20044 Jan 202528 Jan 2026
321hydrastat.comGoDaddy.com, LLC7 Jun 20057 Jun 20247 Jun 2025
322hydrashell.comGoDaddy.com, LLC25 Apr 201226 Apr 202525 Apr 2026
323hydraskins.comGoDaddy.com, LLC29 May 200826 May 202529 May 2026
324hydrasmoke.comGoDaddy.com, LLC6 Aug 20097 Aug 20246 Aug 2025
325hydrasimulations.comEasyspace LTD11 Mar 20139 Feb 202511 Mar 2026
326hydrasurgicalinnovations.comGoDaddy.com, LLC2 May 20123 May 20162 May 2017
327hydrasurgicalsolutions.comGoDaddy.com, LLC2 May 20123 May 20162 May 2017
328hydrasourcecorp.comGoDaddy.com, LLC29 Jan 20118 Sep 202211 Jul 2025
329hydraspa.comServer Plan Srl10 Feb 200011 Feb 202510 Feb 2026
330hydrasport.comGoDaddy.com, LLC18 Aug 199817 Aug 202417 Aug 2025
331hydrasoil.comGo China Domains, LLC15 Jun 201112 Jun 202415 Jun 2025
332hydrastock.comBeijing Lanhai Jiye Technology Co., Ltd4 Apr 20236 Apr 20254 Apr 2026
333hydrastraw.comGoDaddy.com, LLC17 Aug 202229 Oct 202317 Aug 2023
334hydraspyder.comGoDaddy.com, LLC26 May 20044 Nov 20233 Nov 2026
335hydrasnip.comTucows Domains Inc.18 Feb 200320 Jan 202518 Feb 2026
336hydrasquared.comNameCheap, Inc.10 Sep 202318 Sep 202310 Sep 2025
337hydrasonicman.comGoDaddy.com, LLC29 Nov 201330 Nov 201529 Nov 2016
338hydrastarusa.com1&1 Internet AG27 Jun 20129 Aug 202427 Jun 2025
339hydrastroke.comGoDaddy.com, LLC19 Dec 201217 Mar 201619 Dec 2017
340hydrasecure.comGoDaddy.com, LLC14 Aug 200514 Oct 202414 Aug 2025
341hydrascope.comWebfusion Ltd.31 Mar 20052 Apr 202531 Mar 2026
342hydrasteamcleanca.com-30 Aug 201330 Aug 201330 Aug 2017
343hydrasportmiami.comGoDaddy.com, LLC9 Jan 20149 Jan 20169 Jan 2018
344hydrasilk.comDropCatch.com 1434 LLC8 Sep 202423 Sep 20248 Sep 2025
345hydraspears.comDomain.com, LLC16 Oct 20131 Oct 201716 Oct 2018
346hydrasil.comAscio Technologies, Inc. Danmark - Filial af Ascio…19 Apr 202327 Apr 202419 Apr 2025
347hydrascrub.comAnnulet LLC6 Jul 20113 Feb 20256 Jul 2025
348hydraspareparts.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Apr 20129 Apr 20259 Apr 2026
349hydrastatsolutions.comHiChina Zhicheng Technology Limited28 Apr 202029 Apr 202028 Apr 2021
350hydrash.comDynadot3 LLC5 Sep 202215 Nov 20235 Sep 2023
351hydrasure.comGoDaddy.com, LLC16 Apr 201321 Apr 202516 Apr 2026
352hydrasim.comAscio Technologies, Inc. Danmark - Filial af Ascio…12 Oct 200629 Sep 202412 Oct 2025
353hydrasculpt.comName.com, Inc.22 Jan 20215 Apr 202422 Jan 2024
354hydrasecurity.comGoDaddy.com, LLC14 Aug 200511 Dec 202414 Aug 2026
355hydrastudio.comGoDaddy.com, LLC27 Apr 200427 Apr 202427 Apr 2026
356hydrasmarts.comGoDaddy.com, LLC10 Mar 201427 Apr 201510 Mar 2017
357hydrasigns.comeNom, Inc.18 Aug 200922 Aug 201718 Aug 2018
358hydrascapes.comeNom, Inc.31 May 20112 May 202531 May 2026
359hydraservicesfl.com-31 Aug 201231 Aug 201231 Aug 2017
360hydrashock.comTucows Domains Inc.18 Jul 200823 Jan 202518 Jul 2025
361hydrasteamcleaning.comGoDaddy.com, LLC7 Sep 20127 Aug 20167 Sep 2017
362hydrasauna.comGoDaddy.com, LLC17 Aug 202114 Oct 202217 Aug 2026
363hydrasunremaq.comNetwork Solutions, LLC25 Jul 20115 Mar 201725 Jul 2018
364hydrasunindia.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Feb 201120 Feb 202521 Feb 2026
365hydrashieldinc.comGoDaddy.com, LLC10 Feb 201417 Sep 202210 Feb 2029
366hydraspeed.comGoDaddy.com, LLC17 Nov 201317 Nov 202417 Nov 2025
367hydrashockofficial.com1&1 Internet AG27 Dec 201227 Dec 201627 Dec 2017
368hydrastroker.comGoDaddy.com, LLC19 Dec 201217 Mar 201619 Dec 2017
369hydraskin.comGoDaddy.com, LLC2 May 20053 May 20252 May 2026
370hydras-world.comGoDaddy.com, LLC23 Jun 200024 Jun 202423 Jun 2026
371hydrastonegl.comDropCatch.com 534 LLC16 Nov 201716 Nov 201716 Nov 2018
372hydrashare.comregister.com, Inc.15 Feb 200316 Jan 202515 Feb 2026
373hydraspatial.comNameCheap, Inc.3 Nov 20084 Nov 20243 Nov 2025
374hydrasensetv.comCSC Corporate Domains, Inc.8 Dec 20084 Dec 20238 Dec 2025
375hydrashave.comGoDaddy.com, LLC17 Nov 201030 Aug 202417 Nov 2025
376hydrasud.comNordNet SA19 Nov 20049 May 202519 Nov 2025
377hydraseo.comNameCheap, Inc.9 Sep 200827 Aug 20249 Sep 2025
378hydrastatic.comName.com, Inc.10 Jun 202323 Jul 202410 Jun 2024
379hydrasea.comGoogle, Inc.13 Oct 20035 Feb 202513 Oct 2025
380hydrasystems.comGoDaddy.com, LLC3 Dec 19989 Sep 20222 Dec 2026
381hydraselect.comGoDaddy.com, LLC5 Oct 202423 May 20255 Oct 2025
382hydrasensetrial.comCSC Corporate Domains, Inc.8 Dec 20084 Dec 20238 Dec 2025
383hydrasalon.comGoDaddy.com, LLC20 May 202221 May 202420 May 2026
384hydraspeaks.comGoDaddy.com, LLC17 Apr 201218 Apr 202517 Apr 2027
385hydrasoftmatrix.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Mar 20233 May 202422 Mar 2024
386hydrastand.comSquarespace Domains LLC21 Dec 20221 Feb 202521 Dec 2024
387hydrasportscustom.comGoDaddy.com, LLC10 Sep 201211 Sep 202410 Sep 2025
388hydrasonicwater.comGoDaddy.com, LLC1 Dec 20121 Dec 20151 Dec 2016
389hydrastoneglbasementsystems.comGoDaddy.com, LLC23 Aug 200815 Jul 201323 Aug 2016
390hydrastudios.comGoDaddy.com, LLC26 Apr 20178 Feb 202326 Apr 2028
391hydraspalace.com1&1 Internet AG4 Feb 20214 Feb 20214 Feb 2022
392hydrashortz.comGoDaddy.com, LLC5 Aug 20033 Aug 20155 Aug 2017
393hydraset.comNetwork Solutions, LLC26 Jul 199617 Oct 201925 Jul 2029
394hydraspace.comTurnCommerce, Inc. DBA NameBright.com3 Jun 201115 Jan 20203 Jun 2025
395hydrasec.comTucows Domains Inc.12 Jul 200420 Jan 202512 Jul 2025
396hydrasofttoricdw.com-23 Oct 202123 Oct 202123 Oct 2022
397hydrasort.comNameCheap, Inc.7 Jul 20177 Jul 20177 Jul 2018
398hydrass.comNordNet SA15 Apr 20045 Apr 202514 Apr 2027
399hydrasystemplus.comAcens Technologies, S.L.U.17 Sep 200712 Sep 202417 Sep 2025
400hydraspaceproject.comArsys Internet, S.L. dba NICLINE.COM21 Feb 20076 Jul 201721 Feb 2018
401hydrasofthair.comWild West Domains, LLC10 Sep 200811 Sep 202410 Sep 2025
402hydraspider.comGoDaddy.com, LLC7 Jan 20098 Jan 20157 Jan 2017
403hydrasurfacepreparation.comWild West Domains, LLC3 Feb 20094 Feb 20253 Feb 2026
404hydrasa.comTurnCommerce, Inc. DBA NameBright.com30 Nov 201224 Nov 202030 Nov 2025
405hydrasportofmiami.comGoDaddy.com, LLC9 Jan 20149 Jan 20169 Jan 2018
406hydrastemfacial.comGoDaddy.com, LLC11 May 202212 May 202511 May 2026
407hydrase.comDynadot, LLC12 Jan 20211 Jan 202512 Jan 2026
408hydrastar.comGoDaddy.com, LLC11 Aug 200516 Mar 202511 Aug 2025
409hydrasolve.comGoDaddy.com, LLC22 Jul 201125 Jul 202322 Jul 2025
410hydrashotz.comGoDaddy.com, LLC29 Apr 201030 Apr 201629 Apr 2018
411hydrasend.comWebfusion Ltd.24 Apr 201225 Apr 202524 Apr 2026
412hydrascale.comPorkbun, LLC30 Dec 202420 Feb 202530 Dec 2025
413hydraswimmingpools.comNameCheap, Inc.5 Dec 200213 Jan 20255 Dec 2025
414hydrasoftcorporation.comGoDaddy.com, LLC6 Jul 200811 Sep 20226 Jul 2026
415hydraseguros.comWild West Domains, LLC29 Oct 202429 Oct 202429 Oct 2029
416hydrasole.comGoDaddy.com, LLC12 Aug 201313 Aug 202412 Aug 2029
417hydraservice.comGoDaddy.com, LLC1 Mar 199721 May 20242 Mar 2026
418hydrasat.comEpik Inc.31 Oct 201213 Jun 202131 Oct 2027
419hydrasancremona.comRegister.it SPA20 Oct 201420 Sep 201520 Oct 2016
420hydrasfc.comGMO Internet Inc.7 Mar 202217 Apr 20237 Mar 2023
421hydrasportsdealer.comGoDaddy.com, LLC24 Aug 200425 Aug 202424 Aug 2025
422hydrascience.comTurnCommerce, Inc. DBA NameBright.com3 Jun 201328 May 20213 Jun 2025
423hydraswitch.comGoDaddy.com, LLC18 May 201218 May 202418 May 2026
424hydraslim.comGoDaddy.com, LLC28 Aug 20077 Aug 202428 Aug 2026
425hydrasrl.comTurnCommerce, Inc. DBA NameBright.com4 May 201328 Apr 20214 May 2025
426hydrasenseoffer.comCSC Corporate Domains, Inc.8 Dec 20084 Dec 20238 Dec 2025
427hydraskincare.comGoDaddy.com, LLC29 May 200230 May 202529 May 2026
428hydrason.com-1 Jan 202531 Mar 20251 Jan 2026
429hydraseed.comGoDaddy.com, LLC16 Jan 201917 Jan 202516 Jan 2026
430hydrasit.comGandi SAS1 Oct 201028 Aug 20241 Oct 2025
431hydrasas.comNameCheap, Inc.10 Feb 202011 Feb 202410 Feb 2026
432hydrasteamclean.comGoDaddy.com, LLC10 Apr 20136 Mar 201610 Apr 2017
433hydrasep.comBeijing Lanhai Jiye Technology Co., Ltd18 Jan 20255 May 202518 Jan 2026
434hydrasportboat.comGoDaddy.com, LLC28 Jun 200510 Mar 202528 Jun 2025
435hydraseals.comTurnCommerce, Inc. DBA NameBright.com1 Apr 201912 May 20251 Apr 2025
436hydrasoft.comTurnCommerce, Inc. DBA NameBright.com1 Dec 200912 Feb 20251 Dec 2025
437hydrasizers.comName.com, Inc.17 Apr 202017 Apr 202017 Apr 2021
438hydrasmoothcorp.com1&1 Internet AG11 Feb 200730 Aug 201711 Feb 2026
439hydrasupport.comregister.com, Inc.1 Dec 20041 Nov 20241 Dec 2025
440hydrashift.comTurnCommerce, Inc. DBA NameBright.com22 Jan 201316 Jan 202122 Jan 2026
441hydrashows.comGoDaddy.com, LLC21 Jan 201428 Dec 202421 Jan 2026
442hydrastiscanadensis.comFabulous.com Pty Ltd.23 Aug 200424 Aug 202423 Aug 2025
443hydrasponge.comGoDaddy.com, LLC20 Mar 200221 Mar 202520 Mar 2026
444hydrascape.comGoDaddy.com, LLC25 Oct 201031 Aug 202425 Oct 2025
445hydrasolvemanhattan.comGoDaddy.com, LLC6 May 201210 May 20246 May 2026
446hydrasysteme.comTucows Domains Inc.10 Jan 200030 Dec 202410 Jan 2026
447hydrasteakhouse.comKey-Systems GmbH27 Jul 200821 Jan 202527 Jul 2025
448hydrasupply.comGoDaddy.com, LLC5 Sep 201920 Sep 20245 Sep 2025
449hydrasmart.comGoDaddy.com, LLC18 Oct 201018 Oct 202418 Oct 2025
450hydrasurgicaldevice.comGoDaddy.com, LLC2 May 20123 May 20162 May 2017
451hydraservers.comTucows Domains Inc.18 May 201326 Apr 202518 May 2026
452hydrasorb.comGoogle, Inc.14 May 202330 Apr 202514 May 2026
453hydrasoftworks.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…21 Mar 202328 Apr 202421 Mar 2024
454hydrastarmarine.com1&1 Internet AG12 Feb 201412 Mar 201812 Feb 2026
455hydrasphere.comOne.com A/S22 Feb 20121 Feb 202522 Feb 2026
456hydrasource.comNameCheap, Inc.7 Dec 20092 Nov 20237 Dec 2025
457hydrasteer.comNetwork Solutions, LLC22 Dec 20013 Sep 202122 Dec 2026
458hydrasoftware.comTurnCommerce, Inc. DBA NameBright.com24 Jun 200411 Jul 202124 Jun 2025
459hydrasoleil.comGoDaddy.com, LLC3 Mar 20057 Jun 202413 Aug 2026
460hydrasun.com1API GmbH7 Feb 20009 Jan 20257 Feb 2026
461hydrasound.comDreamHost, LLC28 Nov 201928 Oct 202428 Nov 2025
462hydraseal.comAnnulet LLC4 Jan 201221 Feb 20254 Jan 2026
463hydraserviceinc.comNetwork Solutions, LLC24 Mar 20145 Jun 202424 Mar 2027
464hydrastor.comMarkMonitor Inc.29 Sep 20067 Sep 202429 Sep 2026
465hydraskysurvey.comGoDaddy.com, LLC6 Apr 20146 Apr 20246 Apr 2034
466hydrastrengthtraining.comNetwork Solutions, LLC20 Jun 20125 Mar 201620 Jun 2017
467hydraspear.comGoDaddy.com, LLC30 Dec 202430 Dec 202430 Dec 2025
468hydrasyst.comCrazy Domains FZ-LLC15 Oct 201012 Sep 202315 Oct 2025
469hydrasplat.comTurnCommerce, Inc. DBA NameBright.com4 Sep 201914 Oct 20244 Sep 2024
470hydrasoie.comGoDaddy.com, LLC15 Aug 201320 Aug 201615 Aug 2016
471hydrasocial.comTurnCommerce, Inc. DBA NameBright.com2 Dec 201926 Aug 20212 Dec 2025
472hydrasolutions.comTurnCommerce, Inc. DBA NameBright.com7 Aug 200215 Jan 20207 Aug 2025
473hydrasense.comCSC Corporate Domains, Inc.27 Dec 200023 Dec 202327 Dec 2025
474hydrastar-usa.comGoDaddy.com, LLC30 Mar 200929 Mar 202330 Mar 2026
475hydrasm.comHang Zhou E-Business Services Co., Ltd28 Mar 202028 Mar 202028 Mar 2021
476hydrasleeve.comDomain.com, LLC11 Apr 20035 Sep 202411 Apr 2026
477hydrasonicvalve.comGoDaddy.com, LLC8 Sep 20169 Sep 20248 Sep 2025
478hydrasportdrones.com-10 Sep 201610 Sep 201610 Sep 2017
479hydrasportdrone.com-10 Sep 201610 Sep 201610 Sep 2017
480hydrasmartfoliar.com-19 Sep 201619 Sep 201619 Sep 2017
481hydrasorbwounddressings.comGoDaddy.com, LLC28 Sep 201626 Sep 202228 Sep 2027
482hydrasquid.comGoDaddy.com, LLC29 Sep 201629 Sep 202429 Sep 2026
483hydraserve.co.ukeNom, Inc.30 Jun 20087 Oct 201630 Jun 2018
484hydrashowers.com-9 Oct 20169 Oct 20169 Oct 2018
485hydrasource.infoNetwork Solutions, LLC9 Aug 201021 Sep 20169 Aug 2017
486hydrasrl.infoDreamHost, LLC26 Nov 20227 Jan 202426 Nov 2023
487hydrashave.infoGoDaddy.com, LLC17 Nov 201017 Nov 201717 Nov 2018
488hydrasocialmedia.infoArsys Internet, S.L. dba NICLINE.COM30 Sep 201130 Sep 201730 Sep 2018
489hydrasyst-design.comTucows Domains Inc.11 Oct 201615 Oct 201911 Oct 2019
490hydraslideuk.com-14 Oct 201614 Oct 201614 Oct 2019
491hydrasport.netGoDaddy.com, LLC30 Nov 19991 Dec 202430 Nov 2025
492hydrasrl.netTucows Domains Inc.16 May 20059 May 202516 May 2026
493hydrasocialmedia.netArsys Internet, S.L. dba NICLINE.COM30 Sep 20111 Oct 201730 Sep 2018
494hydrasud.netNetwork Solutions, LLC16 Sep 200822 Sep 201616 Sep 2017
495hydrasizers.netNetwork Solutions, LLC23 Oct 199827 Nov 201722 Oct 2017
496hydrastudios.netGoDaddy.com, LLC29 Jul 20209 Sep 202329 Jul 2023
497hydraswisse.netXin Net Technology Corporation1 Feb 20101 Feb 20101 Feb 2020
498hydrashock.net1&1 Internet AG13 Dec 201227 Nov 201713 Dec 2017
499hydrasorb.netGoDaddy.com, LLC5 Sep 200813 Mar 20235 Sep 2028
500hydraserve.netHosting Concepts B.V. dba Openprovider5 Nov 201230 Oct 20245 Nov 2025
501hydrashave.netGoDaddy.com, LLC17 Nov 201017 Nov 201517 Nov 2017
502hydrastor.netMarkMonitor Inc.29 Sep 200615 Mar 201729 Sep 2018
503hydrastore.netTucows Domains Inc.18 Jun 200229 Aug 202418 Jun 2024
504hydrasoftware.netTucows Domains Inc.11 Mar 201414 May 202511 Mar 2026
505hydrashare.netregister.com, Inc.15 Feb 200316 Jan 202515 Feb 2026
506hydraspace.netNameCheap, Inc.22 Apr 202222 Apr 202322 Apr 2024
507hydrasphere.netTucows Domains Inc.7 Jan 20257 Jan 20257 Jan 2026
508hydrasun.netBeijing Lanhai Jiye Technology Co., Ltd18 Jul 202219 Jul 202318 Jul 2024
509hydrasa.netNetwork Solutions, LLC19 Feb 201127 Dec 201519 Feb 2017
510hydrasystem.netTucows Domains Inc.19 Dec 201930 Sep 202419 Dec 2025
511hydrasportsclub.netWild West Domains, LLC4 Dec 20075 Dec 20244 Dec 2025
512hydrasolutions.netWix.com Ltd.4 Apr 20225 Mar 20254 Apr 2026
513hydrasync.netNameCheap, Inc.25 Feb 201326 Jan 202525 Feb 2026
514hydraselect.netGoDaddy.com, LLC24 Jun 201424 Jun 201424 Jun 2017
515hydraskincare.netGoDaddy.com, LLC3 May 20104 May 20253 May 2026
516hydrashell.netGoDaddy.com, LLC30 Apr 20121 May 202530 Apr 2026
517hydrasil.netTucows Domains Inc.3 Jul 20147 Jul 20193 Jul 2019
518hydrasafe.netTucows Domains Inc.12 Jan 202216 Jan 202312 Jan 2024
519hydrashield.netGoogle, Inc.6 Oct 20205 Nov 20246 Oct 2024
520hydraslayer.orgeNom, Inc.19 Oct 201630 Nov 201719 Oct 2018
521hydraslayer.comTurnCommerce, Inc. DBA NameBright.com6 Jan 201824 Aug 20226 Jan 2026
522hydraslayer.neteNom, Inc.19 Oct 201630 Nov 201719 Oct 2017
523hydrasystems.orgGoDaddy.com, LLC12 Jun 202418 Jun 202412 Jun 2025
524hydrasync.orgGoDaddy.com, LLC16 Oct 201330 Nov 202416 Oct 2025
525hydrasecurity.orgMesh Digital Limited9 Jul 200722 Aug 20249 Jul 2024
526hydrasil.orgTucows Domains Inc.3 Jul 201418 Jun 20173 Jul 2018
527hydrashave.orgGoDaddy.com, LLC17 Nov 201018 Nov 201717 Nov 2018
528hydrasandhawk.orgGoDaddy.com, LLC16 Feb 20112 Apr 202516 Feb 2028
529hydrasolutions.orgRegister.it SPA28 Jun 201212 Aug 202428 Jun 2025
530hydrashare.orgregister.com, Inc.15 Feb 200321 Jan 202515 Feb 2026
531hydrasun.orgNameCheap, Inc.18 Apr 202329 Jun 202418 Apr 2024
532hydrasizers.orgNetwork Solutions, LLC23 Oct 19985 Dec 201722 Oct 2018
533hydrasportsclub.orgWild West Domains, LLC4 Dec 200718 Jan 20254 Dec 2025
534hydrasocialmedia.orgArsys Internet, S.L. dba NICLINE.COM30 Sep 20111 Oct 201730 Sep 2018
535hydrasource.orgNetwork Solutions, LLC9 Aug 201021 Sep 20169 Aug 2017
536hydrashield.xxx-1 Dec 201130 Jan 20121 Dec 2021
537hydrasense.xxx-1 Dec 201130 Jan 20121 Dec 2021
538hydrastis.xyzOnlineNIC, Inc.1 Jun 201629 Jul 20161 Jun 2017
539hydrasesab.xyzUniregistrar Corp2 Jun 201627 Sep 20162 Jun 2017
540hydrasport.xyzGoDaddy.com, LLC6 Jun 201429 Aug 20246 Jun 2025
541hydrasportsclub.xyzUniregistrar Corp3 Jun 201623 Sep 20163 Jun 2017
542hydrasti.xyzOnlineNIC, Inc.1 Jun 201629 Jul 20161 Jun 2017
543hydrasense.ca-9 Nov 200017 Nov 20241 Dec 2026
544hydrasports.coeNom, Inc.8 Jan 201412 Dec 20177 Jan 2019
545hydrasud.fr-16 Sep 200813 Oct 2016-
546hydrasport.it-8 Sep 202324 Sep 20248 Sep 2025
547hydrasoft.it-12 Nov 200118 Jul 20172 Jul 2018
548hydrastop-pro.comRealtime Register B.V.28 Oct 201625 Oct 202428 Oct 2025
549hydraspa.co.uk-30 Mar 199820 Feb 202530 Mar 2026
550hydrasub.comEstrategias WebSite S.L.10 Sep 200015 Jan 202510 Sep 2025
551hydrasal.com-2 Nov 20162 Nov 20162 Nov 2017
552hydrastay.com-3 Nov 20163 Nov 20163 Nov 2021
553hydraserumc.comGoDaddy.com, LLC8 Nov 20168 Nov 20168 Nov 2018
554hydraserum-c.comGoDaddy.com, LLC8 Nov 20168 Nov 20168 Nov 2018
555hydrasportsusa.comGoDaddy.com, LLC11 Nov 201611 Nov 201611 Nov 2017
556hydrasportapparel.comGoDaddy.com, LLC17 Aug 202318 Aug 202417 Aug 2025
557hydrastudios.xyzTucows Domains Inc.14 Nov 201610 Dec 202414 Nov 2025
558hydrasportsapp.comTucows Domains Inc.16 Nov 201620 Nov 201816 Nov 2018
559hydrasportcustom.comGoDaddy.com, LLC19 Nov 201619 Nov 202419 Nov 2025
560hydrasix.comCloud Yuqu LLC20 Nov 202420 Nov 202420 Nov 2025
561hydrastores.comTurnCommerce, Inc. DBA NameBright.com7 Jun 20191 Jun 20207 Jun 2025
562hydrastores.infoGoDaddy.com, LLC30 Nov 201630 Nov 201730 Nov 2018
563hydrastores.netGoDaddy.com, LLC30 Nov 201630 Nov 201630 Nov 2017
564hydrasoft.netCloudFlare, Inc.26 Nov 20224 Feb 202526 Nov 2024
565hydrasys.netGoDaddy.com, LLC22 Dec 201622 Dec 201622 Dec 2017
566hydrasolar.comGoDaddy.com, LLC23 Nov 201927 May 202523 Nov 2025
567hydrasys.orgGoDaddy.com, LLC22 Dec 201623 Dec 201722 Dec 2018
568hydrasoft.orgCloudFlare, Inc.13 Mar 202416 Feb 202513 Mar 2026
569hydraseeders.com1&1 Internet AG31 Dec 201612 Mar 201831 Dec 2025
570hydrasmartsleeve.comGoDaddy.com, LLC30 Dec 201630 Dec 201630 Dec 2017
571hydrasome.comDropCatch.com 938 LLC24 Mar 201824 Mar 201824 Mar 2019
572hydrastore.xyzHostinger, UAB7 Jan 20177 Jan 20177 Jan 2018
573hydrashome.comVautron Rechenzentrum AG8 Jan 20178 Jan 20178 Jan 2018
574hydrasmart.netGoDaddy.com, LLC10 Jan 201710 Jan 202510 Jan 2026
575hydrasmartspecialty.comGoDaddy.com, LLC10 Jan 201710 Jan 202510 Jan 2026
576hydrashower.comPorkbun, LLC24 Apr 202524 Apr 202524 Apr 2026
577hydrasmartbottle.comWorthyDomains LLC16 Apr 201816 Apr 201816 Apr 2019
578hydrastocks.comHiChina Zhicheng Technology Limited20 Feb 201720 Feb 201720 Feb 2018
579hydrasiege.comGoDaddy.com, LLC20 Feb 201720 Feb 201720 Feb 2018
580hydrastocks.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…20 Feb 201710 Mar 201720 Feb 2018
581hydrastonenow.rocksGoDaddy.com, LLC10 Mar 20176 Nov 201710 Mar 2019
582hydrastations.comGoDaddy.com, LLC3 Jul 20204 Jul 20243 Jul 2026
583hydrastone.rocksGoDaddy.com, LLC10 Mar 20179 Oct 201710 Mar 2022
584hydrasmooth.infoGoDaddy.com, LLC23 Mar 201722 May 201723 Mar 2018
585hydrashockoffshore.comWild West Domains, LLC23 Mar 20174 Jun 202523 Mar 2025
586hydrashockoffshorellc.comWild West Domains, LLC23 Mar 20174 Jun 202523 Mar 2025
587hydraswiss.comNETIM SARL14 Sep 202414 Sep 202414 Sep 2025
588hydraslide.orgGoDaddy.com, LLC28 Mar 201718 Jul 202428 Mar 2027
589hydraslide.bizGoDaddy.com, LLC28 Mar 201730 Jun 202427 Mar 2027
590hydraslide.netGoDaddy.com, LLC28 Mar 20172 Oct 202228 Mar 2027
591hydraslide.infoGoDaddy.com, LLC28 Mar 201723 Jul 202428 Mar 2027
592hydrascore.netKey-Systems GmbH12 Apr 20173 Feb 202512 Apr 2027
593hydrastresser.xyzInstra Corporation Pty Ltd.13 Apr 201722 Jul 201713 Apr 2018
594hydrasystems.co.uk-5 Aug 199929 Jun 20245 Aug 2027
595hydrasolutions.de--30 Jul 2019-
596hydrasports.co.uk-27 Sep 202428 Mar 202527 Sep 2025
597hydrasrls.comWix.com Ltd.26 Jan 202511 Mar 202526 Jan 2027
598hydrastrategy.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…2 Dec 20162 Dec 20162 Dec 2018
599hydraskills.co.uk-7 Feb 20244 Apr 20257 Feb 2025
600hydrasail.it-13 Oct 201529 Oct 201613 Oct 2017
601hydrasciences.lifeCrazy Domains FZ-LLC17 Apr 201729 Sep 201717 Apr 2018
602hydrasnow.comGoogle, Inc.19 Apr 201719 Apr 201719 Apr 2018
603hydrasight.netMelbourne IT, Ltd23 Apr 20175 Mar 202223 Apr 2026
604hydrasportbottle.comRegister.it SPA20 Aug 202420 Aug 202420 Aug 2025
605hydrastate.com1API GmbH14 Nov 202014 Nov 202014 Nov 2021
606hydrastorcloud.comGoDaddy.com, LLC13 May 201713 May 201713 May 2018
607hydraschelp.comVautron Rechenzentrum AG17 May 201717 May 201717 May 2018
608hydraspeech.comLaunchpad, Inc.26 May 201711 May 202526 May 2026
609hydrasync.supportGoDaddy.com, LLC26 May 201727 May 202526 May 2027
610hydrasvlon.comGoDaddy.com, LLC30 May 201730 May 201730 May 2018
611hydraslasthead.comNameCheap, Inc.5 Jun 20175 May 20255 Jun 2026
612hydraskinbeauty.comTucows Domains Inc.10 Sep 202014 Sep 202110 Sep 2021
613hydrasoftsas.comGoDaddy.com, LLC11 Jun 201711 Jun 201711 Jun 2018
614hydraskull.comGoDaddy.com, LLC16 Jun 201716 Jun 201716 Jun 2018
615hydrasecurityservices.comFastDomain Inc.20 Oct 202120 Oct 202120 Oct 2022
616hydrascent.comGoDaddy.com, LLC31 Oct 202312 Jan 202531 Oct 2024
617hydraservicegov.comNameCheap, Inc.22 Jun 201722 Jun 201722 Jun 2018
618hydrashake.comGoDaddy.com, LLC23 Jun 201728 Sep 202427 Sep 2025
619hydrasearchdefense.comNetwork Solutions, LLC10 Jul 201711 May 202410 Jul 2025
620hydrastack.comDynadot, LLC10 Oct 202131 Aug 202410 Oct 2025
621hydrasearchrecreational.comNetwork Solutions, LLC10 Jul 201711 May 202410 Jul 2025
622hydrasearchcommercial.comNetwork Solutions, LLC10 Jul 201711 May 202410 Jul 2025
623hydrascope.techNetwork Solutions, LLC21 Jul 201713 Nov 201921 Jul 2021
624hydrasquare.orgGoDaddy.com, LLC28 Jul 201728 Jul 201728 Jul 2018
625hydraswimwear.comP.A. Viet Nam Company Limited31 Jul 201731 Jul 201731 Jul 2018
626hydrasquare.infoGoDaddy.com, LLC28 Jul 201728 Jul 201728 Jul 2018
627hydrascents.comGoDaddy.com, LLC14 Mar 202220 Mar 202514 Mar 2026
628hydraspire.comGoogle, Inc.28 Jul 202313 Jul 202428 Jul 2025
629hydraslc.comFastDomain Inc.28 Aug 201717 Aug 202428 Aug 2025
630hydrassilkavtor.netShinjiru MSC Sdn Bhd29 Aug 201730 Aug 201729 Aug 2018
631hydrassilkavtor.comShinjiru MSC Sdn Bhd30 Aug 201730 Aug 201730 Aug 2018
632hydraseptember23.comPapaki Ltd.13 Sep 201713 Sep 201713 Sep 2018
633hydrasafetyshowers.co.uk-20 Aug 201613 Aug 201720 Aug 2018
634hydrasketch.comAmazon Registrar, Inc.21 Sep 201721 Sep 201721 Sep 2018
635hydrasuperflex.comNamesilo, LLC29 Sep 201730 Sep 201729 Sep 2018
636hydrasolutions.servicesGoDaddy.com, LLC2 Oct 20172 Oct 20172 Oct 2018
637hydrasupplies.comGoDaddy.com, LLC26 Sep 202227 Sep 202426 Sep 2026
638hydrastis.de--14 Apr 2017-
639hydrasproperties.comWebfusion Ltd.12 Oct 20175 Oct 202312 Oct 2025
640hydrashapewear.comregister.com, Inc.16 Oct 201716 Oct 201716 Oct 2018
641hydraspaiceland.comName.com, Inc.22 Oct 201722 Oct 201722 Oct 2018
642hydraserum.comTurnCommerce, Inc. DBA NameBright.com11 Jan 202023 Mar 202511 Jan 2025
643hydrasmartscan.comWebfusion Ltd.26 Oct 201726 Oct 201726 Oct 2019
644hydrasystems.ma-18 Jan 20169 May 202518 Jan 2026
645hydrastaticsales-za.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Nov 20176 Nov 20176 Nov 2018
646hydrasaber.netShanghai Meicheng Technology Information Co., Ltd21 Nov 201721 Nov 201721 Nov 2020
647hydrasaber.comShanghai Meicheng Technology Information Co., Ltd21 Nov 201721 Nov 201721 Nov 2020
648hydraskinantiaging.comNameCheap, Inc.21 Nov 201721 Nov 201721 Nov 2018
649hydrasupplements.comDROPCATCH.COM 751 LLC14 Jun 202415 Jun 202414 Jun 2025
650hydrasystempool.comNordreg AB24 Nov 201711 Nov 202424 Nov 2025
651hydrasesport.comAscio Technologies, Inc. Danmark - Filial af Ascio…23 Nov 201723 Nov 201723 Nov 2018
652hydrashop.centerNameCheap, Inc.29 Nov 201730 Nov 201729 Nov 2018
653hydrasoul.lifeGoDaddy.com, LLC11 Dec 201725 Jan 202511 Dec 2025
654hydrastakepool.comGoDaddy.com, LLC7 Jun 20197 Jun 20197 Jun 2020
655hydrasportswall.redpair Networks, Inc. d/b/a pairNIC26 Dec 2017-26 Dec 2018
656hydraschool.comRealtime Register B.V.1 Sep 20241 Sep 20241 Sep 2025
657hydraseals.co.ukHello Internet Corp.10 Jan 201110 Jan 201710 Jan 2018
658hydrascan.co.uk-30 Apr 200831 Mar 202530 Apr 2026
659hydraserv.co.uk-6 Jan 20166 Jan 20166 Jan 2018
660hydraslideuk.co.uk-14 Oct 201614 Oct 201614 Oct 2019
661hydrasync.co.uk-25 Feb 201326 Jan 202525 Feb 2026
662hydrason.co.uk-15 Oct 20101 Mar 201715 Oct 2018
663hydrassure.co.uk-16 Mar 202411 Jun 202416 Mar 2025
664hydraseeding.co.ukINTERNEXT28 Apr 200827 Apr 201728 Apr 2018
665hydrastream.co.uk-2 Jul 20122 Jul 20162 Jul 2018
666hydrastore.co.uk-3 Mar 19984 Mar 20253 Mar 2027
667hydrasplat.co.uk-18 Jun 201230 Jul 201718 Jun 2018
668hydraskincare.co.ukReserved24 Oct 200823 Oct 201624 Oct 2018
669hydraseed.co.uk-7 Jul 20167 Jul 20167 Jul 2018
670hydraseeders.co.uk-26 Apr 201210 May 201426 Apr 2019
671hydrasaw.co.uk-24 Jan 201325 Dec 201724 Jan 2019
672hydrasoft.co.uk-30 Sep 202123 Sep 202430 Sep 2025
673hydrasend.co.ukHello Internet Corp.31 Jan 201631 Jan 201731 Jan 2018
674hydraserveuk.co.uk-17 Dec 201218 Dec 202317 Dec 2027
675hydrascombatacademy.co.uk-3 Nov 202218 Oct 20233 Nov 2023
676hydrashop.co.uk-19 Oct 201020 Oct 202419 Oct 2026
677hydraservices.co.uk-11 Nov 20111 Nov 202411 Nov 2026
678hydrasit.co.uk-1 Oct 201028 Aug 20241 Oct 2025
679hydrasure.co.uk-8 May 202022 Jul 20238 May 2024
680hydrasmartscan.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…26 Oct 201726 Oct 201726 Oct 2019
681hydrasun.co.uk--25 Jul 20163 Sep 2018
682hydrasario.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…23 Feb 201516 Feb 201723 Feb 2019
683hydrasupport.co.uk-7 Oct 20097 Sep 20177 Oct 2018
684hydrasportswear.co.ukeNom, Inc.29 Jan 201630 Jan 201729 Jan 2018
685hydrasupplements.co.ukReserved22 Nov 201724 Nov 201722 Nov 2018
686hydrasolve.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…8 May 20122 May 20168 May 2018
687hydrascope.co.uk-31 Mar 200516 May 202531 Mar 2026
688hydrasafe.co.uk-29 Aug 20165 Aug 202229 Aug 2027
689hydrasystemtechnology.co.ukOne.com A/S20 Sep 201621 Aug 201720 Sep 2019
690hydrasecurityservices.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…20 Jun 201729 Sep 201720 Jun 2019
691hydrasearch.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…7 Jul 201614 Jul 20167 Jul 2018
692hydrasw.co.uk-20 Jun 200022 Jul 202420 Jun 2027
693hydrasimulations.co.uk-11 Mar 20139 Feb 202511 Mar 2027
694hydrasecuritization.comRegister.it SPA13 Jan 201813 Jan 201813 Jan 2019
695hydrasunpools.netTucows Domains Inc.12 Jan 201812 Jan 201812 Jan 2019
696hydrasecurity.netRegister.it SPA25 Jan 202128 Mar 202425 Jan 2024
697hydraseataxieleni.comPapaki Ltd.30 Jan 201831 Jan 201830 Jan 2019
698hydrast.racingNameCheap, Inc.9 Feb 20189 Feb 20189 Feb 2019
699hydrasrilankadental.comRealtime Register B.V.17 Feb 201817 Feb 201817 Feb 2019
700hydrasecurities.comTurnCommerce, Inc. DBA NameBright.com23 Jul 202117 Jul 202223 Jul 2025
701hydrastylesource.comNameCheap, Inc.22 Feb 201822 Feb 201822 Feb 2019
702hydraslimfitness.comAB NameISP23 Feb 201823 Feb 201823 Feb 2019
703hydrasuite.comGransy s.r.o. d/b/a subreg.cz2 Mar 201816 Feb 20252 Mar 2026
704hydrasmartshower.comNetwork Solutions, LLC7 Mar 20187 Mar 20187 Mar 2019
705hydrasur.comHostinger, UAB9 Mar 201810 Mar 20259 Mar 2026
706hydrasportstrainingsystem.comDynadot, LLC10 Mar 201810 Mar 201810 Mar 2019
707hydrasec.co.uk-8 Mar 20188 Mar 20188 Mar 2019
708hydrasdr.comOVH sas28 Mar 20181 Mar 202428 Mar 2025
709hydrasg.siteNameCheap, Inc.29 Mar 201829 Mar 201829 Mar 2019
710hydrasdr.netOVH sas28 Mar 201828 Mar 201828 Mar 2019
711hydrasatindo.comTucows Domains Inc.4 May 20188 May 20194 May 2019
712hydrasilver.comNamesilo, LLC15 May 201816 May 201815 May 2019
713hydraser.comNameCheap, Inc.25 May 201825 May 201825 May 2019
714hydrasex.reviewNameCheap, Inc.4 Jun 20184 Jun 20184 Jun 2019
715hydrasecret.comGoDaddy.com, LLC5 Jun 20185 Jun 20185 Jun 2020
716hydrasecrets.comGoDaddy.com, LLC5 Jun 20185 Jun 20185 Jun 2020
717hydrasparkling.comTurnCommerce, Inc. DBA NameBright.com11 Jun 201811 Jun 201811 Jun 2019
718hydraspin.netGoDaddy.com, LLC14 Jun 201826 Aug 202414 Jun 2024
719hydrasecurities.netGoDaddy.com, LLC18 Jun 201818 Jun 201818 Jun 2019
720hydrashop.infoNamesilo, LLC23 Dec 202023 Dec 202023 Dec 2021
721hydras2web.comDomain Original, LLC12 Sep 202226 Nov 202312 Sep 2023
722hydrashop.bizPDR Ltd. d/b/a PublicDomainRegistry.com26 Nov 202026 Nov 202026 Nov 2021
723hydrasilox.comFastDomain Inc.28 Jun 201813 Jun 202428 Jun 2025
724hydrasolperu.comNameCheap, Inc.9 Jul 20189 Jul 20189 Jul 2019
725hydraseataxi-agiosfanourios.comPapaki Ltd.19 Apr 202422 Apr 202519 Apr 2026
726hydrasrv.comGoDaddy.com, LLC16 Jul 201827 Aug 202416 Jul 2024
727hydrasmart-g.comDynadot, LLC20 Jul 201820 Jul 201820 Jul 2019
728hydraservice.proPorkbun, LLC7 Feb 202512 Feb 20257 Feb 2026
729hydrasp.worldNamesilo, LLC22 Jul 201822 Jul 201822 Jul 2019
730hydraskzxpnew4af.comGuangDong NaiSiNiKe Information Technology Co Ltd.23 Jul 201823 Jul 201823 Jul 2021
731hydras-onion.comChengdu West Dimension Digital Technology Co., Ltd…9 Oct 202216 Dec 20239 Oct 2023
732hydrasdzxpnew4af.comGuangDong NaiSiNiKe Information Technology Co Ltd.23 Jul 201823 Jul 201823 Jul 2019
733hydrasizxpnew4af.comBeijing Lanhai Jiye Technology Co., Ltd15 Jan 202410 Apr 202515 Jan 2026
734hydrasynergy.comHosting Concepts B.V. dba Openprovider23 Nov 202125 Nov 202123 Nov 2022
735hydrasolutions.ca-2 May 20121 May 20172 May 2022
736hydraseries.comGoogle, Inc.14 Dec 202114 Dec 202114 Dec 2022
737hydraskin.netGoDaddy.com, LLC31 Jul 201811 Oct 202431 Jul 2024
738hydraspray.netGoDaddy.com, LLC31 Jul 201811 Oct 202431 Jul 2024
739hydrasmoke.netGoDaddy.com, LLC31 Jul 201811 Oct 202431 Jul 2024
740hydrasdominion.comGoDaddy.com, LLC6 Aug 20186 Aug 20186 Aug 2019
741hydrasuperadmin.comeNom, Inc.9 Aug 20189 Aug 20189 Aug 2019
742hydrastool.comFastDomain Inc.15 Aug 201820 Sep 202415 Aug 2025
743hydraship.infoGoDaddy.com, LLC17 Aug 201817 Aug 201817 Aug 2019
744hydraship.comGoDaddy.com, LLC17 Aug 201812 Aug 202417 Aug 2026
745hydraship.netGoDaddy.com, LLC17 Aug 201817 Aug 201817 Aug 2019
746hydrasec.siteGoDaddy.com, LLC26 Aug 201826 Aug 201826 Aug 2019
747hydraseosd.comHiChina Zhicheng Technology Limited3 Sep 20183 Sep 20183 Sep 2019
748hydraseoly.comHiChina Zhicheng Technology Limited3 Sep 20183 Sep 20183 Sep 2019
749hydrasolucoes.comHostinger, UAB19 Jan 202420 Jan 202519 Jan 2026
750hydrasunrigworld.comTucows Domains Inc.24 Nov 20234 Dec 202424 Nov 2025
751hydraspare.comGandi SAS24 Sep 201824 Sep 201824 Sep 2019
752hydraspark.comDynadot, LLC10 Apr 20238 Apr 202510 Apr 2026
753hydrastonepdm.comGoDaddy.com, LLC4 Oct 20184 Oct 20184 Oct 2019
754hydrashields.comGoDaddy.com, LLC5 Oct 201817 Dec 20245 Oct 2024
755hydrasocialmediamarketing.comGoogle, Inc.9 Oct 20189 Oct 20189 Oct 2019
756hydraswimclub.comKey-Systems GmbH19 Sep 20221 Nov 202319 Sep 2023
757hydraswimtech.comGoDaddy.com, LLC12 Oct 201812 Oct 201812 Oct 2020
758hydrasana.comHosting Concepts B.V. dba Openprovider15 Oct 201830 Sep 202415 Oct 2025
759hydraspinus.comGoDaddy.com, LLC17 Oct 201829 Dec 202417 Oct 2024
760hydraspinusa.comGoDaddy.com, LLC17 Oct 201829 Dec 202417 Oct 2024
761hydrasecuritypa.comGoDaddy.com, LLC9 Feb 20219 Feb 20219 Feb 2023
762hydrastuff.comSharkweek Domains LLC3 Jan 20223 Jan 20223 Jan 2023
763hydrascapestickers.comGoDaddy.com, LLC31 Oct 201815 Oct 202231 Oct 2025
764hydrasoothe.com1&1 Internet AG20 Oct 202420 Oct 202420 Oct 2025
765hydrasns.clubNameCheap, Inc.5 Nov 20185 Nov 20185 Nov 2019
766hydrashop.netTucows Domains Inc.7 Jan 202319 Mar 20247 Jan 2024
767hydrasac.comGoDaddy.com, LLC15 Nov 202315 Nov 202315 Nov 2026
768hydrasightseeing.comPapaki Ltd.9 Nov 20181 Nov 20249 Nov 2025
769hydrasell.comregister.com, Inc.27 Jan 202227 Jan 202227 Jan 2023
770hydrasoulaffiliate.comGoDaddy.com, LLC12 Nov 201812 Nov 201812 Nov 2020
771hydrascientific.comGoDaddy.com, LLC3 Apr 20243 Apr 20243 Apr 2027
772hydrasurvival.comNameCheap, Inc.22 Nov 201822 Nov 201822 Nov 2019
773hydrasbadmusictakes.comenom385, Incorporated13 Feb 202429 Mar 202513 Feb 2025
774hydraspot.comDynadot, LLC20 Feb 20215 Feb 202520 Feb 2026
775hydrasticfantastic.comNetwork Solutions, LLC26 Nov 201826 Nov 201826 Nov 2020
776hydrasun.infoWild West Domains, LLC27 Nov 201827 Nov 201827 Nov 2019
777hydrasalt.comGoDaddy.com, LLC6 Dec 201814 Jan 20256 Dec 2025
778hydraseq.comPSI-USA, Inc. dba Domain Robot19 Mar 20258 May 202519 Mar 2026
779hydraspeed24.comGuangDong NaiSiNiKe Information Technology Co Ltd.19 Dec 201819 Dec 201819 Dec 2019
780hydraslim.neteNom, Inc.20 Dec 201820 Dec 201820 Dec 2019
781hydrasecuritiesdmcc.comNetwork Solutions, LLC3 Jan 20193 Jan 20193 Jan 2020
782hydrashops.infoLimited Liability Company "Registrar of domain nam…6 Jan 20196 Jan 20196 Jan 2020
783hydrasrilanka.comGoDaddy.com, LLC5 Jan 20195 Jan 20195 Jan 2020
784hydrasdenexotics.comeNom, Inc.11 Jan 201911 Jan 201911 Jan 2020
785hydrasden.comHangzhou AiMing Network Co., LTD31 Mar 202031 Mar 202031 Mar 2021
786hydrastick.infoGoDaddy.com, LLC25 Jan 201926 Jan 202025 Jan 2021
787hydrastick.comGoDaddy.com, LLC25 Jan 201927 Jan 202525 Jan 2026
788hydrastik.comTurnCommerce, Inc. DBA NameBright.com3 Dec 202227 Nov 20233 Dec 2025
789hydrastik.infoGoDaddy.com, LLC25 Jan 201926 Jan 202025 Jan 2021
790hydrastik.netGoDaddy.com, LLC25 Jan 201925 Jan 201925 Jan 2020
791hydrastick.netKey-Systems GmbH5 Dec 202217 Feb 20245 Dec 2023
792hydrastreamer.comGoogle, Inc.29 Jan 201929 Jan 201929 Jan 2020
793hydrasv.comDomain.com, LLC30 Jan 201910 Jan 202530 Jan 2026
794hydrascript.comName.com, Inc.23 Oct 20225 Jan 202523 Oct 2024
795hydraseduction.comGoDaddy.com, LLC6 Feb 20196 Feb 20196 Feb 2020
796hydrasponics.comGoDaddy.com, LLC12 Feb 201912 Feb 201912 Feb 2020
797hydrasos.comNameCheap, Inc.15 Feb 201916 Jan 202515 Feb 2026
798hydraspinusafraud.comGoDaddy.com, LLC22 Feb 201922 Feb 201922 Feb 2020
799hydraserene.comGoDaddy.com, LLC18 Nov 202118 Nov 202418 Nov 2025
800hydrashops.comTucows Domains Inc.14 Aug 202420 Mar 202514 Aug 2025
801hydrasupplyco.comGoogle, Inc.12 Mar 201926 Feb 202512 Mar 2026
802hydrastaff2k19c.comDynadot, LLC8 Jun 202117 Aug 20238 Jun 2023
803hydrastaff2019.comNamePal.com #802329 May 202129 May 202129 May 2022
804hydrastaff2k19.comGuangDong NaiSiNiKe Information Technology Co Ltd.14 Mar 201914 Mar 201914 Mar 2020
805hydrastaff-2k19.comGuangDong NaiSiNiKe Information Technology Co Ltd.14 Mar 201914 Mar 201914 Mar 2020
806hydrastaff-2019.comGuangDong NaiSiNiKe Information Technology Co Ltd.14 Mar 201914 Mar 201914 Mar 2020
807hydrastaff2k19n.comGuangDong NaiSiNiKe Information Technology Co Ltd.14 Mar 201914 Mar 201914 Mar 2020
808hydrastaff2k19q.comGuangDong NaiSiNiKe Information Technology Co Ltd.14 Mar 201914 Mar 201914 Mar 2020
809hydrastaff2k19r.comGuangDong NaiSiNiKe Information Technology Co Ltd.14 Mar 201914 Mar 201914 Mar 2020
810hydrastaff2k19t.comGuangDong NaiSiNiKe Information Technology Co Ltd.14 Mar 201914 Mar 201914 Mar 2020
811hydraserver1.comTucows Domains Inc.14 Mar 201918 Mar 202014 Mar 2020
812hydrastaff2k19y.comGuangDong NaiSiNiKe Information Technology Co Ltd.14 Mar 201914 Mar 201914 Mar 2020
813hydrastar.infoGoDaddy.com, LLC17 Mar 201918 Mar 201917 Mar 2020
814hydrasystemperu.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Mar 201924 Mar 202523 Mar 2026
815hydrasurf.icuLimited Liability Company "Registrar of domain nam…30 Mar 201930 Mar 201930 Mar 2020
816hydrasplash.comNameCheap, Inc.5 Sep 20216 Aug 20245 Sep 2025
817hydrashieldwater.comregister.com, Inc.16 Apr 201916 Apr 201916 Apr 2020
818hydrastaff.comTurnCommerce, Inc. DBA NameBright.com4 Jul 202128 Jun 20224 Jul 2025
819hydrastaff24.comGuangDong NaiSiNiKe Information Technology Co Ltd.19 Apr 201919 Apr 201919 Apr 2020
820hydrastate.groupAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…20 Apr 201920 Apr 201920 Apr 2020
821hydraseltz.comGoDaddy.com, LLC25 Apr 201910 May 202525 Apr 2026
822hydrasqueen.comHiChina Zhicheng Technology Limited30 Apr 201930 Apr 201930 Apr 2020
823hydrastore.bizPorkbun, LLC4 May 20194 May 20194 May 2020
824hydrashop.proNameCheap, Inc.8 May 20198 May 20208 May 2021
825hydrasport.clubGoogle, Inc.12 May 20193 May 202512 May 2026
826hydrasruzxpnew4afn.comPDR Ltd. d/b/a PublicDomainRegistry.com16 May 201916 May 201916 May 2020
827hydrasruzxpnew4afns.comPDR Ltd. d/b/a PublicDomainRegistry.com18 May 201918 May 201918 May 2020
828hydrastates.comHiChina Zhicheng Technology Limited17 May 201917 May 201917 May 2020
829hydraspanj.comeNom, Inc.22 May 201923 May 202522 May 2025
830hydrastepp.comGoDaddy.com, LLC25 May 20199 May 202525 May 2026
831hydrasruzxpnew4af.comPDR Ltd. d/b/a PublicDomainRegistry.com24 May 201924 May 201924 May 2020
832hydrasurgesolutions.comGoDaddy.com, LLC28 May 201928 May 201928 May 2020
833hydrasportsprotection.comGoDaddy.com, LLC11 Jun 201912 Jun 202411 Jun 2025
834hydrasportsnutrition.comGoDaddy.com, LLC11 Jun 201912 Jun 202411 Jun 2025
835hydraseedvault.comNetwork Solutions, LLC14 Jun 20195 Jun 202414 Jun 2026
836hydrasynth.comGoDaddy.com, LLC18 Jun 201919 Jun 202318 Jun 2025
837hydrasanus.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Jun 201917 Jun 201917 Jun 2020
838hydrasl.comEuroDNS S.A.26 Jun 20196 Jun 202325 Jun 2025
839hydraslahir.comLaunchpad, Inc.27 Jun 201927 Jun 201927 Jun 2020
840hydrashieldtech.comAmazon Registrar, Inc.27 Jun 20196 Feb 202527 Jun 2025
841hydrashieldprotection.comAmazon Registrar, Inc.27 Jun 20196 Feb 202527 Jun 2025
842hydrashieldtextile.comAmazon Registrar, Inc.27 Jun 20196 Feb 202527 Jun 2025
843hydrasobby.comCloud Yuqu LLC21 Sep 202021 Sep 202021 Sep 2021
844hydrasait.comNamePal.com #802824 Sep 202024 Sep 202024 Sep 2021
845hydraswell.comNetwork Solutions, LLC24 Mar 20222 Mar 202424 Mar 2032
846hydrasolutionsgroup.comGoDaddy.com, LLC19 Jul 201919 Jul 201919 Jul 2020
847hydrasmoothing.comGoDaddy.com, LLC31 Jul 201931 Jul 201931 Jul 2020
848hydrasmoothingsystem.comGoDaddy.com, LLC31 Jul 201931 Jul 201931 Jul 2020
849hydrashouse.comNetwork Solutions, LLC1 Aug 20191 Aug 20191 Aug 2022
850hydraspout.comTucows Domains Inc.28 Mar 20231 Apr 202428 Mar 2025
851hydrasmoothe.comGoDaddy.com, LLC1 Aug 20191 Aug 20191 Aug 2020
852hydrasuppliers.comGoogle, Inc.5 Aug 20195 Aug 20195 Aug 2020
853hydrasayt.comNameCheap, Inc.2 Jan 20252 Jan 20252 Jan 2026
854hydrasajt.comWeb Commerce Communications Limited dba WebNic.cc7 Nov 20247 Nov 20247 Nov 2025
855hydrasportsscience.comGoDaddy.com, LLC27 Aug 201928 Aug 202427 Aug 2025
856hydrasportscience.comGoDaddy.com, LLC27 Aug 201928 Aug 202427 Aug 2025
857hydraspecproduction.comDomeneshop AS dba domainnameshop.com29 Aug 201911 May 202529 Aug 2025
858hydrasait.bizNICENIC INTERNATIONAL GROUP CO., LIMITED27 Aug 201927 Aug 201927 Aug 2020
859hydrasoft.bizUdomainName.com LLC11 Nov 202111 Nov 202111 Nov 2022
860hydrasultimate.comregister.com, Inc.6 Sep 201924 Aug 20236 Sep 2025
861hydrasruby.comeNom, Inc.8 Sep 20198 Sep 20198 Sep 2021
862hydrasemerald.comeNom, Inc.8 Sep 20198 Sep 20198 Sep 2021
863hydraslut.comGoDaddy.com, LLC23 Sep 201923 Sep 201923 Sep 2020
864hydraskinmt.comTucows Domains Inc.24 Sep 201928 Sep 202124 Sep 2021
865hydrasmp.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Jun 202210 Aug 202329 Jun 2023
866hydrashaker.comTucows Domains Inc.4 Apr 20248 Apr 20254 Apr 2026
867hydrashold.comHiChina Zhicheng Technology Limited4 Oct 20194 Oct 20194 Oct 2020
868hydrasurge.comGoDaddy.com, LLC18 Dec 202319 Dec 202418 Dec 2025
869hydraseguridadprivada.comGoDaddy.com, LLC7 Oct 201921 Oct 20247 Oct 2025
870hydrashack.walesMesh Digital Limited9 Oct 20199 Oct 20199 Oct 2020
871hydraspec-production.comDomeneshop AS dba domainnameshop.com9 Oct 201917 Sep 20249 Oct 2025
872hydrasweeps.comGoDaddy.com, LLC14 Oct 201925 Oct 202414 Oct 2025
873hydrashred.comTucows Domains Inc.25 Jun 20235 Aug 202425 Jun 2024
874hydrasmma.comOnlineNIC, Inc.18 Oct 201918 Oct 201918 Oct 2020
875hydraskinglow.comGoDaddy.com, LLC29 Oct 201929 Oct 201929 Oct 2020
876hydrastoicism.comGoDaddy.com, LLC20 Nov 201920 Nov 201920 Nov 2020
877hydrastoic.comGoDaddy.com, LLC20 Nov 201920 Nov 201920 Nov 2020
878hydrasec.clubGoDaddy.com, LLC11 Dec 201911 Dec 201911 Dec 2020
879hydrasocks.comGoDaddy.com, LLC12 Dec 201913 Dec 202312 Dec 2025
880hydrasx.comGuangDong NaiSiNiKe Information Technology Co Ltd.12 Dec 201912 Dec 201912 Dec 2020
881hydrasoftsocks.comGoDaddy.com, LLC12 Dec 201913 Dec 202312 Dec 2025
882hydrasplsh.comGoDaddy.com, LLC17 Dec 201917 Dec 201917 Dec 2020
883hydraspacetime.comGuangDong NaiSiNiKe Information Technology Co Ltd.16 Dec 201916 Dec 201916 Dec 2020
884hydrasatoshi.comGuangDong NaiSiNiKe Information Technology Co Ltd.18 Dec 201918 Dec 201918 Dec 2020
885hydrasunshine.comGuangDong NaiSiNiKe Information Technology Co Ltd.18 Dec 201918 Dec 201918 Dec 2020
886hydrashop4af.comGuangDong NaiSiNiKe Information Technology Co Ltd.17 Dec 201917 Dec 201917 Dec 2020
887hydrassylka.comGuangDong NaiSiNiKe Information Technology Co Ltd.18 Dec 201918 Dec 201918 Dec 2020
888hydrascrape.comDynadot, LLC21 Dec 201921 Dec 201921 Dec 2020
889hydrasta.comGuangDong NaiSiNiKe Information Technology Co Ltd.21 Dec 201921 Dec 201921 Dec 2020
890hydras4us.comGuangDong NaiSiNiKe Information Technology Co Ltd.29 Dec 201929 Dec 201929 Dec 2020
891hydrastole.comGuangDong NaiSiNiKe Information Technology Co Ltd.29 Dec 201929 Dec 201929 Dec 2020
892hydras4you.comGuangDong NaiSiNiKe Information Technology Co Ltd.29 Dec 201929 Dec 201929 Dec 2020
893hydrasajtmagazin.comGuangDong NaiSiNiKe Information Technology Co Ltd.29 Dec 201929 Dec 201929 Dec 2020
894hydrastudy.comGoDaddy.com, LLC9 Jan 202028 Jan 20259 Jan 2026
895hydrasconnect.comHostinger, UAB10 Jan 202010 Jan 202010 Jan 2021
896hydraserveis.comArsys Internet, S.L. dba NICLINE.COM13 Jan 202012 Feb 202513 Jan 2025
897hydraspice.comInternet Domain Services BS Corp13 Jan 202014 Jan 202513 Jan 2026
898hydrasmoove.comGoDaddy.com, LLC13 Jan 202013 Jan 202013 Jan 2021
899hydraseeds.comGoDaddy.com, LLC14 Jan 20205 Feb 202514 Jan 2026
900hydrashydros.comNameCheap, Inc.19 Jan 2020-19 Jan 2021
901hydrashydro.comNameCheap, Inc.19 Jan 2020-19 Jan 2021
902hydrasfera.comNeubox Internet S.A. de C.V.22 Jan 202022 Jan 202022 Jan 2022
903hydrasok.comGoDaddy.com, LLC25 Jan 20208 Mar 202525 Jan 2025
904hydraspo.comOnlineNIC, Inc.28 Jan 202028 Jan 202028 Jan 2021
905hydrasunparcom.com1API GmbH3 Feb 202018 Apr 20253 Feb 2025
906hydrasmoothout.comGoDaddy.com, LLC6 Feb 20206 Feb 20206 Feb 2021
907hydrasparehydraulics.comTucows Domains Inc.10 Feb 202014 Feb 202110 Feb 2021
908hydrasails.comHosting Concepts B.V. dba Openprovider17 Feb 202017 Feb 202017 Feb 2021
909hydrassilka.comNamePal.com #80286 May 20216 May 20216 May 2022
910hydrasilkout.comGoDaddy.com, LLC7 May 20207 May 20207 May 2021
911hydraslimplus.comGoDaddy.com, LLC27 Feb 202027 Feb 202027 Feb 2021
912hydrasilkpro.comGoDaddy.com, LLC27 Feb 20201 Mar 202527 Feb 2026
913hydrasek.comCSC Corporate Domains, Inc.27 Feb 202023 Feb 202527 Feb 2026
914hydrasysllc.comGMO Internet Inc.23 Mar 20233 May 202423 Mar 2024
915hydrasharding.comGoDaddy.com, LLC11 Mar 202023 May 202511 Mar 2025
916hydrasroblox.comChengdu West Dimension Digital Technology Co., Ltd…18 Mar 202018 Mar 202018 Mar 2021
917hydrassylka.netGuangDong NaiSiNiKe Information Technology Co Ltd.20 Mar 202020 Mar 202020 Mar 2021
918hydrasani.comGoDaddy.com, LLC30 Mar 202030 Mar 202030 Mar 2022
919hydrashun.comGoogle, Inc.7 Apr 20207 Apr 20207 Apr 2021
920hydrasms.comNamesilo, LLC11 Apr 202012 Apr 202011 Apr 2021
921hydrashop24.comZigZagNames.com LLC3 Jul 202316 Sep 20243 Jul 2024
922hydraservers.infoKey-Systems GmbH24 Apr 202024 Apr 202524 Apr 2026
923hydraskinco.comGoDaddy.com, LLC5 Apr 20255 Apr 20255 Apr 2026
924hydrasmm.comHostinger, UAB4 Apr 20244 Jun 20244 Apr 2026
925hydrasistemas.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…27 Jul 202212 Aug 202327 Jul 2023
926hydrasilkhair.comGoDaddy.com, LLC7 May 20208 May 20257 May 2026
927hydrasigma.comNameCheap, Inc.7 May 20207 Apr 20247 May 2025
928hydrasforce.comWild West Domains, LLC15 May 202015 May 202015 May 2021
929hydraswage.comWebfusion Ltd.18 May 202019 May 202518 May 2026
930hydrasportboatsforsale.comGoDaddy.com, LLC20 May 20201 Aug 202320 May 2023
931hydrasol.netHostinger, UAB28 Mar 202410 May 202528 Mar 2025
932hydrasproducts.comGoogle, Inc.29 May 202030 May 202329 May 2024
933hydrastats.comXin Net Technology Corporation23 Aug 202323 Oct 202423 Aug 2024
934hydrasciencefoundation.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Jun 20204 Jun 20204 Jun 2021
935hydraskinskincare.comTucows Domains Inc.4 Jan 202316 Mar 20244 Jan 2024
936hydrashead.netCloudFlare, Inc.8 Jun 202027 Jun 20238 Jun 2026
937hydrastrip.comGoDaddy.com, LLC23 May 202523 May 202523 May 2026
938hydrashinepressurewashing.comGoDaddy.com, LLC12 Jun 202013 Jun 202412 Jun 2026
939hydrashinepw.comGoDaddy.com, LLC16 Jun 202017 Jun 202416 Jun 2025
940hydrasack.comTucows Domains Inc.29 Jun 202029 Jun 202029 Jun 2021
941hydras-products.comGoogle, Inc.29 Jun 202030 Jun 202329 Jun 2024
942hydrasnus.comAscio Technologies, Inc. Danmark - Filial af Ascio…3 Jul 20203 Jul 20203 Jul 2021
943hydrasneaker.comGoDaddy.com, LLC5 Jul 20205 Jul 20205 Jul 2021
944hydrasec.techGoDaddy.com, LLC10 Mar 202021 May 202310 Mar 2023
945hydrasisterscleaning.comGoDaddy.com, LLC8 Jul 202219 Aug 20248 Jul 2024
946hydrasoaps.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Jul 202021 Jul 202021 Jul 2021
947hydrastarbrakes.comGoDaddy.com, LLC22 Jul 202023 Jul 202422 Jul 2025
948hydrascopeentertainment.comeNom, Inc.23 Jul 20208 Jul 202423 Jul 2025
949hydraskinpr.comLaunchpad, Inc.25 Jul 202010 Jul 202425 Jul 2025
950hydrasuites.comPapaki Ltd.1 Aug 202024 Jul 20241 Aug 2025
951hydrass-burkina.comLigne Web Services SARL3 Aug 20203 Aug 20233 Aug 2025
952hydrashipping.comGoDaddy.com, LLC4 Aug 202017 Sep 20244 Aug 2025
953hydraskineffect.comDynadot, LLC29 Jul 202029 Jul 202029 Jul 2021
954hydraservicos.comGoDaddy.com, LLC5 Aug 20205 Aug 20205 Aug 2022
955hydrasport42.comGoDaddy.com, LLC5 Aug 202015 Sep 20245 Aug 2024
956hydrastaking.comDynadot, LLC27 Oct 20216 Jan 202427 Oct 2023
957hydrastoreph.comTucows Domains Inc.9 Aug 202013 Aug 20219 Aug 2021
958hydraskinclinic.comTucows Domains Inc.18 Aug 202017 Aug 202418 Aug 2025
959hydrastorequoting.comName.com, Inc.18 Aug 202018 Aug 202018 Aug 2021
960hydrasgames.netOVH sas17 Aug 202017 Aug 202017 Aug 2021
961hydrasunnigfms.comNamesilo, LLC2 Sep 20203 Sep 20202 Sep 2021
962hydrashop.spaceLiquidNet Ltd.22 Jan 20206 Feb 202022 Jan 2021
963hydrascape.onlineHostinger, UAB17 Apr 20205 May 202017 Apr 2021
964hydrastro.comTucows Domains Inc.31 Jan 202331 Jan 202331 Jan 2024
965hydrastro.netEpik Inc.7 Sep 20207 Sep 20207 Sep 2021
966hydraseatcatcher.comTucows Domains Inc.15 Sep 202015 Sep 202015 Sep 2021
967hydrastudiosllc.comGoDaddy.com, LLC22 Sep 20203 Dec 202322 Sep 2023
968hydrasait.onlineNICENIC INTERNATIONAL GROUP CO., LIMITED24 Sep 202024 Sep 202024 Sep 2021
969hydrasearchdefense.infoEpik Inc.25 Sep 202025 Sep 202025 Sep 2021
970hydrasite.storeNamesilo, LLC31 Dec 202031 Dec 202031 Dec 2021
971hydraspecma.comCSC Corporate Domains, Inc.6 Feb 20172 Feb 20256 Feb 2026
972hydrashop.onlineGoDaddy.com, LLC12 Jan 2023-12 Jan 2024
973hydrasgames.networkGoogle, Inc.1 Oct 20201 Oct 20201 Oct 2021
974hydrascopeengineering.com-5 Oct 20207 Sep 20245 Oct 2025
975hydrastine.spacePDR Ltd. d/b/a PublicDomainRegistry.com6 Oct 20206 Oct 20206 Oct 2021
976hydrasalesgroup.comWild West Domains, LLC8 Oct 20209 Oct 20248 Oct 2026
977hydraspeed.storeTucows Domains Inc.7 Oct 201911 Oct 20207 Oct 2021
978hydraskinrefiner.comTucows Domains Inc.24 Nov 202324 Nov 202324 Nov 2024
979hydrasmile.comGoDaddy.com, LLC10 May 202211 May 202510 May 2026
980hydrastore-sa.comTucows Domains Inc.26 May 20236 Aug 202426 May 2024
981hydrasajt24.comRally Cry Domains, LLC9 Jan 20238 Feb 20249 Jan 2025
982hydraswim.clubRegional Network Information Center, JSC dba RU-CE…27 Oct 202027 Oct 202027 Oct 2021
983hydrastx.comDynadot, LLC5 Nov 20205 Nov 20205 Nov 2021
984hydrasajt24online.comGuangDong NaiSiNiKe Information Technology Co Ltd.8 Nov 20208 Nov 20208 Nov 2021
985hydrasft.comLaunchpad, Inc.16 Nov 202016 Nov 202016 Nov 2021
986hydrascubomarket.spaceBeget LLC25 Nov 202025 Nov 202025 Nov 2021
987hydrasilvershop.xyzHostinger, UAB29 Nov 202029 Nov 202029 Nov 2021
988hydrasilvershop.onlineHostinger, UAB29 Nov 202029 Nov 202029 Nov 2021
989hydrashare.onlineregister.com, Inc.5 Dec 20205 Dec 20205 Dec 2021
990hydrasoapworks.comDomain.com, LLC4 Dec 202019 Nov 20244 Dec 2025
991hydrasoftco.comCSL Computer Service Langenbach GmbH d/b/a joker.c…6 Dec 20206 Dec 20206 Dec 2021
992hydrasail.comHetzner Online AG7 Dec 20207 Feb 20257 Dec 2025
993hydrasocket.comUdamain.com LLC21 Feb 20236 May 202421 Feb 2024
994hydrashow.xyzNameCheap, Inc.12 Dec 202012 Dec 202012 Dec 2021
995hydrasteeth.artGoDaddy.com, LLC12 Dec 20209 Jun 202412 Dec 2025
996hydrashop.siteLimited Liability Company "Registrar of domain nam…11 Jul 202016 Jul 202011 Jul 2021
997hydrashop24.siteGMO Internet Inc.23 Mar 20235 May 202423 Mar 2024
998hydrasale.siteLimited Liability Company "Registrar of domain nam…28 Dec 20192 Jan 202028 Dec 2020
999hydrasciencefoundation.sitePDR Ltd. d/b/a PublicDomainRegistry.com4 Jun 202027 Jul 20204 Jun 2021
1000hydrashed.comGoDaddy.com, LLC20 Dec 202020 Dec 202020 Dec 2021

Displaying 1,000 out of 1,770 domains starting with the keyword "HYDRAS". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=hydras

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now