Our database now contains whois records of 672 Million (672,821,864) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1595 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [672 Million Domains] $10,000 Details

Keyword: HOUSECLEANINGSERVICE

Reverse Whois » KEYWORD [housecleaningservice ]  { 898 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1housecleaningservice.orgDynadot, LLC6 Oct 202425 Nov 20256 Oct 2026
2housecleaningservice.bizGoDaddy.com, LLC26 Nov 200719 Jul 201725 Nov 2017
3housecleaningservice.comGoDaddy.com, LLC12 Jun 20026 Jul 202512 Jun 2026
4housecleaningservice.infoGoDaddy.com, LLC22 Aug 20233 Oct 202422 Aug 2024
5housecleaningservice.netGoDaddy.com, LLC29 Dec 20059 Dec 202529 Dec 2026
6housecleaningservice.spaceDOTSERVE INC.15 Dec 202216 Dec 202315 Dec 2024
7housecleaningservice.co.uk-21 Nov 20213 Dec 202521 Nov 2026
8housecleaningservice.proGoDaddy.com, LLC8 Jan 20268 Jan 20268 Jan 2028
9housecleaningservice.nycGoDaddy.com, LLC6 Mar 202017 Apr 20256 Mar 2025
10housecleaningservice.siteHosting Concepts B.V. dba Openprovider19 Jul 202522 Aug 202519 Jul 2026
11housecleaningservice.onlineGoDaddy.com, LLC5 Jan 202511 Jan 20265 Jan 2027
12housecleaningservice.todayGoDaddy.com, LLC10 Dec 202420 Feb 202610 Dec 2025
13housecleaningservice.xyzNameCheap, Inc.16 Dec 20251 Jan 202616 Dec 2026
14housecleaningservice.clubGoDaddy.com, LLC23 Jun 20224 Aug 202323 Jun 2023
15housecleaningservice.asiaGoDaddy.com, LLC30 Jan 202312 Mar 202430 Jan 2024
16housecleaningservice.funGoDaddy.com, LLC29 Jan 202311 Mar 202429 Jan 2024
17housecleaningservice.servicesGoDaddy.com, LLC29 Jan 202311 Mar 202429 Jan 2024
18housecleaningservice.websiteGoDaddy.com, LLC29 Jan 202311 Mar 202429 Jan 2024
19housecleaningservice.companyGoogle, Inc.12 Dec 202112 Dec 202312 Dec 2024
20housecleaningservice.ltdGoDaddy.com, LLC10 May 202321 Jul 202410 May 2024
21housecleaningservice.socialGoDaddy.com, LLC16 May 202327 Jun 202416 May 2024
22housecleaningservice.lifeGoDaddy.com, LLC16 May 202327 Jun 202416 May 2024
23housecleaningservice.uk-4 Jun 20234 Jun 20234 Jun 2024
24housecleaningservice.liveGoDaddy.com, LLC8 Aug 202319 Sep 20248 Aug 2024
25housecleaningservice.collegeGoDaddy.com, LLC16 Aug 202327 Sep 202416 Aug 2024
26housecleaningservice.solutionsGoDaddy.com, LLC16 Aug 202327 Sep 202416 Aug 2024
27housecleaningservice.fyiGoDaddy.com, LLC16 Aug 202327 Sep 202416 Aug 2024
28housecleaningservice.monsterGoDaddy.com, LLC11 Sep 202322 Nov 202411 Sep 2024
29housecleaningservice.loveGMO Internet Inc.5 May 20245 May 20255 May 2026
30housecleaningservice.agencyGoDaddy.com, LLC5 Sep 202417 Sep 20255 Sep 2026
31housecleaningservice.clickDynadot, LLC29 Oct 20244 Nov 202529 Oct 2026
32housecleaningservice.linkPDR Ltd. d/b/a PublicDomainRegistry.com10 Dec 202410 Dec 202510 Dec 2026
33housecleaningservice.store-13 Dec 202414 Dec 202513 Dec 2026
34housecleaningservice.workGoogle, Inc.28 Jul 202526 Sep 202528 Jul 2026
35housecleaningservice.usNameCheap, Inc.13 Jan 202618 Jan 202613 Jan 2027
36housecleaningservices1.comWild West Domains, LLC2 Jun 20143 Jun 20152 Jun 2016
37housecleaningservices.infoGoogle, Inc.24 Aug 202529 Aug 202524 Aug 2026
38housecleaningservices.xyzDynadot, LLC5 Feb 20256 Feb 20265 Feb 2027
39housecleaningservicestustin.comeNom, Inc.5 Nov 20145 Nov 20145 Nov 2015
40housecleaningservicesarasota.comGoogle, Inc.28 Feb 202113 Feb 202528 Feb 2026
41housecleaningservicesswap.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Aug 201412 Sep 20148 Aug 2015
42housecleaningserviceokemos.infoGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
43housecleaningservicemason.infoGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
44housecleaningservicesanfrancisco.comGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
45housecleaningservicescalifornia.comInternet.bs Corp.4 Sep 20144 Sep 20144 Sep 2015
46housecleaningservicemiami.comNameCheap, Inc.29 May 202229 Apr 202529 May 2026
47housecleaningservicesbroomfield.comGoDaddy.com, LLC23 Sep 201415 Sep 201623 Sep 2017
48housecleaningservicesboulder.comGoDaddy.com, LLC23 Sep 201415 Sep 201623 Sep 2017
49housecleaningservicescroftonmd.comeNom, Inc.6 Oct 20146 Oct 20146 Oct 2015
50housecleaningservicejacksonville.comGoDaddy.com, LLC7 Oct 20145 Oct 20187 Oct 2019
51housecleaningservicesny.comFastDomain Inc.22 Nov 201422 Nov 201622 Nov 2017
52housecleaningserviceaustintx.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Jan 202520 Jan 202620 Jan 2026
53housecleaningservicesnc.comNetwork Solutions, LLC25 Sep 201425 Sep 201425 Sep 2015
54housecleaningservicesscottsdaleaz.comeNom, Inc.25 Nov 201425 Nov 201425 Nov 2015
55housecleaningservicesdurhamnc.comeNom, Inc.25 Nov 201425 Nov 201425 Nov 2015
56housecleaningservicescarync.comGoDaddy.com, LLC26 Jul 202427 Jun 202526 Jul 2026
57housecleaningservicesnashville.comGoDaddy.com, LLC6 Sep 20256 Sep 20256 Sep 2026
58housecleaningservicesbridgeport.netName.com, Inc.18 Dec 201418 Dec 201418 Dec 2015
59housecleaningservicesinbangalore.comWild West Domains, LLC26 Apr 202125 Apr 202526 Apr 2026
60housecleaningservicesbloomfield.comName.com, Inc.19 Jan 201519 Jan 201519 Jan 2016
61housecleaningservice-ct.comTucows Domains Inc.23 Jan 201427 Jan 201523 Jan 2016
62housecleaningservices9.comTLD Registrar Solutions Ltd.27 Jan 201527 Jan 201527 Jan 2016
63housecleaningservicesofsandiego.comGoDaddy.com, LLC30 Jan 201530 Jan 201530 Jan 2017
64housecleaningserviceslocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
65housecleaningservicesvancouver.comeNom, Inc.16 Feb 201516 Feb 201516 Feb 2016
66housecleaningservicenewbern.comregister.com, Inc.18 Feb 201518 Feb 201518 Feb 2016
67housecleaningservicesmarthasvineyard.comGoDaddy.com, LLC13 Mar 201513 Mar 201513 Mar 2016
68housecleaningservicesaustin.netGoDaddy.com, LLC14 Mar 201514 Mar 201514 Mar 2016
69housecleaningservicesnw.comregister.com, Inc.17 Mar 201517 Mar 201517 Mar 2016
70housecleaningservices.name----
71housecleaningservicesinconcord.comeNom, Inc.1 Sep 201513 Feb 20161 Sep 2018
72housecleaningserviceprices.comDomainsalsa.com LLC2 Feb 20213 Feb 20212 Feb 2022
73housecleaningserviceslosangeles.comWild West Domains, LLC6 Oct 20227 Oct 20256 Oct 2026
74housecleaningservicesgrandprairie.comGoDaddy.com, LLC20 Apr 201520 Apr 201520 Apr 2016
75housecleaningservicesnearme.comGoDaddy.com, LLC3 Mar 202026 Feb 20253 Mar 2026
76housecleaningservicesteam.comGoDaddy.com, LLC11 May 201522 Jun 202511 May 2025
77housecleaningservicenearme.comGoDaddy.com, LLC5 Jul 20171 Jul 20255 Jul 2026
78housecleaningservicesprices.netTucows Domains Inc.13 May 201417 May 201513 May 2016
79housecleaningservicesprices.orgTucows Domains Inc.18 May 201422 May 201518 May 2016
80housecleaningservicesdowney.comregister.com, Inc.28 May 201529 May 202528 May 2026
81housecleaningserviceirmo.comName.com, Inc.29 May 201529 May 201529 May 2016
82housecleaningservicesphoenix.comGoDaddy.com, LLC12 Jun 201512 Jun 201512 Jun 2016
83housecleaningservicesoftware.comGoDaddy.com, LLC30 Jun 201530 Jun 201530 Jun 2016
84housecleaningservicesofsantacruz.netTucows Domains Inc.20 Sep 201224 Sep 201520 Sep 2016
85housecleaningservicesofsantacruz.comTucows Domains Inc.20 Sep 201224 Sep 201520 Sep 2016
86housecleaningserviceportland.comNameCheap, Inc.28 Feb 202528 Feb 202528 Feb 2026
87housecleaningservicesinkirkland.comNamesilo, LLC24 Sep 20152 Aug 201724 Sep 2017
88housecleaningservicesportmoody.comGoDaddy.com, LLC11 Jul 201511 Jul 201511 Jul 2016
89housecleaningservicesmaine.comeNom, Inc.13 Jul 201513 Jul 201513 Jul 2016
90housecleaningservicesaintcloud.comName.com, Inc.16 Jul 201517 Jun 201716 Jul 2018
91housecleaningservicesaurora.comGoDaddy.com, LLC13 Nov 202414 Nov 202513 Nov 2026
92housecleaningservicebymaria.comWild West Domains, LLC20 Jul 201520 Jul 201520 Jul 2016
93housecleaningserviceshq.xyzNameCheap, Inc.28 Sep 201528 Sep 201528 Sep 2016
94housecleaningservicesf.comGoDaddy.com, LLC11 Aug 202123 Oct 202411 Aug 2024
95housecleaningservicest.comeNom, Inc.28 Jul 201528 Jul 201528 Jul 2016
96housecleaningservicesnj.infoNameCheap, Inc.6 Oct 20156 Oct 20156 Oct 2016
97housecleaningserviceeastlansing.usGoDaddy.com, LLC8 Oct 20158 Oct 20157 Oct 2016
98housecleaningservicesandiego.comDROPCATCH.COM 783 LLC19 Mar 201819 Mar 201819 Mar 2019
99housecleaningservicesespy.comName.com, Inc.20 Oct 201520 Oct 201520 Oct 2016
100housecleaningservicesjacksonvillefl.comeNom, Inc.23 Oct 20155 Feb 201723 Oct 2017
101housecleaningserviceantioch.comName.com, Inc.30 Oct 201530 Oct 201530 Oct 2016
102housecleaningservicesindaytonoh.comeNom, Inc.19 Nov 201519 Nov 201519 Nov 2016
103housecleaningservicescharleston.comeNom, Inc.24 Nov 201524 Nov 201524 Nov 2016
104housecleaningserviceschicago.comGoDaddy.com, LLC25 Sep 202026 Sep 202425 Sep 2026
105housecleaningservicesirving.comName.com, Inc.8 Dec 20158 Dec 20158 Dec 2016
106housecleaningservicesatl.comGoDaddy.com, LLC10 Dec 201510 Dec 201510 Dec 2017
107housecleaningserviceorangecountyca.comGoDaddy.com, LLC23 Dec 201523 Dec 201523 Dec 2016
108housecleaningservicesma.comNetwork Solutions, LLC3 Jan 20163 Jan 20163 Jan 2017
109housecleaningservicesalexandria.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Jun 201827 Jun 201827 Jun 2019
110housecleaningservicessanfrancisco.comGoDaddy.com, LLC16 Jan 201616 Jan 201616 Jan 2017
111housecleaningservicetucson.comGoDaddy.com, LLC28 Feb 20241 Feb 202528 Feb 2026
112housecleaningservicestucson.comGoogle, Inc.9 Jan 20199 Jan 20199 Jan 2020
113housecleaningservicesct.comGoDaddy.com, LLC17 Feb 201617 Feb 201617 Feb 2017
114housecleaningservicessterling.comName.com, Inc.18 Feb 201620 Jan 201718 Feb 2018
115housecleaningservicecarmen.comregister.com, Inc.5 Mar 20165 Mar 20165 Mar 2017
116housecleaningservices.siteDNSPod, Inc.28 Oct 202429 Oct 202528 Oct 2026
117housecleaningserviceonline.comregister.com, Inc.6 Apr 20166 Apr 20166 Apr 2017
118housecleaningservices123.comIn2net Network, Inc.21 Apr 201617 Apr 201721 Apr 2018
119housecleaningservicesmiami.comGoDaddy.com, LLC26 Nov 202526 Nov 202526 Nov 2026
120housecleaningservicesdenver.comGoDaddy.com, LLC1 Jul 202510 Jul 20251 Jul 2026
121housecleaningservicesseattle.comGoDaddy.com, LLC28 Aug 20229 Nov 202328 Aug 2023
122housecleaningservicesmd.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Dec 202420 Nov 202517 Dec 2026
123housecleaningservicesburbank.comeNom, Inc.30 Jun 201630 Jun 201630 Jun 2017
124housecleaningservices.bizNetwork Solutions, LLC6 May 20216 May 20216 May 2022
125housecleaningservicesanjose.comGoDaddy.com, LLC8 Nov 20258 Nov 20258 Nov 2026
126housecleaningserviceslowell.comeNom, Inc.22 Jul 20163 Sep 201722 Jul 2017
127housecleaningservicessarasota.comeNom, Inc.26 Jul 201628 Jun 201726 Jul 2018
128housecleaningservicedenver.comGoDaddy.com, LLC13 Aug 202511 Sep 202513 Aug 2026
129housecleaningservicepros.comNameCheap, Inc.6 Dec 202422 Nov 20256 Dec 2026
130housecleaningserviceslrs.com-17 Aug 201617 Aug 201617 Aug 2017
131housecleaningservicesgrandrapidsmi.comMoniker Online Services LLC18 Aug 201625 Nov 202518 Aug 2026
132housecleaningservicesatlanta.com1&1 Internet AG10 Jan 200820 Jan 202610 Jan 2027
133housecleaningservicesnyc.comGoDaddy.com, LLC11 Mar 201927 Mar 202511 Mar 2026
134housecleaningserviceashburnva.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Apr 201019 May 201722 Apr 2018
135housecleaningserviceswilmington.comGoDaddy.com, LLC28 Jan 201229 Jan 202628 Jan 2027
136housecleaningservicefortwayne.comGoDaddy.com, LLC1 Dec 20112 Dec 20251 Dec 2026
137housecleaningservicemckinney.comeNom, Inc.3 Mar 201124 Feb 20253 Mar 2026
138housecleaningservicesorangecounty.comGoDaddy.com, LLC31 Dec 201931 Dec 201931 Dec 2020
139housecleaningservicesserv.comTucows Domains Inc.21 Apr 201425 Apr 201821 Apr 2018
140housecleaningservicessingapore.comGoDaddy.com, LLC14 Dec 202014 Dec 202014 Dec 2022
141housecleaningservicestulsa.comGoDaddy.com, LLC29 Mar 201214 Apr 201529 Mar 2017
142housecleaningservicedirectory.comGoDaddy.com, LLC26 Nov 20076 Jan 202526 Nov 2024
143housecleaningservicephoenix.comNameCheap, Inc.9 May 20259 May 20259 May 2026
144housecleaningservices.comGoDaddy.com, LLC2 Oct 200112 Sep 20252 Oct 2026
145housecleaningservicenj.comGoDaddy.com, LLC28 Feb 202310 Apr 202428 Feb 2024
146housecleaningservicesineverett.comGoDaddy.com, LLC4 Apr 201211 Sep 20224 Apr 2026
147housecleaningservice4u.comGoDaddy.com, LLC14 Dec 201118 Aug 202514 Dec 2027
148housecleaningservicesintacoma.comGoDaddy.com, LLC4 Apr 201211 Sep 20224 Apr 2026
149housecleaningservicesstlouis.comGoDaddy.com, LLC17 Feb 201317 Feb 201317 Feb 2018
150housecleaningserviceslondon.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Dec 201211 Aug 201421 Dec 2016
151housecleaningservicehouston.com-20 Sep 202526 Sep 202520 Sep 2026
152housecleaningservicessandiego.comNameCheap, Inc.21 Feb 202521 Feb 202521 Feb 2026
153housecleaningservicesinsanfrancisco.comregister.com, Inc.12 Mar 201311 Feb 202512 Mar 2026
154housecleaningserviceirvine.comGoDaddy.com, LLC3 Apr 202315 May 20253 Apr 2025
155housecleaningservicesnortherncincinnati.comTucows Domains Inc.1 Nov 20115 Nov 20211 Nov 2021
156housecleaningservicesquadcities.comeNom, Inc.19 Aug 201322 Aug 201619 Aug 2016
157housecleaningservicesdubai.comCloudFlare, Inc.22 Mar 20221 May 202522 Mar 2025
158housecleaningserviceorangecounty.comGoDaddy.com, LLC18 May 20135 Aug 20161 Jan 2017
159housecleaningservicesboston.comNamesilo, LLC20 Mar 202325 May 202420 Mar 2024
160housecleaningservicecolumbusoh.comTucows Domains Inc.17 May 201121 May 201717 May 2017
161housecleaningservicescn.comGoDaddy.com, LLC15 Nov 201515 Nov 201515 Nov 2016
162housecleaningserviceherndonva.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Apr 201019 May 201722 Apr 2018
163housecleaningservicessantafe.comName.com, Inc.20 Oct 201417 Oct 201720 Oct 2018
164housecleaningserviceboston.comWild West Domains, LLC21 Jan 201421 Jan 202621 Jan 2027
165housecleaningservicebytina.comFastDomain Inc.19 Oct 200919 Oct 201719 Oct 2018
166housecleaningservicesaustin.comGoDaddy.com, LLC25 Jun 20216 Aug 202525 Jun 2026
167housecleaningserviceinriverside.comHongkong Domain Name Information Management Co., L…9 Nov 202112 Nov 20228 Nov 2022
168housecleaningserviceshouston.comGoDaddy.com, LLC31 Dec 202412 Jan 202631 Dec 2026
169housecleaningservicepittsburgh.comGoDaddy.com, LLC4 Oct 20214 Oct 20214 Oct 2022
170housecleaningserviceleesburgva.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Apr 201019 May 201722 Apr 2018
171housecleaningservicesaz.comGoDaddy.com, LLC4 Aug 201813 Oct 20224 Aug 2028
172housecleaningserviceyellowpages.comeNom, Inc.4 Jan 20083 Jan 20264 Jan 2027
173housecleaningservicesdover.comeNom, Inc.24 Oct 201225 Sep 201424 Oct 2018
174housecleaningserviceroundrock.comFastDomain Inc.1 Aug 20141 Aug 20171 Aug 2018
175housecleaningserviceseattle.comGoDaddy.com, LLC16 Oct 20085 Sep 20227 Aug 2026
176housecleaningservicesantarosa.comGKG.NET, INC.30 Oct 20132 Nov 202030 Oct 2021
177housecleaningservicesatx.comGoDaddy.com, LLC13 Jun 201213 Jun 201213 Jun 2017
178housecleaningserviceaustin.comNameCheap, Inc.9 Feb 20269 Feb 20269 Feb 2027
179housecleaningservicesinseattle.comGoDaddy.com, LLC4 Apr 201211 Sep 20224 Apr 2026
180housecleaningservicesindianapolis.comGoDaddy.com, LLC4 Dec 20115 Dec 20254 Dec 2026
181housecleaningserviceoflakeland.comTucows Domains Inc.7 Nov 201211 Nov 20207 Nov 2020
182housecleaningserviceinneworleans.comGoDaddy.com, LLC3 Jul 201213 Jul 20163 Jul 2017
183housecleaningservicesnj.comGoDaddy.com, LLC6 Feb 20196 Feb 20196 Feb 2021
184housecleaningserviceblog.comGoogle, Inc.20 Mar 201920 Mar 201920 Mar 2020
185housecleaningservicelivermore.comGoDaddy.com, LLC23 May 201424 May 202523 May 2026
186housecleaningservicesinbellevue.comGoDaddy.com, LLC4 Apr 201211 Sep 20224 Apr 2026
187housecleaningservicesfl.comDynadot, LLC24 Mar 202225 Mar 202324 Mar 2024
188housecleaningserviceinorangecounty.comSquarespace Domains LLC12 Jul 202427 Jun 202512 Jul 2026
189housecleaningservicechicago.comWild West Domains, LLC13 Sep 201614 Aug 202513 Sep 2026
190housecleaningservices.netGoDaddy.com, LLC12 Jun 201213 Jun 202512 Jun 2026
191housecleaningservicessingapore.netLaunchpad, Inc.21 Oct 201311 Oct 201621 Oct 2017
192housecleaningservices4.xyzNameCheap, Inc.7 Sep 201520 Oct 20167 Sep 2016
193housecleaningservices5.xyzNameCheap, Inc.7 Sep 201520 Oct 20167 Sep 2016
194housecleaningserviceottawa.comDomain.com, LLC25 Oct 201625 Oct 201625 Oct 2018
195housecleaningservicesottawa.comDomain.com, LLC25 Oct 201625 Oct 201625 Oct 2018
196housecleaningservices.directoryGoDaddy.com, LLC27 Oct 201611 Dec 201727 Oct 2018
197housecleaningservicesseattle.xyzPDR Ltd. d/b/a PublicDomainRegistry.com1 Jun 20161 Sep 20161 Jun 2017
198housecleaningservicesnj.neteNom, Inc.30 Nov 20163 Dec 201730 Nov 2017
199housecleaningservicesedison.comNamesilo, LLC30 Jan 201710 Feb 201830 Jan 2019
200housecleaningservicesnatick.comLaunchpad, Inc.21 Feb 201723 Apr 201721 Feb 2018
201housecleaningservicemadisonwi.comWild West Domains, LLC16 Mar 201717 Mar 202516 Mar 2026
202housecleaningservicesjc.comNetwork Solutions, LLC20 Mar 201720 Mar 201720 Mar 2018
203housecleaningservicesintheus.comNameCheap, Inc.21 Mar 201721 Mar 201721 Mar 2018
204housecleaningservicestacoma.comTucows Domains Inc.29 Mar 20172 Apr 201829 Mar 2018
205housecleaningservicespa.comDomain.com, LLC26 Apr 20179 Jun 202526 Apr 2025
206housecleaningservices.linkUniregistrar Corp11 May 201716 May 201711 May 2018
207housecleaningservicenaples.comGoDaddy.com, LLC15 May 201715 May 201715 May 2018
208housecleaningserviceswoodbridge.comName.com, Inc.26 May 201726 May 201726 May 2018
209housecleaningserviceslaramie.comName.com, Inc.16 Jun 201716 Jun 201716 Jun 2018
210housecleaningserviceszuni.comName.com, Inc.19 Jun 201719 Jun 201719 Jun 2018
211housecleaningservicesyucaipa.comName.com, Inc.13 Jul 201713 Jul 201713 Jul 2018
212housecleaningservicesprovidence.comName.com, Inc.24 Jul 201724 Jul 201724 Jul 2018
213housecleaningservicedubai.comNameCheap, Inc.27 Jul 201727 Jul 201727 Jul 2018
214housecleaningservicesrevere.comName.com, Inc.2 Aug 20172 Aug 20172 Aug 2018
215housecleaningservicesbrutus.comName.com, Inc.4 Aug 20174 Aug 20174 Aug 2018
216housecleaningservicessanjose.orgNameCheap, Inc.12 Aug 201712 Aug 201712 Aug 2018
217housecleaningservicesmorristown.comName.com, Inc.15 Aug 201715 Aug 201715 Aug 2018
218housecleaningservicessyracuse.comInternet Domain Services BS Corp18 May 202118 May 202118 May 2022
219housecleaningservicesmidland.comName.com, Inc.18 Sep 201718 Sep 201718 Sep 2018
220housecleaningservicesportland.comName.com, Inc.26 Sep 201726 Sep 201726 Sep 2018
221housecleaningservicessacramento.comName.com, Inc.27 Sep 201727 Sep 201727 Sep 2018
222housecleaningservicesloveland.comName.com, Inc.28 Sep 201728 Sep 201728 Sep 2018
223housecleaningservicesculpeper.comName.com, Inc.28 Sep 201728 Sep 201728 Sep 2018
224housecleaningserviceca.comAmazon Registrar, Inc.3 Mar 20253 Mar 20253 Mar 2026
225housecleaningservicesraleigh.comNameCheap, Inc.12 Sep 202413 Aug 202512 Sep 2026
226housecleaningserviceharvey.comMedia Elite Holdings Limited18 Aug 202018 Aug 202018 Aug 2021
227housecleaningserviceswillis.comName.com, Inc.26 Oct 201727 Sep 202526 Oct 2026
228housecleaningserviceslilburn.comName.com, Inc.1 Nov 20171 Nov 20171 Nov 2018
229housecleaningservicesmountshasta.comTucows Domains Inc.15 Dec 201719 Dec 201915 Dec 2019
230housecleaningservicesmaui.comGoDaddy.com, LLC7 Jun 20197 Jun 20197 Jun 2020
231housecleaningservices.org.uk-20 Dec 20129 Jan 202620 Dec 2026
232housecleaningservices.co.uk-27 Jan 200611 Feb 201727 Jan 2018
233housecleaningserviceglasgow.co.uk-17 Oct 201314 Oct 201717 Oct 2019
234housecleaningserviceswestpalmbeach.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
235housecleaningservices.guruDomain.com, LLC3 Feb 201818 Apr 20233 Feb 2023
236housecleaningservicespreston.co.uk-27 Apr 201827 Apr 201827 Apr 2019
237housecleaningservicecincinnati.comGoDaddy.com, LLC16 Aug 202427 Oct 202516 Aug 2025
238housecleaningserviceinsanfrancisco.comGoDaddy.com, LLC14 Jun 201814 Jun 201814 Jun 2019
239housecleaningservicestop.comGoDaddy.com, LLC19 Jun 201819 Jun 201819 Jun 2019
240housecleaningservicenv.comGoDaddy.com, LLC21 Jun 201821 Jun 201821 Jun 2019
241housecleaningservicesintampa.comGoDaddy.com, LLC15 May 202515 May 202515 May 2026
242housecleaningservicesutah.comNameCheap, Inc.17 Oct 202418 Oct 202517 Oct 2026
243housecleaningservicesbymaria.comGoDaddy.com, LLC12 Jul 202313 Jul 202512 Jul 2026
244housecleaningservicesrichmond.comGoDaddy.com, LLC30 Dec 201930 Dec 201930 Dec 2020
245housecleaningservicesmechanicsville.comGoDaddy.com, LLC30 Dec 201930 Dec 201930 Dec 2020
246housecleaningservicesandjanitorialserviceskc.comGoDaddy.com, LLC21 Nov 20182 Feb 202521 Nov 2024
247housecleaningservicealbuquerque.comGoDaddy.com, LLC15 Dec 201815 Dec 201815 Dec 2019
248housecleaningservicesalbuquerque.comGoDaddy.com, LLC15 Dec 201826 Jan 202515 Dec 2024
249housecleaningservicesbaltimore.comGoDaddy.com, LLC4 Jan 20194 Jan 20194 Jan 2020
250housecleaningserviceskochi.comGoDaddy.com, LLC14 Jan 201914 Jan 201914 Jan 2020
251housecleaningserviceoftexas.comGoDaddy.com, LLC31 Jan 201931 Jan 201931 Jan 2020
252housecleaningservicelosangeles.comNamesilo, LLC21 Oct 202424 Dec 202521 Oct 2025
253housecleaningservicesgalt.comGoDaddy.com, LLC18 Mar 201918 Mar 201918 Mar 2020
254housecleaningservicesterlingheightsmi.comGoDaddy.com, LLC12 Apr 201912 Apr 201912 Apr 2020
255housecleaningservicesorlando.com1&1 Internet AG13 Apr 201923 Apr 202413 Apr 2025
256housecleaningservicespittsburgh.comNamesilo, LLC16 May 201917 May 201916 May 2020
257housecleaningservices.servicesGoDaddy.com, LLC21 Dec 20221 Feb 202421 Dec 2023
258housecleaningserviceinjesusname.comeNom, Inc.4 Jul 20194 Jul 20194 Jul 2020
259housecleaningservicestampa.comGoDaddy.com, LLC16 Jul 201926 Aug 202516 Jul 2025
260housecleaningservicenyc.comGoDaddy.com, LLC16 Jul 201917 Jul 202516 Jul 2026
261housecleaningservicesauroraco.comName.com, Inc.22 Jul 201922 Jul 201922 Jul 2020
262housecleaningserviceorlando.comGoDaddy.com, LLC27 Jul 201927 Jul 201927 Jul 2020
263housecleaningserviceslongwood.comGoDaddy.com, LLC27 Jul 201927 Jul 201927 Jul 2020
264housecleaningserviceoceanside.comTucows Domains Inc.5 Aug 20199 Aug 20205 Aug 2020
265housecleaningservicewauconda.comGoDaddy.com, LLC26 Aug 201927 Aug 202526 Aug 2027
266housecleaningservicesbatonrouge.comName.com, Inc.11 Sep 201911 Sep 201911 Sep 2020
267housecleaningserviceslouisville.comeNom, Inc.19 Sep 201919 Sep 201919 Sep 2020
268housecleaningservicekaty.comTucows Domains Inc.27 Sep 20191 Oct 202127 Sep 2021
269housecleaningservicekatytx.comTucows Domains Inc.30 Sep 201930 Sep 201930 Sep 2020
270housecleaningservicesbykarina.comWix.com Ltd.22 Oct 201922 Oct 201922 Oct 2020
271housecleaningservicela.comGoDaddy.com, LLC23 Oct 201923 Oct 201923 Oct 2020
272housecleaningservicebrooklyn.comGoDaddy.com, LLC6 Nov 20197 Nov 20256 Nov 2026
273housecleaningservicemanhattan.comGoDaddy.com, LLC6 Nov 201920 Jan 20266 Nov 2026
274housecleaningservicesbrooklyn.comGoDaddy.com, LLC11 Nov 201911 Nov 202511 Nov 2026
275housecleaningservicesbyiselavaldez.comGoDaddy.com, LLC6 Dec 20196 Dec 20196 Dec 2020
276housecleaningservices.companyPorkbun, LLC2 Jun 202212 Aug 20232 Jun 2023
277housecleaningservicesla.comTucows Domains Inc.19 May 20234 May 202519 May 2026
278housecleaningservicescolchestervt.com1&1 Internet AG5 Feb 202023 Feb 20205 Feb 2021
279housecleaningservices.proNameCheap, Inc.26 Feb 202028 Jan 2025-
280housecleaningservicesuk.comAbove.com Pty Ltd.28 Nov 20238 Jan 202528 Nov 2024
281housecleaningserviceflorence.comTucows Domains Inc.30 Jun 20201 Jun 202530 Jun 2026
282housecleaningservicemary.comGoDaddy.com, LLC7 Jul 20207 Jul 20207 Jul 2021
283housecleaningservicescarsdale.comGoDaddy.com, LLC25 Oct 201724 Feb 202525 Oct 2025
284housecleaningservices.spaceDOTSERVE INC.27 Jan 20233 Apr 202427 Jan 2024
285housecleaningservicescharlotte.comGoDaddy.com, LLC13 Aug 202024 Sep 202413 Aug 2024
286housecleaningservicesnationwide.infoHosting Concepts B.V. dba Openprovider8 Nov 20228 Nov 20238 Nov 2024
287housecleaningservicesvictoria.comregister.com, Inc.7 Sep 20207 Sep 20207 Sep 2021
288housecleaningservicewichita.xyzNameCheap, Inc.24 Sep 202024 Sep 202024 Sep 2021
289housecleaningservicesbangalore.comGoDaddy.com, LLC25 Sep 202025 Sep 202025 Sep 2021
290housecleaningservicessavannahga.comNameCheap, Inc.8 Mar 202316 Feb 20258 Mar 2026
291housecleaningservicegreenville.comGoDaddy.com, LLC6 Oct 20207 Oct 20256 Oct 2026
292housecleaningservicesimpsonville.comGoDaddy.com, LLC6 Oct 20207 Oct 20256 Oct 2026
293housecleaningservicewestchester.comNamesilo, LLC19 Oct 20201 Oct 202519 Oct 2026
294housecleaningservicenearme.onlineAbove.com Pty Ltd.4 Jan 20255 Jan 20264 Jan 2027
295housecleaningserviceatlantaga.comGoDaddy.com, LLC27 Jul 20238 Oct 202427 Jul 2024
296housecleaningservicewoodbridgeva.comGoDaddy.com, LLC30 Nov 202030 Nov 202030 Nov 2021
297housecleaningservicemanhattanny.comGoDaddy.com, LLC15 Dec 202015 Dec 202015 Dec 2021
298housecleaningservices-uk.siteDOTSERVE INC.25 Aug 202031 Oct 202525 Aug 2025
299housecleaningservicelasvegas.comGoDaddy.com, LLC6 Jan 20216 Jan 20216 Jan 2022
300housecleaningservicesofausting.comGoDaddy.com, LLC20 Jan 20213 Mar 202520 Jan 2025
301housecleaningservicesserrano.comGoogle, Inc.1 Mar 20211 Mar 20211 Mar 2022
302housecleaningservicemidland.comNamesilo, LLC16 Mar 202117 Mar 202516 Mar 2026
303housecleaningservicesnear.comGoDaddy.com, LLC11 Apr 202122 Jun 202311 Apr 2023
304housecleaningserviceleads.comNameCheap, Inc.16 Apr 202128 Jun 202516 Apr 2025
305housecleaningservicesinclarksville.comGoDaddy.com, LLC23 Apr 202123 Apr 202123 Apr 2022
306housecleaningservices.todayGoDaddy.com, LLC20 Mar 20241 May 202520 Mar 2025
307housecleaningservicemurfreesborotn.comGoDaddy.com, LLC19 May 202119 May 202119 May 2022
308housecleaningservicespro.comAbove.com Pty Ltd.8 Jun 20218 Jun 20218 Jun 2022
309housecleaningservicestrichy.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Jun 202128 Jun 202128 Jun 2022
310housecleaningservicesinsanfrancisco.onlineregister.com, Inc.2 Aug 20212 Aug 20212 Aug 2022
311housecleaningserviceshyderabad.comWild West Domains, LLC11 Aug 202111 Aug 202111 Aug 2022
312housecleaningservicebyhelimar.comAscio Technologies, Inc. Danmark - Filial af Ascio…12 Aug 202112 Aug 202112 Aug 2022
313housecleaningservicesus.comAbove.com Pty Ltd.20 Aug 202120 Aug 202120 Aug 2022
314housecleaningserviceslynnwood.comGoDaddy.com, LLC13 Sep 202113 Sep 202113 Sep 2022
315housecleaningservicesnearyou.comAbove.com Pty Ltd.7 Oct 20217 Oct 20217 Oct 2022
316housecleaningservicesbrooklyn.netGoDaddy.com, LLC17 Oct 202121 Oct 202517 Oct 2026
317housecleaningservicebayridge.comGoDaddy.com, LLC17 Oct 202121 Oct 202517 Oct 2026
318housecleaningservicesupperwestside.comGoDaddy.com, LLC17 Oct 202121 Oct 202517 Oct 2026
319housecleaningserviceswellington.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
320housecleaningservicesnorthmiami.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
321housecleaningservicesweston.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
322housecleaningservicesbocaraton.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
323housecleaningservicesmiramar.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
324housecleaningservicesaf.comWild West Domains, LLC29 Oct 202110 Dec 202529 Oct 2025
325housecleaningservicemorningside.comGoDaddy.com, LLC8 Nov 20218 Nov 20218 Nov 2022
326housecleaningservicestamford.comGoDaddy.com, LLC16 Nov 202126 Nov 202516 Nov 2026
327housecleaningservicemadison.comGoDaddy.com, LLC16 Nov 202126 Nov 202516 Nov 2026
328housecleaningservicemystik.comGoDaddy.com, LLC16 Nov 202126 Nov 202516 Nov 2026
329housecleaningservicesnewcanaan.comGoDaddy.com, LLC16 Nov 202126 Nov 202516 Nov 2026
330housecleaningserviceweston.comGoDaddy.com, LLC16 Nov 202126 Nov 202516 Nov 2026
331housecleaningservicewoodbridge.comGoDaddy.com, LLC16 Nov 202126 Nov 202516 Nov 2026
332housecleaningservicesuffield.comGoDaddy.com, LLC16 Nov 202126 Nov 202516 Nov 2026
333housecleaningservicesnewtown.comGoDaddy.com, LLC16 Nov 202126 Nov 202516 Nov 2026
334housecleaningservicesbrier.comGoDaddy.com, LLC17 Nov 202117 Nov 202117 Nov 2022
335housecleaningserviceinkathmandu.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…1 Dec 202117 Jun 20251 Dec 2026
336housecleaningservicesseattle.solutionsGoDaddy.com, LLC12 Dec 202112 Dec 202112 Dec 2022
337housecleaningserviceconcord.comGoDaddy.com, LLC7 Jan 20227 Jan 20227 Jan 2023
338housecleaningservicesmurfreesboro.comGoDaddy.com, LLC8 Jan 20228 Jan 20228 Jan 2023
339housecleaningservicesgroup.comGoDaddy.com, LLC13 Jan 202214 Jan 202413 Jan 2025
340housecleaningservicejeddah.comNamesilo, LLC13 Jan 202223 Feb 202513 Jan 2025
341housecleaningservicesindenver.comHosting Concepts B.V. dba Openprovider7 Feb 20227 Feb 20227 Feb 2023
342housecleaningservicedurham.comGoDaddy.com, LLC10 Feb 202222 Apr 202410 Feb 2024
343housecleaningservicesrye.comGoDaddy.com, LLC14 Feb 202228 Apr 202314 Feb 2023
344housecleaningservices.onlineGoDaddy.com, LLC11 May 202322 Jun 202411 May 2024
345housecleaningservicenearby.siteDOTSERVE INC.4 Mar 202210 May 20244 Mar 2024
346housecleaningservices5boroughs.comNameCheap, Inc.18 Mar 202230 Apr 202518 Mar 2025
347housecleaningservicesjamaicaqueens.comNameCheap, Inc.18 Mar 202217 Feb 202418 Mar 2025
348housecleaningservicesfiveboroughs.comNameCheap, Inc.18 Mar 202217 Feb 202418 Mar 2025
349housecleaningserviceshamptons.comNameCheap, Inc.18 Mar 202217 Feb 202418 Mar 2025
350housecleaningserviceshuntington.comNameCheap, Inc.18 Mar 202217 Feb 202418 Mar 2025
351housecleaningservicesmanhattan.comNameCheap, Inc.18 Mar 202217 Feb 202418 Mar 2025
352housecleaningservicesstonybrook.comNameCheap, Inc.19 Mar 202219 Mar 202419 Mar 2025
353housecleaningservicesriverhead.comNameCheap, Inc.19 Mar 202219 Mar 202419 Mar 2025
354housecleaningservices-ca.siteDOTSERVE INC.24 Mar 202230 Apr 202524 Mar 2025
355housecleaningservicesoc.comNameCheap, Inc.11 May 202223 Jul 202311 May 2023
356housecleaningservices.clubDNSPod, Inc.24 Oct 202427 Oct 202524 Oct 2025
357housecleaningservices.org-5 Sep 202312 Sep 20255 Sep 2026
358housecleaningservicesmesaaz.comNameCheap, Inc.10 Jul 202221 Aug 202310 Jul 2023
359housecleaningserviceelpaso.comGoDaddy.com, LLC21 Jul 20222 Oct 202321 Jul 2023
360housecleaningservicewestchesteril.comGoDaddy.com, LLC21 Jul 20224 Aug 202521 Jul 2026
361housecleaningservicesphiladelphia.comGoDaddy.com, LLC23 Jul 20223 Sep 202323 Jul 2023
362housecleaningservicecharlotte.com-29 Aug 202529 Aug 202529 Aug 2026
363housecleaningservicemiramar.comNameCheap, Inc.8 Aug 20229 Jul 20258 Aug 2026
364housecleaningserviceslakemurraysc.comGoDaddy.com, LLC9 Aug 202221 Oct 20259 Aug 2025
365housecleaningserviceschapinsc.comGoDaddy.com, LLC9 Aug 202221 Oct 20259 Aug 2025
366housecleaningservicesirmosc.comGoDaddy.com, LLC9 Aug 202221 Oct 20259 Aug 2025
367housecleaningservicestx.comGoDaddy.com, LLC9 Aug 202221 Oct 20249 Aug 2024
368housecleaningservicecibolo.comGoDaddy.com, LLC17 Aug 202217 Aug 202217 Aug 2023
369housecleaningservicescharlottenc.comGoDaddy.com, LLC27 Apr 202427 Apr 202527 Apr 2026
370housecleaningservicesnewrochelle.comGoDaddy.com, LLC23 Aug 20223 Oct 202423 Aug 2024
371housecleaningservicesflower.comNameCheap, Inc.30 Aug 202211 Oct 202330 Aug 2023
372housecleaningservicesheaven.comNameCheap, Inc.30 Aug 202211 Oct 202330 Aug 2023
373housecleaningservicesknight.comNameCheap, Inc.30 Aug 202211 Oct 202330 Aug 2023
374housecleaningserviceslion.comNameCheap, Inc.30 Aug 202211 Oct 202330 Aug 2023
375housecleaningservicesmission.comNameCheap, Inc.30 Aug 202211 Oct 202330 Aug 2023
376housecleaningservicescastle.comNameCheap, Inc.30 Aug 202211 Oct 202330 Aug 2023
377housecleaningservicesinc.netGoogle, Inc.5 Sep 20226 Sep 20235 Sep 2024
378housecleaningservicegallatintn.comGoDaddy.com, LLC7 Sep 202219 Nov 20237 Sep 2023
379housecleaningservices-ut.comGoDaddy.com, LLC8 Sep 202220 Oct 20238 Sep 2023
380housecleaningservicesok.fyieNom, Inc.13 Sep 202225 Nov 202413 Sep 2024
381housecleaningservicemarathonfl.comGoDaddy.com, LLC16 Sep 202228 Nov 202316 Sep 2023
382housecleaningservicemiamifl.comGoDaddy.com, LLC16 Sep 202228 Nov 202316 Sep 2023
383housecleaningserviceredmondwa.comGoDaddy.com, LLC16 Sep 202230 Sep 202416 Sep 2025
384housecleaningservicechulavistaca.comGoDaddy.com, LLC21 Sep 20223 Dec 202321 Sep 2023
385housecleaningservicesurpriseaz.comGoDaddy.com, LLC21 Sep 20223 Dec 202321 Sep 2023
386housecleaningservicescolumbus.comGoDaddy.com, LLC22 Sep 20224 Dec 202322 Sep 2023
387housecleaningserviceteam.proDynadot, LLC25 Sep 20224 Dec 202325 Sep 2023
388housecleaningservicesbyvania.comGoogle, Inc.25 Sep 202226 Sep 202325 Sep 2024
389housecleaningserviceashlandva.comGoDaddy.com, LLC4 Oct 202216 Dec 20234 Oct 2023
390housecleaningservicesinlandempire.comWild West Domains, LLC6 Oct 20227 Oct 20256 Oct 2026
391housecleaningservicescolumbusohio.comWild West Domains, LLC6 Oct 20227 Oct 20256 Oct 2026
392housecleaningservicesdallas.comWild West Domains, LLC6 Oct 20227 Oct 20256 Oct 2026
393housecleaningservicebaltimore.comGoDaddy.com, LLC10 Oct 202222 Dec 202310 Oct 2023
394housecleaningservicecharlottenc.comGoDaddy.com, LLC29 Jan 202411 Feb 202529 Jan 2026
395housecleaningservicemidlandva.comGoDaddy.com, LLC13 Oct 202225 Dec 202313 Oct 2023
396housecleaningserviceslasvegas.comGoogle, Inc.13 Oct 202212 Nov 202413 Oct 2024
397housecleaningservicessancarlos.comGoDaddy.com, LLC20 Oct 20221 Jan 202420 Oct 2023
398housecleaningservicesinfo.siteDOTSERVE INC.1 Nov 20221 Nov 20221 Nov 2023
399housecleaningservicekula.comGoDaddy.com, LLC11 Nov 202223 Jan 202411 Nov 2023
400housecleaningservicesogden.comTucows Domains Inc.11 Nov 202210 Nov 202511 Nov 2026
401housecleaningservicekathmandu.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…1 Dec 202117 Jun 20251 Dec 2026
402housecleaningservicesayrshire.comHostinger, UAB25 Nov 20225 Jan 202425 Nov 2023
403housecleaningservices.pl-15 Oct 201410 Oct 202515 Oct 2026
404housecleaningservicecrosbytx.comGoDaddy.com, LLC2 Dec 202213 Feb 20242 Dec 2023
405housecleaningservicebayside.comGoDaddy.com, LLC17 Oct 202121 Oct 202517 Oct 2026
406housecleaningservicebuckeye.comGoDaddy.com, LLC12 Dec 202223 Feb 202412 Dec 2023
407housecleaningservicehonoluluhi.comGoDaddy.com, LLC14 Dec 202225 Jan 202414 Dec 2023
408housecleaningservicesoftheyear.comGoDaddy.com, LLC20 Dec 20222 Mar 202520 Dec 2024
409housecleaningservicepatchogueny.comGoDaddy.com, LLC20 Dec 20222 Mar 202420 Dec 2023
410housecleaningservicehollywood.comGoDaddy.com, LLC20 Dec 20222 Mar 202420 Dec 2023
411housecleaningservices.homesGoDaddy.com, LLC9 Apr 20249 Apr 20249 Apr 2025
412housecleaningservicessc.comGoDaddy.com, LLC23 Dec 202228 Dec 202523 Dec 2026
413housecleaningservices.asiaGoDaddy.com, LLC9 Jan 202320 Feb 20249 Jan 2024
414housecleaningservices.websiteGoDaddy.com, LLC10 Jan 202321 Feb 202410 Jan 2024
415housecleaningservicemilford.comGoDaddy.com, LLC16 Jan 202327 Feb 202516 Jan 2025
416housecleaningservices.appCloudFlare, Inc.28 Jul 20254 Aug 202528 Jul 2026
417housecleaningservicecorbettor.comGoDaddy.com, LLC27 Jan 20238 Feb 202427 Jan 2025
418housecleaningservicecost.comGoogle, Inc.27 Jan 202326 Feb 202427 Jan 2024
419housecleaningservicelagunaniguel.comGoDaddy.com, LLC27 Jan 20238 Feb 202427 Jan 2025
420housecleaningservices.agencyGoDaddy.com, LLC29 Jan 202311 Mar 202429 Jan 2024
421housecleaningservices.latGoDaddy.com, LLC29 Jan 202311 Mar 202429 Jan 2024
422housecleaningservices.liveGoDaddy.com, LLC23 Apr 20244 Jul 202523 Apr 2025
423housecleaningservices.ltdGoDaddy.com, LLC29 Jan 202311 Mar 202429 Jan 2024
424housecleaningservices.solutionsGoDaddy.com, LLC29 Jan 202311 Mar 202429 Jan 2024
425housecleaningservicesnearme.onlineGoDaddy.com, LLC30 Jan 202312 Mar 202430 Jan 2024
426housecleaningservicesnearme.xyzGoDaddy.com, LLC30 Jan 202312 Mar 202430 Jan 2024
427housecleaningservices.houseNameCheap, Inc.31 Jan 202313 Mar 202431 Jan 2024
428housecleaningservices.vegasNameCheap, Inc.31 Jan 202313 Mar 202431 Jan 2024
429housecleaningservicesnearme.spaceGoDaddy.com, LLC1 Feb 202314 Mar 20241 Feb 2024
430housecleaningservices.workNameCheap, Inc.5 Feb 202320 Feb 20255 Feb 2025
431housecleaningserviceinpoland.storeNameCheap, Inc.7 Feb 202320 Mar 20247 Feb 2024
432housecleaningserviceusa.comGoDaddy.com, LLC7 Feb 202319 Feb 20267 Feb 2027
433housecleaningservicesnearus.xyzGoDaddy.com, LLC13 Feb 202326 Mar 202413 Feb 2024
434housecleaningservicesnearmes.spaceGoDaddy.com, LLC15 Feb 202328 Mar 202415 Feb 2024
435housecleaningservice-usa.siteDOTSERVE INC.14 Feb 202321 Apr 202414 Feb 2024
436housecleaningservicenearme.xyzGoDaddy.com, LLC15 Feb 202328 Mar 202415 Feb 2024
437housecleaningservicelowellvt.comGoDaddy.com, LLC23 Feb 20236 May 202423 Feb 2024
438housecleaningservices.lifeGoDaddy.com, LLC23 Feb 20235 May 202423 Feb 2024
439housecleaningserviceswestchester.comGoDaddy.com, LLC25 Oct 201727 Mar 202525 Oct 2025
440housecleaningservicesbronxville.comGoDaddy.com, LLC25 Oct 201710 Jan 202525 Oct 2025
441housecleaningservicelongisland.comGoDaddy.com, LLC28 Feb 202328 Feb 202528 Feb 2026
442housecleaningservicevirginiabeach.comGoDaddy.com, LLC28 Feb 202311 May 202428 Feb 2024
443housecleaningservicekw.comGransy s.r.o. d/b/a subreg.cz3 Mar 20234 Mar 20243 Mar 2025
444housecleaningserviceprescott.comGoDaddy.com, LLC8 Mar 202320 May 20248 Mar 2024
445housecleaningservicenearby-us.siteDOTSERVE INC.6 Mar 202312 Apr 20256 Mar 2025
446housecleaningservicesprice.siteDOTSERVE INC.9 Mar 202315 May 20259 Mar 2025
447housecleaningservicesinc.comGoDaddy.com, LLC14 Jun 202226 Aug 202314 Jun 2023
448housecleaningservicesllc.comGoDaddy.com, LLC10 Mar 202321 Apr 202410 Mar 2024
449housecleaningservicecom.comGoDaddy.com, LLC12 Mar 202323 Apr 202412 Mar 2024
450housecleaningserviceedith.comGoogle, Inc.11 Mar 202310 May 202411 Mar 2024
451housecleaningservicehamptons.comGoDaddy.com, LLC12 Mar 202313 Mar 202512 Mar 2026
452housecleaningservicetoday.comGoogle, Inc.14 Mar 202325 Apr 202514 Mar 2025
453housecleaningservicemerrittisland.comGoDaddy.com, LLC22 Mar 202329 Mar 202422 Mar 2025
454housecleaningservicephiladelphia.comNameCheap, Inc.2 Feb 20218 Jan 20222 Feb 2023
455housecleaningservicenear.comGoDaddy.com, LLC11 Apr 202122 Apr 202311 Apr 2024
456housecleaningservicespringfieldma.comGoDaddy.com, LLC28 Mar 20239 Jun 202528 Mar 2025
457housecleaningservices-info-at.lifeGoDaddy.com, LLC4 Apr 202316 May 20244 Apr 2024
458housecleaningservices-info-de.lifeGoDaddy.com, LLC4 Apr 202316 May 20254 Apr 2025
459housecleaningservices-info-ch.lifeGoDaddy.com, LLC4 Apr 202316 May 20244 Apr 2024
460housecleaningservices2023.onlineGoDaddy.com, LLC2 Apr 202314 May 20242 Apr 2024
461housecleaningservicesbuffalogrove.comGoDaddy.com, LLC8 Sep 202120 Oct 20238 Sep 2023
462housecleaningservicesarlingtonheights.comGoDaddy.com, LLC8 Sep 202120 Oct 20248 Sep 2024
463housecleaningservicescoloradosprings.comDropCatch.com 1395 LLC20 Jun 202431 Jul 202520 Jun 2025
464housecleaningservices-info-it.lifeGoDaddy.com, LLC4 Apr 202316 May 20244 Apr 2024
465housecleaningservices-jp-search.lifeGoDaddy.com, LLC4 Apr 202316 May 20244 Apr 2024
466housecleaningservices-westchester.comGoDaddy.com, LLC17 Oct 202121 Oct 202517 Oct 2026
467housecleaningserviceschelsea.comGoDaddy.com, LLC17 Oct 202121 Oct 202517 Oct 2026
468housecleaningservicesqueens.comGoDaddy.com, LLC17 Oct 202121 Oct 202517 Oct 2026
469housecleaningservicestatenisland.comGoDaddy.com, LLC17 Oct 202121 Oct 202517 Oct 2026
470housecleaningservicewhitestone.comGoDaddy.com, LLC17 Oct 202121 Oct 202517 Oct 2026
471housecleaningservicesboyntonbeach.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
472housecleaningservicesaventura.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
473housecleaningservicesftlauderdale.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
474housecleaningservicesdavie.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
475housecleaningservicesdoral.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
476housecleaningservicesjupiter.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
477housecleaningserviceskeybiscayne.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
478housecleaningservicesmidtown.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
479housecleaningservicespompanobeach.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
480housecleaningservicescoralgables.comGoDaddy.com, LLC24 Oct 202130 Oct 202524 Oct 2026
481housecleaningservicenewcastle.comGoDaddy.com, LLC5 Apr 202317 Apr 20245 Apr 2025
482housecleaningservicetrumbull.comGoDaddy.com, LLC16 Nov 202126 Nov 202516 Nov 2026
483housecleaningservices.net.au--25 Jun 2025-
484housecleaningservice-nj.comGoDaddy.com, LLC6 Apr 202318 Apr 20246 Apr 2025
485housecleaningservicesofbet.comWix.com Ltd.15 Jan 202226 Mar 202415 Jan 2024
486housecleaningservicescleveland.comGoDaddy.com, LLC18 Jan 202230 Jan 202618 Jan 2027
487housecleaningserviceslarchmont.comGoDaddy.com, LLC14 Feb 202228 Mar 202314 Feb 2023
488housecleaningservicesuppersaddleriver.comGoDaddy.com, LLC14 Feb 202228 Mar 202314 Feb 2023
489housecleaningservicesmamaroneck.comGoDaddy.com, LLC14 Feb 202228 Mar 202314 Feb 2023
490housecleaningserviceworcester.comGoDaddy.com, LLC10 Apr 202322 Jun 202410 Apr 2024
491housecleaningserviceslongisland.comNameCheap, Inc.18 Mar 202217 Feb 202418 Mar 2025
492housecleaningservicessaintjames.comNameCheap, Inc.19 Mar 202230 Apr 202419 Mar 2024
493housecleaningservices411.comNameCheap, Inc.12 Apr 202313 Apr 202412 Apr 2025
494housecleaningservicebaxter.comGoDaddy.com, LLC20 Apr 20222 May 202320 Apr 2024
495housecleaningservicesinmiami.comGoogle, Inc.21 Jun 202222 Jun 202321 Jun 2024
496housecleaningservices.funGoDaddy.com, LLC10 Jan 202321 Feb 202410 Jan 2024
497housecleaningservices.inGoDaddy.com, LLC11 Dec 20191 Jun 202511 Dec 2026
498housecleaningserviceneptunecity.comGoDaddy.com, LLC18 Apr 20232 Apr 202418 Apr 2026
499housecleaningservicesinorangecounty.comeNom, Inc.21 Apr 20234 Jul 202421 Apr 2024
500housecleaningservicenearme.netWild West Domains, LLC3 May 202214 Jul 20233 May 2023
501housecleaningservices.nl-28 Jan 202328 Apr 2024-
502housecleaningservices.co.nzKey-Systems GmbH26 Nov 20185 Jan 2024-
503housecleaningservices-ca.lifeGoDaddy.com, LLC26 Apr 20237 Jul 202426 Apr 2024
504housecleaningservicesonline.lifeGoDaddy.com, LLC29 Apr 202310 Jul 202429 Apr 2024
505housecleaningservices.vipGoDaddy.com, LLC17 Aug 202217 Oct 202517 Aug 2025
506housecleaningservicesanantonio.comGoDaddy.com, LLC8 May 202320 Jul 20248 May 2024
507housecleaningservicescompany.lifeGoDaddy.com, LLC16 May 202327 Jun 202416 May 2024
508housecleaningservices.fyiGoDaddy.com, LLC17 May 202328 Jun 202517 May 2025
509housecleaningservices.socialGoDaddy.com, LLC18 May 202329 Jul 202418 May 2024
510housecleaningservices.mediaGoDaddy.com, LLC26 May 20236 Aug 202526 May 2025
511housecleaningservicesonline.todayGoDaddy.com, LLC26 May 20237 Jul 202426 May 2024
512housecleaningservicescompany.todayGoDaddy.com, LLC1 Jun 202313 Jul 20241 Jun 2024
513housecleaningservices.storeDNSPod, Inc.25 Oct 202426 Oct 202525 Oct 2026
514housecleaningservices23.todayGoDaddy.com, LLC9 Jun 202320 Aug 20249 Jun 2024
515housecleaningservicekennewick.comGoDaddy.com, LLC13 Jun 202325 Jul 202413 Jun 2024
516housecleaningservicesgroup.todayGoDaddy.com, LLC15 Jun 202327 Jul 202415 Jun 2024
517housecleaningserviceguide.spaceDOTSERVE INC.16 Jun 202317 Jun 202516 Jun 2026
518housecleaningservicesnl.spaceDOTSERVE INC.19 Jun 202325 Aug 202419 Jun 2024
519housecleaningservicesindia.todayGoDaddy.com, LLC20 Jun 20231 Aug 202420 Jun 2024
520housecleaningservicealbany.comGoDaddy.com, LLC20 Jun 20231 Sep 202420 Jun 2024
521housecleaningservices.topNamesilo, LLC21 Jun 202325 Jul 202421 Jun 2024
522housecleaningservicesdfgh.todayGoDaddy.com, LLC27 Jun 20238 Aug 202427 Jun 2024
523housecleaningservicesnearme.siteNameCheap, Inc.28 Jun 20239 Aug 202428 Jun 2024
524housecleaningservicessfdg.todayGoDaddy.com, LLC29 Jun 202310 Aug 202429 Jun 2024
525housecleaningservicesnearby.lifeGoDaddy.com, LLC2 Jul 202313 Aug 20242 Jul 2024
526housecleaningservicesouglk.todayGoDaddy.com, LLC3 Jul 202314 Aug 20243 Jul 2024
527housecleaningservicesspringfield.comDynadot, LLC4 Jul 202313 Jun 20244 Jul 2024
528housecleaningservicesergf.todayGoDaddy.com, LLC5 Jul 202316 Aug 20245 Jul 2024
529housecleaningservicesrytyuji.todayGoDaddy.com, LLC6 Jul 202317 Aug 20246 Jul 2024
530housecleaningservicesewrdf.todayGoDaddy.com, LLC7 Jul 202318 Aug 20247 Jul 2024
531housecleaningservicesswryhd.todayGoDaddy.com, LLC7 Jul 202318 Aug 20247 Jul 2024
532housecleaningservicestyuog.todayGoDaddy.com, LLC7 Jul 202318 Aug 20247 Jul 2024
533housecleaningserviceerhyf.todayGoDaddy.com, LLC8 Jul 202318 Sep 20248 Jul 2024
534housecleaningservices-es.todayGoDaddy.com, LLC9 Jul 202319 Sep 20249 Jul 2024
535housecleaningservicesews.todayGoDaddy.com, LLC9 Jul 202319 Sep 20249 Jul 2024
536housecleaningservicessdc.todayGoDaddy.com, LLC9 Jul 202319 Sep 20249 Jul 2024
537housecleaningservices-pt.todayGoDaddy.com, LLC10 Jul 202320 Sep 202410 Jul 2024
538housecleaningserviceserdhtf.todayGoDaddy.com, LLC10 Jul 202320 Sep 202410 Jul 2024
539housecleaningservicesfghn.todayGoDaddy.com, LLC10 Jul 202320 Sep 202410 Jul 2024
540housecleaningservicesgfsd.todayGoDaddy.com, LLC10 Jul 202320 Sep 202410 Jul 2024
541housecleaningservicesghmj.todayGoDaddy.com, LLC10 Jul 202320 Sep 202410 Jul 2024
542housecleaningservicesoilkn.todayGoDaddy.com, LLC10 Jul 202320 Sep 202410 Jul 2024
543housecleaningservices-here.todayGoDaddy.com, LLC11 Jul 202322 Aug 202411 Jul 2024
544housecleaningservices-now.todayGoDaddy.com, LLC11 Jul 202322 Aug 202411 Jul 2024
545housecleaningservices-provider.todayGoDaddy.com, LLC11 Jul 202322 Aug 202411 Jul 2024
546housecleaningservicespt.todayGoDaddy.com, LLC11 Jul 202322 Aug 202411 Jul 2024
547housecleaningservicesefd.todayGoDaddy.com, LLC11 Jul 202322 Aug 202411 Jul 2024
548housecleaningserviceses.todayGoDaddy.com, LLC12 Jul 202323 Aug 202412 Jul 2024
549housecleaningservicestrfj.todayGoDaddy.com, LLC12 Jul 202323 Aug 202412 Jul 2024
550housecleaningservicedfh.todayGoDaddy.com, LLC14 Jul 202325 Aug 202414 Jul 2024
551housecleaningservicesgrtd.todayGoDaddy.com, LLC14 Jul 202325 Aug 202414 Jul 2024
552housecleaningservicesrgdf.todayGoDaddy.com, LLC14 Jul 202325 Aug 202414 Jul 2024
553housecleaningservicehere.todayGoDaddy.com, LLC20 Jul 202330 Sep 202420 Jul 2024
554housecleaningservices-fr.todayGoDaddy.com, LLC19 Jul 202330 Aug 202419 Jul 2024
555housecleaningservicecollingwoodvic.comGoDaddy.com, LLC20 Jul 20231 Oct 202420 Jul 2024
556housecleaningservicecompany.todayGoDaddy.com, LLC20 Jul 202330 Sep 202420 Jul 2024
557housecleaningservices2105.todayGoDaddy.com, LLC21 Jul 20231 Oct 202421 Jul 2024
558housecleaningservices2155.todayGoDaddy.com, LLC21 Jul 20231 Oct 202421 Jul 2024
559housecleaningservices2185.todayGoDaddy.com, LLC21 Jul 20231 Oct 202421 Jul 2024
560housecleaningservices2562.todayGoDaddy.com, LLC21 Jul 20231 Oct 202421 Jul 2024
561housecleaningservices3125.todayGoDaddy.com, LLC21 Jul 20231 Oct 202421 Jul 2024
562housecleaningservices51458.todayGoDaddy.com, LLC21 Jul 20231 Oct 202421 Jul 2024
563housecleaningservices5158.todayGoDaddy.com, LLC21 Jul 20231 Oct 202421 Jul 2024
564housecleaningservices2154.todayGoDaddy.com, LLC22 Jul 20232 Sep 202422 Jul 2024
565housecleaningservicespricelist.clickNameCheap, Inc.25 Jul 20235 Sep 202425 Jul 2024
566housecleaningservices-23.onlineGoDaddy.com, LLC25 Jul 20235 Sep 202425 Jul 2024
567housecleaningservicesbend.comGoDaddy.com, LLC2 Aug 20232 Sep 20242 Aug 2024
568housecleaningservices1.liveGoDaddy.com, LLC8 Aug 202319 Sep 20248 Aug 2024
569housecleaningservices2.liveGoDaddy.com, LLC8 Aug 202319 Sep 20248 Aug 2024
570housecleaningservices1.ltdGoDaddy.com, LLC8 Aug 202319 Sep 20248 Aug 2024
571housecleaningservices7.onlineGoDaddy.com, LLC10 Aug 202321 Sep 202410 Aug 2024
572housecleaningservices.digitalGoDaddy.com, LLC9 Aug 202320 Sep 20249 Aug 2024
573housecleaningservices3.xyzGoDaddy.com, LLC9 Aug 202320 Sep 20249 Aug 2024
574housecleaningservicepinehurst.comGoDaddy.com, LLC9 Aug 202321 Oct 20249 Aug 2024
575housecleaningservices.worldGoDaddy.com, LLC10 Aug 202321 Sep 202410 Aug 2024
576housecleaningservices.collegeGoDaddy.com, LLC11 Aug 202322 Oct 202411 Aug 2024
577housecleaningservices01.onlineGoDaddy.com, LLC11 Aug 202322 Oct 202411 Aug 2024
578housecleaningservices.babyGoDaddy.com, LLC14 Aug 202325 Sep 202414 Aug 2024
579housecleaningservices.monsterGoDaddy.com, LLC15 Aug 202326 Sep 202415 Aug 2024
580housecleaningservices1.lifeGoDaddy.com, LLC16 Aug 202327 Sep 202416 Aug 2024
581housecleaningservices1.socialGoDaddy.com, LLC16 Aug 202327 Sep 202416 Aug 2024
582housecleaningservices2.storeNameCheap, Inc.5 Nov 20246 Nov 20255 Nov 2026
583housecleaningservices6.storeGoDaddy.com, LLC19 Aug 202330 Sep 202419 Aug 2024
584housecleaningservices1.storeGoDaddy.com, LLC19 Aug 202330 Sep 202419 Aug 2024
585housecleaningservices22.fyiGoDaddy.com, LLC22 Aug 20233 Oct 202522 Aug 2025
586housecleaningservices7.lifeGoDaddy.com, LLC22 Aug 20233 Oct 202422 Aug 2024
587housecleaningservices9.liveGoDaddy.com, LLC22 Aug 20233 Oct 202422 Aug 2024
588housecleaningservices101.todayGoDaddy.com, LLC22 Aug 20233 Oct 202422 Aug 2024
589housecleaningservicesncls.todayGoDaddy.com, LLC22 Aug 20233 Oct 202422 Aug 2024
590housecleaningservices9.xyzGoDaddy.com, LLC22 Aug 20233 Oct 202422 Aug 2024
591housecleaningservices9.ltdGoDaddy.com, LLC22 Aug 20233 Oct 202422 Aug 2024
592housecleaningservices9.socialGoDaddy.com, LLC22 Aug 20233 Oct 202422 Aug 2024
593housecleaningserviceceloronny.comGoDaddy.com, LLC25 Aug 20239 Sep 202425 Aug 2025
594housecleaningservicencr.comGoDaddy.com, LLC30 Aug 202311 Nov 202430 Aug 2024
595housecleaningservicehollandmi.comGoDaddy.com, LLC4 Sep 202316 Oct 20244 Sep 2024
596housecleaningservicesnearme.todayGoDaddy.com, LLC6 Sep 202318 Oct 20246 Sep 2024
597housecleaningserviceholland-mi.comGoDaddy.com, LLC4 Sep 202316 Oct 20244 Sep 2024
598housecleaningservices-23.storeAbove.com Pty Ltd.14 Jun 202519 Jun 202514 Jun 2026
599housecleaningservicesbayarea.comNameCheap, Inc.8 Sep 202320 Nov 20258 Sep 2025
600housecleaningservicesdaytonoh.comSquarespace Domains LLC8 Sep 20238 Nov 20248 Sep 2024
601housecleaningservices-nearby.todayGoDaddy.com, LLC13 Sep 202324 Nov 202413 Sep 2024
602housecleaningservicesinnl2023.liveeNom, Inc.13 Sep 202325 Nov 202413 Sep 2024
603housecleaningservices-provider.onlineGoDaddy.com, LLC14 Sep 202315 Sep 202414 Sep 2025
604housecleaningservices-23.todayGoDaddy.com, LLC16 Sep 202327 Nov 202416 Sep 2024
605housecleaningservicerowletttx.comGoDaddy.com, LLC19 Sep 202331 Oct 202419 Sep 2024
606housecleaningservices356.todayGoDaddy.com, LLC22 Sep 20233 Nov 202422 Sep 2024
607housecleaningservicesin.comWild West Domains, LLC24 Sep 20236 Dec 202424 Sep 2024
608housecleaningservices-de.onlineGoDaddy.com, LLC25 Sep 20236 Dec 202425 Sep 2024
609housecleaningservices-today.storeNameCheap, Inc.25 Sep 20236 Dec 202425 Sep 2024
610housecleaningservices-us.xyzNameCheap, Inc.29 Sep 202330 Sep 202429 Sep 2025
611housecleaningservicecoeurdalene.comGoDaddy.com, LLC30 Sep 202311 Dec 202430 Sep 2024
612housecleaningservicemumbai.comGoDaddy.com, LLC30 Sep 202312 Dec 202430 Sep 2024
613housecleaningservicebangalore.comGoDaddy.com, LLC30 Sep 202312 Dec 202430 Sep 2024
614housecleaningservicesfor-seniors.todayGoDaddy.com, LLC5 Oct 202316 Nov 20245 Oct 2024
615housecleaningserviceworcesterma.comGoDaddy.com, LLC4 Oct 202315 Nov 20244 Oct 2024
616housecleaningservicesforseniors.todayGoDaddy.com, LLC5 Oct 202316 Nov 20245 Oct 2024
617housecleaningservicemargatefl.comGoDaddy.com, LLC5 Oct 202316 Nov 20245 Oct 2024
618housecleaningservices-store.todayGoDaddy.com, LLC6 Oct 202311 Oct 20246 Oct 2025
619housecleaningservice71.liveGoDaddy.com, LLC10 Oct 202321 Dec 202410 Oct 2024
620housecleaningservice71.xyzGMO Internet Inc.4 Jan 20255 Jan 20264 Jan 2027
621housecleaningservices6.xyzGoDaddy.com, LLC11 Oct 202322 Dec 202411 Oct 2024
622housecleaningservices-us.todayGoDaddy.com, LLC13 Oct 202324 Nov 202413 Oct 2024
623housecleaningservicehebercity.comGoDaddy.com, LLC13 Oct 202328 Oct 202413 Oct 2025
624housecleaningservicesabudhabi.comCosmotown, Inc.15 Oct 202325 Nov 202415 Oct 2024
625housecleaningservicepanamacityfl.comGoDaddy.com, LLC16 Oct 202328 Dec 202416 Oct 2024
626housecleaningservicewillistonnd.comGoDaddy.com, LLC16 Oct 202327 Nov 202416 Oct 2024
627housecleaningservices1.siteNameCheap, Inc.17 Oct 202328 Dec 202417 Oct 2024
628housecleaningservices303.todayGoDaddy.com, LLC18 Oct 202329 Dec 202418 Oct 2024
629housecleaningservices6.liveGoDaddy.com, LLC20 Oct 202331 Dec 202420 Oct 2024
630housecleaningservice1.todayGoDaddy.com, LLC20 Oct 202331 Dec 202420 Oct 2024
631housecleaningservice1.xyzGoDaddy.com, LLC20 Oct 202331 Dec 202420 Oct 2024
632housecleaningservicesv.todayGoDaddy.com, LLC22 Oct 20232 Jan 202522 Oct 2024
633housecleaningservices-406.todayGoDaddy.com, LLC23 Oct 20234 Dec 202423 Oct 2024
634housecleaningservices406.todayGoDaddy.com, LLC23 Oct 20234 Dec 202423 Oct 2024
635housecleaningservicesus.todayGoDaddy.com, LLC23 Oct 20234 Dec 202423 Oct 2024
636housecleaningservices-us-fb.bondKey-Systems, LLC24 Oct 202324 Oct 202324 Oct 2024
637housecleaningservicenewcastle-de.comGoDaddy.com, LLC23 Oct 20234 Dec 202423 Oct 2024
638housecleaningservicesnearyou.onlineNameCheap, Inc.24 Oct 20235 Dec 202424 Oct 2024
639housecleaningservices2.siteNameCheap, Inc.30 Oct 202331 Oct 202430 Oct 2025
640housecleaningserviceriverside.comGoDaddy.com, LLC31 Oct 202312 Jan 202531 Oct 2024
641housecleaningservicemasontx.com-1 Nov 20231 Nov 20241 Nov 2026
642housecleaningservice1.fyiGoDaddy.com, LLC2 Nov 202317 Nov 20242 Nov 2025
643housecleaningservice1.liveGoDaddy.com, LLC2 Nov 202313 Jan 20252 Nov 2024
644housecleaningservice1.ltdGoDaddy.com, LLC2 Nov 202313 Jan 20252 Nov 2024
645housecleaningserviceirvingtx.comDynadot, LLC4 Feb 20255 Feb 20264 Feb 2027
646housecleaningservices-9.todayGoDaddy.com, LLC6 Nov 202318 Dec 20246 Nov 2024
647housecleaningservice-stigler.comGoDaddy.com, LLC6 Nov 202320 Nov 20246 Nov 2025
648housecleaningservice-stiglerok.comGoDaddy.com, LLC6 Nov 202318 Dec 20246 Nov 2024
649housecleaningservicepflugervilletx.comGoDaddy.com, LLC6 Nov 202320 Nov 20246 Nov 2025
650housecleaningservicestigler.comGoDaddy.com, LLC6 Nov 202318 Dec 20246 Nov 2024
651housecleaningservicewestminsterca.com-7 Nov 20237 Nov 20247 Nov 2025
652housecleaningservicelongmontco.comGoDaddy.com, LLC8 Nov 202323 Nov 20248 Nov 2025
653housecleaningservices-finds.todayGoDaddy.com, LLC10 Nov 202322 Dec 202410 Nov 2024
654housecleaningservicewilliston.comGoDaddy.com, LLC10 Nov 202322 Jan 202510 Nov 2024
655housecleaningservicecoconutcreek.comGoDaddy.com, LLC10 Nov 202325 Nov 202410 Nov 2025
656housecleaningservicedesplainesil.comGoDaddy.com, LLC10 Nov 202322 Jan 202510 Nov 2024
657housecleaningservicetigard.comGoDaddy.com, LLC10 Nov 202322 Nov 202510 Nov 2026
658housecleaningserviceeastpaloaltoca.comGoDaddy.com, LLC10 Nov 202322 Jan 202510 Nov 2024
659housecleaningservicefreeport.comGoDaddy.com, LLC10 Nov 202322 Jan 202510 Nov 2024
660housecleaningservicemargate.comGoDaddy.com, LLC10 Nov 202322 Jan 202510 Nov 2024
661housecleaningservicepanamacity.comGoDaddy.com, LLC10 Nov 202322 Jan 202510 Nov 2024
662housecleaningservicekingsport.comGoDaddy.com, LLC13 Nov 202325 Jan 202513 Nov 2024
663housecleaningservicespricelist199740.lifeGoDaddy.com, LLC14 Nov 202329 Nov 202414 Nov 2025
664housecleaningservicehammond.comGoDaddy.com, LLC14 Nov 202326 Jan 202514 Nov 2024
665housecleaningservice66.liveGoDaddy.com, LLC15 Nov 202330 Nov 202415 Nov 2025
666housecleaningservices-ca.todayGoDaddy.com, LLC15 Nov 202330 Nov 202415 Nov 2025
667housecleaningservicesde.todayGoDaddy.com, LLC16 Nov 202328 Nov 202416 Nov 2025
668housecleaningservicetampafl.comGoDaddy.com, LLC16 Nov 20231 Dec 202416 Nov 2025
669housecleaningserviceomaha.comGoDaddy.com, LLC17 Nov 202329 Jan 202517 Nov 2024
670housecleaningservicesq.todayGoDaddy.com, LLC22 Nov 20232 Feb 202522 Nov 2024
671housecleaningservicesnearme.liveGoDaddy.com, LLC24 Nov 20234 Feb 202524 Nov 2024
672housecleaningservicesfr.todayGoDaddy.com, LLC24 Nov 20234 Feb 202524 Nov 2024
673housecleaningservices411.onlinePDR Ltd. d/b/a PublicDomainRegistry.com25 Nov 20231 Jan 202525 Nov 2024
674housecleaningservicessummerville.comGoDaddy.com, LLC26 Nov 20237 Jan 202526 Nov 2024
675housecleaningservicenearyou.todayGoDaddy.com, LLC27 Nov 20238 Jan 202527 Nov 2024
676housecleaningservicetrentonnj.comGoDaddy.com, LLC1 Dec 202312 Feb 20251 Dec 2024
677housecleaningservices.bondKey-Systems, LLC6 Dec 20236 Dec 20236 Dec 2024
678housecleaningservicereisterstown.comGoDaddy.com, LLC5 Dec 202316 Jan 20255 Dec 2024
679housecleaningservicecf.comTucows Domains Inc.6 Dec 202316 Jan 20256 Dec 2024
680housecleaningservices1.todayGoDaddy.com, LLC11 Dec 202322 Jan 202511 Dec 2024
681housecleaningservicesoptions.todayGoDaddy.com, LLC14 Dec 202325 Jan 202514 Dec 2024
682housecleaningservicepittsburghpa.comGoDaddy.com, LLC18 Dec 20231 Mar 202518 Dec 2024
683housecleaningservicebronxny.comGoDaddy.com, LLC19 Dec 20232 Mar 202519 Dec 2024
684housecleaningservicesinca.todayGoDaddy.com, LLC20 Dec 20232 Mar 202520 Dec 2024
685housecleaningservicewellington.comGoDaddy.com, LLC29 Dec 20239 Feb 202529 Dec 2024
686housecleaningservicequeensny.comGoDaddy.com, LLC28 Dec 20238 Feb 202528 Dec 2024
687housecleaningservices.blogGoDaddy.com, LLC4 Jan 202415 Feb 20254 Jan 2025
688housecleaningservicesanrafaelca.com-3 Jan 20246 Jan 20253 Jan 2026
689housecleaningserviceminneapolismn.comGoDaddy.com, LLC4 Jan 202418 Mar 20254 Jan 2025
690housecleaningservicelosangelesca.comGoDaddy.com, LLC8 Jan 202419 Feb 20258 Jan 2025
691housecleaningservicemesaaz.comGoDaddy.com, LLC8 Jan 202419 Feb 20258 Jan 2025
692housecleaningservicesunnyvaleca.comGoDaddy.com, LLC8 Jan 202419 Feb 20258 Jan 2025
693housecleaningserviceperrisca.com-9 Jan 20249 Jan 20259 Jan 2027
694housecleaningserviceseattlewa.com-23 Sep 202523 Sep 202523 Sep 2026
695housecleaningservicearnoldmo.comGoDaddy.com, LLC12 Jan 202426 Mar 202512 Jan 2025
696housecleaningservices749413.lifeGoDaddy.com, LLC15 Jan 202428 Mar 202515 Jan 2025
697housecleaningservicesnearme305760.lifeGoDaddy.com, LLC15 Jan 202428 Mar 202515 Jan 2025
698housecleaningservices627552.lifeGoDaddy.com, LLC16 Jan 202429 Mar 202516 Jan 2025
699housecleaningservicespringdale.comGoDaddy.com, LLC16 Jan 202428 Jan 202616 Jan 2027
700housecleaningservicesanmarcos.comGoDaddy.com, LLC17 Jan 202428 Feb 202517 Jan 2025
701housecleaningservicecolbert.comGoDaddy.com, LLC18 Jan 20241 Mar 202518 Jan 2025
702housecleaningservices-seniorsnearme.todayGoDaddy.com, LLC25 Jan 20248 Mar 202525 Jan 2025
703housecleaningservicesusa.comWix.com Ltd.24 Jan 202424 Jan 202424 Jan 2027
704housecleaningservicesnearme-usa.todayGoDaddy.com, LLC28 Jan 202410 Apr 202528 Jan 2025
705housecleaningservicestonepark.com-18 Apr 202528 Dec 202518 Apr 2026
706housecleaningservice2024.onlineDNSPod, Inc.31 Jan 20241 Feb 202531 Jan 2026
707housecleaningservicecarmichael.com-2 Feb 20243 Feb 20252 Feb 2026
708housecleaningservicesmesa.comGoDaddy.com, LLC5 Feb 20242 Feb 20265 Feb 2027
709housecleaningservicesincanada.todayGoDaddy.com, LLC10 Feb 202424 Mar 202510 Feb 2025
710housecleaningservicesinusa1.todayGoDaddy.com, LLC13 Feb 202427 Mar 202513 Feb 2025
711housecleaningservicesinaustralia.todayGoDaddy.com, LLC17 Feb 202431 Mar 202517 Feb 2025
712housecleaningservicesinusa.todayGoDaddy.com, LLC17 Feb 202431 Mar 202517 Feb 2025
713housecleaningservicespokane.comGoDaddy.com, LLC18 Feb 202418 Feb 202518 Feb 2026
714housecleaningservices453.todayGoDaddy.com, LLC19 Feb 20242 Apr 202519 Feb 2025
715housecleaningservicecrownsvillemd.comGoDaddy.com, LLC19 Feb 20242 Apr 202519 Feb 2025
716housecleaningservices674292.lifeGoDaddy.com, LLC20 Feb 20243 Apr 202520 Feb 2025
717housecleaningserviceredondobeach.comGoDaddy.com, LLC21 Feb 20245 May 202521 Feb 2025
718housecleaningserviceaurora.com-17 May 202531 Jan 202617 May 2026
719housecleaningservices419983.lifeGoDaddy.com, LLC5 Mar 202416 Apr 20255 Mar 2025
720housecleaningservices22.xyzGoDaddy.com, LLC11 Mar 202422 Apr 202511 Mar 2025
721housecleaningserviceconyersga.comGoDaddy.com, LLC13 Mar 202424 Apr 202513 Mar 2025
722housecleaningservices841639.lifeGoDaddy.com, LLC15 Mar 202426 Apr 202515 Mar 2025
723housecleaningservices835180.lifeGoDaddy.com, LLC17 Mar 202428 May 202517 Mar 2025
724housecleaningservices113839.lifeGoDaddy.com, LLC18 Mar 202429 Apr 202518 Mar 2025
725housecleaningservices905802.lifeGoDaddy.com, LLC19 Mar 202430 Apr 202519 Mar 2025
726housecleaningservices22.liveGoDaddy.com, LLC19 Mar 202430 Apr 202519 Mar 2025
727housecleaningservices30.xyzGoDaddy.com, LLC19 Mar 202430 Apr 202519 Mar 2025
728housecleaningservices.nycGoDaddy.com, LLC21 Mar 202420 Oct 202521 Mar 2026
729housecleaningservices469463.lifeGoDaddy.com, LLC20 Mar 20241 May 202520 Mar 2025
730housecleaningservicesca.comAmazon Registrar, Inc.27 Mar 20249 Jun 202527 Mar 2025
731housecleaningserviceindianapolis.comGoDaddy.com, LLC28 Mar 20249 Jun 202528 Mar 2025
732housecleaningservicestockton.comGoDaddy.com, LLC28 Mar 20248 Jun 202528 Mar 2025
733housecleaningservicesnearyou.todayGoDaddy.com, LLC29 Mar 20249 Jun 202529 Mar 2025
734housecleaningservicelasvegasnv.comGoDaddy.com, LLC1 Apr 202413 Jun 20251 Apr 2025
735housecleaningserviceannandaleva.comGoDaddy.com, LLC1 Apr 202413 Jun 20251 Apr 2025
736housecleaningservicearletaca.comGoDaddy.com, LLC1 Apr 202413 Jun 20251 Apr 2025
737housecleaningservicesanchorage.comGoDaddy.com, LLC4 Apr 202416 May 20254 Apr 2025
738housecleaningservicechickashaok.comGoDaddy.com, LLC5 Apr 202417 May 20255 Apr 2025
739housecleaningservicess.todayGoDaddy.com, LLC6 Apr 202418 May 20256 Apr 2025
740housecleaningserviceskmw.todayGoDaddy.com, LLC8 Apr 202420 May 20258 Apr 2025
741housecleaningserviceskw.todayGoDaddy.com, LLC8 Apr 202420 May 20258 Apr 2025
742housecleaningservicelehighkmcs.comGoDaddy.com, LLC8 Apr 202420 May 20258 Apr 2025
743housecleaningservicesmelbourne.au--2 Jun 2024-
744housecleaningservicesbangor.comNameCheap, Inc.6 Jul 20256 Jul 20256 Jul 2026
745housecleaningservicenc.comGoDaddy.com, LLC19 Apr 202431 May 202519 Apr 2025
746housecleaningservicesnearme436901.lifeGoDaddy.com, LLC19 Apr 202431 May 202519 Apr 2025
747housecleaningservicesit.todayGoDaddy.com, LLC22 Apr 20244 May 202522 Apr 2026
748housecleaningservicesnearby.comHosting Concepts B.V. dba Openprovider22 Apr 202420 Jul 202522 Apr 2027
749housecleaningservices1.shopGoDaddy.com, LLC22 Aug 202326 Sep 202322 Aug 2024
750housecleaningservices.shopRealtime Register B.V.19 Oct 202320 Oct 202419 Oct 2025
751housecleaningservices06.xyzGoDaddy.com, LLC6 May 202418 Jul 20256 May 2025
752housecleaningserviceselgin.comGoDaddy.com, LLC7 May 20241 May 20257 May 2026
753housecleaningservices30.liveGoDaddy.com, LLC11 May 202422 Jun 202511 May 2025
754housecleaningservicemuscleshoals.comGoDaddy.com, LLC13 May 20241 May 202513 May 2026
755housecleaningservices30.lifeGoDaddy.com, LLC17 May 202428 Jun 202517 May 2025
756housecleaningservices32.xyzGoDaddy.com, LLC20 May 20241 Jul 202520 May 2025
757housecleaningserviceschicago.net1&1 Internet AG27 May 202428 May 202527 May 2026
758housecleaningservicechulavista.comGoDaddy.com, LLC31 May 202412 Aug 202531 May 2025
759housecleaningservicenearby069526.lifeGoDaddy.com, LLC3 Jun 202414 Aug 20253 Jun 2025
760housecleaningservicenearby407153.lifeGoDaddy.com, LLC3 Jun 202414 Aug 20253 Jun 2025
761housecleaningservicenearby515782.lifeGoDaddy.com, LLC3 Jun 202414 Aug 20253 Jun 2025
762housecleaningservicenearby646974.lifeGoDaddy.com, LLC4 Jun 202415 Aug 20254 Jun 2025
763housecleaningservicetexas.comNameCheap, Inc.22 Jun 202423 Jun 202522 Jun 2026
764housecleaningservicecathedralcity.comGoDaddy.com, LLC26 Jun 20242 Jun 202526 Jun 2026
765housecleaningservicesinmyarea.todayGoDaddy.com, LLC27 Jun 20242 Jul 202527 Jun 2026
766housecleaningservices1.xyzNameCheap, Inc.27 Jun 202428 Jun 202527 Jun 2026
767housecleaningservices11.siteNameCheap, Inc.5 Jul 20246 Jul 20255 Jul 2026
768housecleaningserviceshinesvillega.comNameCheap, Inc.8 Jul 20249 Jul 20258 Jul 2026
769housecleaningservicesone.todayGoDaddy.com, LLC18 Jul 20242 Aug 202518 Jul 2026
770housecleaningservices222.xyzGoDaddy.com, LLC22 Jul 20246 Aug 202522 Jul 2026
771housecleaningservicesrutherford.comGoDaddy.com, LLC23 Jul 202424 Jul 202523 Jul 2026
772housecleaningservicesparamus.comGoDaddy.com, LLC23 Jul 202424 Jul 202523 Jul 2026
773housecleaningservicesridgewood.comGoDaddy.com, LLC23 Jul 202424 Jul 202523 Jul 2026
774housecleaningservices222.lifeGoDaddy.com, LLC24 Jul 20246 Aug 202524 Jul 2026
775housecleaningservicesfuquayvarinanc.comGoDaddy.com, LLC26 Jul 202427 Jun 202526 Jul 2026
776housecleaningservicesraleighnc.comGoDaddy.com, LLC26 Jul 202427 Jun 202526 Jul 2026
777housecleaningservices222.todayGoDaddy.com, LLC29 Jul 20243 Aug 202529 Jul 2026
778housecleaningserviceuk.todayGoDaddy.com, LLC29 Jul 20243 Aug 202529 Jul 2026
779housecleaningservicesnearme.netTucows Domains Inc.31 Jul 202417 Jul 202531 Jul 2026
780housecleaningservicespensacola.comSquarespace Domains LLC1 Aug 202424 Jul 20251 Aug 2026
781housecleaningservicesbig10.todayGoDaddy.com, LLC2 Aug 202416 Aug 20252 Aug 2026
782housecleaningservicessp.todayGoDaddy.com, LLC2 Aug 202416 Aug 20252 Aug 2026
783housecleaningservices45.shopGoDaddy.com, LLC20 May 20243 Jun 202520 May 2026
784housecleaningservicesnow.bondKey-Systems, LLC13 Aug 20244 Oct 202413 Aug 2025
785housecleaningservicesroundrock.comSquarespace Domains LLC12 Aug 202428 Jul 202512 Aug 2026
786housecleaningservices11.lifeGoDaddy.com, LLC15 Aug 202426 Sep 202515 Aug 2025
787housecleaningservices11.questGoDaddy.com, LLC15 Aug 202426 Sep 202515 Aug 2025
788housecleaningservicenewyork.comGoDaddy.com, LLC15 Aug 202416 Aug 202515 Aug 2026
789housecleaningservices25.lifeGoDaddy.com, LLC17 Aug 202428 Oct 202517 Aug 2025
790housecleaningservices25.xyzGoDaddy.com, LLC17 Aug 202428 Oct 202517 Aug 2025
791housecleaningservices25.infoGoDaddy.com, LLC19 Aug 202430 Oct 202519 Aug 2025
792housecleaningservice25.infoGoDaddy.com, LLC19 Aug 202430 Oct 202519 Aug 2025
793housecleaningservice25.lifeGoDaddy.com, LLC19 Aug 202430 Oct 202519 Aug 2025
794housecleaningservices125.lifeGoDaddy.com, LLC19 Aug 202430 Oct 202519 Aug 2025
795housecleaningservices25.todayGoDaddy.com, LLC19 Aug 202430 Oct 202519 Aug 2025
796housecleaningservices125.xyzGoDaddy.com, LLC19 Aug 202430 Oct 202519 Aug 2025
797housecleaningservice25.xyzGoDaddy.com, LLC19 Aug 202430 Oct 202519 Aug 2025
798housecleaningservice11.shopGoDaddy.com, LLC16 Aug 202424 Sep 202416 Aug 2025
799housecleaningservices30.shopGoDaddy.com, LLC19 Aug 202424 Sep 202419 Aug 2025
800housecleaningservicesforseniors.bondKey-Systems, LLC21 Aug 202427 Sep 202421 Aug 2025
801housecleaningservice25.buzzGoDaddy.com, LLC21 Aug 202422 Oct 202521 Aug 2025
802housecleaningservices25.buzzGoDaddy.com, LLC21 Aug 202422 Oct 202521 Aug 2025
803housecleaningservicestampafl.comGoDaddy.com, LLC20 Aug 202421 Aug 202520 Aug 2026
804housecleaningservices302.lifeGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
805housecleaningservices89.lifeGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
806housecleaningservices10.lifeGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
807housecleaningservices05.lifeGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
808housecleaningservice25.liveGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
809housecleaningservices05.liveGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
810housecleaningservices10.liveGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
811housecleaningservices25.liveGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
812housecleaningservice25.todayGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
813housecleaningservices10.todayGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
814housecleaningservices30.todayGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
815housecleaningservices820-info-us.todayGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
816housecleaningservices02.xyzGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
817housecleaningservices03.xyzGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
818housecleaningservices04.xyzGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
819housecleaningservices05.xyzGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
820housecleaningservices10.xyzGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
821housecleaningservices302.xyzGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
822housecleaningservices102.xyzGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
823housecleaningservices01.xyzGoDaddy.com, LLC21 Aug 20241 Nov 202521 Aug 2025
824housecleaningserviceau.todayGoDaddy.com, LLC24 Aug 20245 Oct 202524 Aug 2025
825housecleaningservicesnearme-us.siteDOTSERVE INC.27 Aug 202428 Aug 202527 Aug 2026
826housecleaningservicefallriver.comGoDaddy.com, LLC4 Sep 202416 Sep 20254 Sep 2026
827housecleaningservices00.lifeGoDaddy.com, LLC6 Sep 202418 Sep 20256 Sep 2026
828housecleaningservices002.lifeGoDaddy.com, LLC9 Sep 202421 Sep 20259 Sep 2026
829housecleaningservices01.lifeGoDaddy.com, LLC9 Sep 202422 Sep 20259 Sep 2026
830housecleaningservices32.lifeGoDaddy.com, LLC12 Sep 202423 Nov 202512 Sep 2025
831housecleaningservicesfayettevillenc.comNameCheap, Inc.12 Sep 202413 Aug 202512 Sep 2026
832housecleaningservicesmyrtlebeach.comNameCheap, Inc.12 Sep 202413 Aug 202512 Sep 2026
833housecleaningserviceswilmingtonnc.comNameCheap, Inc.12 Sep 202413 Aug 202512 Sep 2026
834housecleaningservices45.xyzGoDaddy.com, LLC18 Sep 202430 Oct 202518 Sep 2025
835housecleaningservicesdalycity.comGoDaddy.com, LLC20 Sep 20241 Nov 202520 Sep 2025
836housecleaningservicefortlauderdale.comNameCheap, Inc.3 Oct 202414 Nov 20253 Oct 2025
837housecleaningservicesbergencountynj.comCosmotown, Inc.5 Oct 20246 Oct 20255 Oct 2026
838housecleaningservices.ieProtocol Internet Technology Limited T/A Hosting I…4 Dec 20234 Dec 20254 Dec 2026
839housecleaningservice1.onlineNameCheap, Inc.7 Oct 20248 Oct 20257 Oct 2026
840housecleaningservice2.onlineNameCheap, Inc.7 Oct 20248 Oct 20257 Oct 2026
841housecleaningservicesutah.casaNameCheap, Inc.17 Oct 20241 Nov 202517 Oct 2025
842housecleaningservicessaltlake.comNameCheap, Inc.17 Oct 202418 Oct 202517 Oct 2026
843housecleaningservicessaltlakecity.com-5 Jan 20265 Jan 20265 Jan 2027
844housecleaningservices01.todayGoDaddy.com, LLC22 Oct 20243 Dec 202522 Oct 2025
845housecleaningserviceslicensedinsured.comGoogle, Inc.22 Oct 20247 Oct 202522 Oct 2026
846housecleaningservices24.siteDNSPod, Inc.24 Oct 202424 Nov 202524 Oct 2025
847housecleaningservices780.websiteDNSPod, Inc.24 Oct 202425 Oct 202524 Oct 2026
848housecleaningservicesoflosangeles.comNetwork Solutions, LLC24 Oct 20249 Oct 202524 Oct 2026
849housecleaningservicesnewjersey.comCosmotown, Inc.7 Nov 20248 Nov 20257 Nov 2026
850housecleaningservices-gb.todayGoDaddy.com, LLC11 Nov 202423 Nov 202511 Nov 2026
851housecleaningservicestoronto.comGoDaddy.com, LLC19 Nov 202421 Nov 202419 Nov 2027
852housecleaningserviceinabudhabi.comNameCheap, Inc.27 Nov 20248 Jan 202627 Nov 2025
853housecleaningservicesquote.comNameCheap, Inc.6 Dec 202410 Nov 20256 Dec 2026
854housecleaningservicesnearme.co.uk-22 Jan 202522 Jan 202522 Jan 2026
855housecleaningserviceslubbock.comGoDaddy.com, LLC24 Jan 202530 Jan 202624 Jan 2027
856housecleaningservicesc.comGoDaddy.com, LLC25 Jan 202526 Jan 202625 Jan 2027
857housecleaningservicenear.meGoDaddy.com, LLC23 Jun 202328 Jun 202523 Jun 2026
858housecleaningservicesfr2.todayGoDaddy.com, LLC4 Feb 20255 Feb 20264 Feb 2027
859housecleaningservicesteam.co.uk-2 Feb 202518 Jan 20262 Feb 2027
860housecleaningservicessanantonio.comNameCheap, Inc.6 Feb 20257 Jan 20266 Feb 2027
861housecleaningservicemg.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Feb 20258 Feb 20268 Feb 2026
862housecleaningservices.icuTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…10 Feb 202511 Feb 202610 Feb 2027
863housecleaningserviceana.comGoDaddy.com, LLC14 Feb 20259 Jun 202514 Feb 2026
864housecleaningservicesquebec.ca-28 Jan 202429 Dec 202528 Jan 2027
865housecleaningservices123460.icuTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…20 Feb 202513 Mar 202520 Feb 2026
866housecleaningservices240390.icuTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…20 Feb 202513 Mar 202520 Feb 2026
867housecleaningservices308049.icuTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…20 Feb 202513 Mar 202520 Feb 2026
868housecleaningservices946595.icuTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…20 Feb 202513 Mar 202520 Feb 2026
869housecleaningservices136004.icuTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…20 Feb 202513 Mar 202520 Feb 2026
870housecleaningservices527431.icuTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…20 Feb 202513 Mar 202520 Feb 2026
871housecleaningservices-04.todayGoDaddy.com, LLC5 Mar 202510 Mar 20255 Mar 2026
872housecleaningservicesg.comTucows Domains Inc.12 Mar 202512 Mar 202512 Mar 2026
873housecleaningservices148.siteGoDaddy.com, LLC14 Mar 202525 Apr 202514 Mar 2026
874housecleaningserviceslaketahoe.comGoDaddy.com, LLC27 Apr 202527 Apr 202527 Apr 2026
875housecleaningservicesroanoke.comregister.com, Inc.6 May 20256 May 20256 May 2026
876housecleaningservicescottsdale.comNameCheap, Inc.9 May 20259 May 20259 May 2026
877housecleaningserviceraleigh.comCloudFlare, Inc.22 May 202529 May 202522 May 2026
878housecleaningservicepa.comGoogle, Inc.9 Jun 20259 Jun 20259 Jun 2026
879housecleaningserviceva.com-11 Jun 202511 Jun 202511 Jun 2026
880housecleaningservicesmanchester.co.uk-3 Jul 20253 Jul 20253 Jul 2026
881housecleaningservicecharlotte.link-29 Aug 20253 Sep 202529 Aug 2026
882housecleaningservices.com.au--10 Dec 2025-
883housecleaningservicehouston.info-20 Sep 202525 Sep 2025-
884housecleaningservicehouston.link-20 Sep 202525 Sep 202520 Sep 2026
885housecleaningservices.euRealtime Register B.V.---
886housecleaningservicesbeverlyhills.comHostinger, UAB7 Oct 20257 Oct 20257 Oct 2026
887housecleaningservicesnewyork.comPorkbun, LLC13 Oct 202515 Oct 202513 Oct 2026
888housecleaningservicecharlotte.info-29 Aug 202517 Oct 2025-
889housecleaningservicelosangeles.servicesNameCheap, Inc.29 Oct 2025--
890housecleaningservicesbyrosy.comNetwork Solutions, LLC26 Nov 202526 Nov 202526 Nov 2026
891housecleaningservicepro.topPDR Ltd. d/b/a PublicDomainRegistry.com31 Dec 202531 Dec 202531 Dec 2026
892housecleaningservicesplainfieldil.comNameCheap, Inc.7 Jan 20267 Jan 20267 Jan 2027
893housecleaningservicesmissoula.comNameCheap, Inc.16 Jan 202616 Jan 202616 Jan 2027
894housecleaningservices.ca-16 Jan 202621 Jan 202616 Jan 2029
895housecleaningservicesmcllc.comGoDaddy.com, LLC3 Feb 20263 Feb 20263 Feb 2027
896housecleaningservicecmr.comHostinger, UAB7 Feb 20267 Feb 20267 Feb 2027
897housecleaningservice1.comGoogle, Inc.23 Feb 202623 Feb 202623 Feb 2027
898housecleaningservicesnaperville.comNameCheap, Inc.25 Feb 202625 Feb 202625 Feb 2027

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=housecleaningservice

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now