With support for 
Keyword: HANDYMANSERVICES
Reverse Whois » KEYWORD [handymanservices ] { 1,300 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | handymanservices.me | eNom, Inc. | 10 Oct 2024 | 7 Nov 2024 | 10 Oct 2026 |
| 2 | handymanservices.biz | 1API GmbH | 9 Dec 2024 | 5 Feb 2025 | 9 Dec 2025 |
| 3 | handymanservices.xyz | Porkbun, LLC | 5 Mar 2025 | 11 Apr 2025 | 5 Mar 2026 |
| 4 | handymanservices.today | GoDaddy.com, LLC | 3 Aug 2024 | 8 Aug 2024 | 3 Aug 2025 |
| 5 | handymanservices.guru | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 6 | handymanservices.vegas | eNom, Inc. | 15 Sep 2014 | 24 Aug 2017 | 15 Sep 2022 |
| 7 | handymanservices.nyc | GoDaddy.com, LLC | 12 Jun 2023 | 18 Jun 2024 | 12 Jun 2025 |
| 8 | handymanservices.ninja | GoDaddy.com, LLC | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 9 | handymanservices.capetown | DiaMatrix C.C. | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 10 | handymanservices.repair | GoDaddy.com, LLC | 11 Jul 2022 | 7 Sep 2024 | 11 Jul 2026 |
| 11 | handymanservices.website | Domain.com, LLC | 4 Feb 2024 | 20 Mar 2025 | 4 Feb 2025 |
| 12 | handymanservices.help | 1API GmbH | 27 Sep 2024 | 29 Nov 2024 | 27 Sep 2025 |
| 13 | handymanservices.expert | GoDaddy.com, LLC | 30 Aug 2024 | 4 Sep 2024 | 30 Aug 2025 |
| 14 | handymanservices.trade | NameCheap, Inc. | 15 Dec 2016 | 15 Dec 2016 | 14 Dec 2017 |
| 15 | handymanservices.global | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Mar 2015 | 14 Mar 2015 | 14 Mar 2016 |
| 16 | handymanservices.melbourne | Melbourne IT, Ltd | 8 Jan 2017 | 20 Jan 2017 | 8 Jan 2018 |
| 17 | handymanservices.sydney | Synergy Wholesale Pty Ltd | 2 Jul 2023 | 22 Jun 2024 | 2 Jul 2025 |
| 18 | handymanservices.space | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 19 | handymanservices.one | Google, Inc. | 24 Jan 2022 | 14 Jan 2025 | 24 Jan 2026 |
| 20 | handymanservices.mobi | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Mar 2015 | 14 Mar 2015 | 14 Mar 2016 |
| 21 | handymanservices.info | Name.com, Inc. | 6 Mar 2023 | 19 Apr 2025 | 6 Mar 2025 |
| 22 | handymanservices.solutions | GoDaddy.com, LLC | 3 Aug 2024 | 8 Aug 2024 | 3 Aug 2025 |
| 23 | handymanservices.name | - | - | - | - |
| 24 | handymanservices.miami | GoDaddy.com, LLC | 3 Jul 2024 | 23 Apr 2025 | 3 Jul 2025 |
| 25 | handymanservices.directory | GoDaddy.com, LLC | 30 Dec 2015 | 1 Dec 2016 | 30 Dec 2020 |
| 26 | handymanservices.work | GoDaddy.com, LLC | 3 Feb 2016 | 3 Feb 2016 | 3 Feb 2017 |
| 27 | handymanservices.site | Hosting Concepts B.V. dba Openprovider | 16 Jul 2024 | 5 Sep 2024 | 16 Jul 2025 |
| 28 | handymanservices.scot | Mesh Digital Limited | 23 Sep 2014 | 17 Sep 2016 | 23 Sep 2017 |
| 29 | handymanservices.online | GoDaddy.com, LLC | 29 Apr 2024 | 17 Sep 2024 | 29 Apr 2025 |
| 30 | handymanservices.management | GoDaddy.com, LLC | 22 Apr 2014 | 6 Jun 2016 | 22 Apr 2017 |
| 31 | handymanservices.joburg | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Mar 2015 | 14 Mar 2025 | 14 Mar 2026 |
| 32 | handymanservices.com | TurnCommerce, Inc. DBA NameBright.com | 19 Jun 2004 | 3 Nov 2024 | 19 Jun 2026 |
| 33 | handymanservices.net | GoDaddy.com, LLC | 6 Dec 2007 | 22 Jan 2025 | 21 Jan 2028 |
| 34 | handymanservices.org | GoDaddy.com, LLC | 30 Aug 2001 | 14 Oct 2024 | 30 Aug 2025 |
| 35 | handymanservices.tech | NameCheap, Inc. | 15 Dec 2016 | 1 Jan 2018 | 15 Dec 2018 |
| 36 | handymanservices.download | Alpnames Limited | 14 Dec 2016 | 14 Dec 2017 | 13 Dec 2017 |
| 37 | handymanservices.company | GoDaddy.com, LLC | 1 Dec 2023 | 11 May 2024 | 1 Dec 2025 |
| 38 | handymanservices.rocks | Name.com, Inc. | 6 Oct 2017 | 6 Oct 2017 | 6 Oct 2018 |
| 39 | handymanservices.co.uk | - | 19 Mar 2018 | 16 Jun 2024 | 19 Mar 2025 |
| 40 | handymanservices.me.uk | Reserved | 18 Oct 2010 | 17 Oct 2016 | 18 Oct 2018 |
| 41 | handymanservices.org.uk | - | 9 Feb 2016 | 20 Nov 2016 | 9 Feb 2018 |
| 42 | handymanservices.uk | - | 19 Mar 2018 | 16 Jun 2024 | 19 Mar 2025 |
| 43 | handymanservices.club | NameCheap, Inc. | 15 Jun 2020 | 15 Jun 2020 | 15 Jun 2021 |
| 44 | handymanservices.services | - | 19 Jan 2025 | 24 Jan 2025 | 19 Jan 2026 |
| 45 | handymanservices.network | NameCheap, Inc. | 10 Jan 2020 | 15 Jan 2020 | 10 Jan 2021 |
| 46 | handymanservices.pro | Network Solutions, LLC | 2 Dec 2010 | 16 Jan 2025 | 2 Dec 2025 |
| 47 | handymanservices.contractors | NameCheap, Inc. | 28 Nov 2021 | 28 Nov 2021 | 28 Nov 2022 |
| 48 | handymanservices.us | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 7 Jul 2023 | 8 Jul 2024 | 7 Jul 2024 |
| 49 | handymanservices.store | GoDaddy.com, LLC | 29 Apr 2024 | 28 Jul 2024 | 29 Apr 2025 |
| 50 | handymanservices.asia | Mat Bao Trading & Service Company Limited d/b/a Ma… | 30 Nov 2018 | 30 Nov 2023 | 30 Nov 2024 |
| 51 | handymanservices.tel | Name.com, Inc. | 26 Jan 2023 | 20 Jan 2025 | 26 Jan 2026 |
| 52 | handymanservices.ca | - | 24 Jun 2016 | 15 Apr 2025 | 24 Jun 2027 |
| 53 | handymanservices.ae | - | - | - | - |
| 54 | handymanservices.llc | Google, Inc. | 9 Sep 2021 | 30 Aug 2024 | 9 Sep 2025 |
| 55 | handymanservices.ie | - | 11 Sep 2018 | 26 Nov 2021 | 11 Sep 2025 |
| 56 | handymanservices.team | GoDaddy.com, LLC | 15 Apr 2023 | 26 Jun 2024 | 15 Apr 2024 |
| 57 | handymanservices.io | NameCheap, Inc. | 20 Nov 2020 | 4 Jan 2025 | 20 Nov 2025 |
| 58 | handymanservices.london | Mesh Digital Limited | 23 Nov 2016 | 20 Feb 2025 | 23 Nov 2025 |
| 59 | handymanservices.nl | - | 11 Mar 2021 | 24 Apr 2023 | - |
| 60 | handymanservices.shop | GoDaddy.com, LLC | 17 Nov 2022 | 29 Dec 2024 | 17 Nov 2024 |
| 61 | handymanservices.pt | - | - | - | - |
| 62 | handymanservices.industries | Google, Inc. | 1 Jun 2023 | 1 Jun 2024 | 1 Jun 2025 |
| 63 | handymanservices.nz | - | 9 Aug 2015 | 22 Sep 2024 | - |
| 64 | handymanservices.works | Google, Inc. | 19 Jul 2023 | 18 Aug 2024 | 19 Jul 2024 |
| 65 | handymanservices.app | Google, Inc. | 12 Aug 2023 | 4 Aug 2024 | 12 Aug 2025 |
| 66 | handymanservices.construction | Tucows Domains Inc. | 30 Dec 2023 | 20 Dec 2024 | 30 Dec 2025 |
| 67 | handymanservices.com.au | - | - | 6 Feb 2025 | - |
| 68 | handymanservices.email | GoDaddy.com, LLC | 29 Apr 2024 | 4 May 2024 | 29 Apr 2025 |
| 69 | handymanservices.life | GoDaddy.com, LLC | 29 Apr 2024 | 15 Sep 2024 | 29 Apr 2025 |
| 70 | handymanservices.world | GoDaddy.com, LLC | 13 Aug 2024 | 18 Aug 2024 | 13 Aug 2025 |
| 71 | handymanservices.ru | - | 22 Sep 2024 | - | 22 Sep 2025 |
| 72 | handymanservices.agency | GoDaddy.com, LLC | 27 Sep 2024 | 2 Oct 2024 | 27 Sep 2025 |
| 73 | handymanservices.homes | GoDaddy.com, LLC | 27 Sep 2024 | 25 Nov 2024 | 27 Sep 2025 |
| 74 | handymanservices.live | NameCheap, Inc. | 21 Nov 2024 | 26 Nov 2024 | 21 Nov 2025 |
| 75 | handymanservices.zone | eNom, Inc. | 18 Dec 2024 | 23 Dec 2024 | 18 Dec 2025 |
| 76 | handymanservices.wiki | GoDaddy.com, LLC | 28 Feb 2025 | 5 Mar 2025 | 28 Feb 2026 |
| 77 | handymanservices.fun | 1&1 Internet AG | 5 Apr 2025 | 5 Apr 2025 | 5 Apr 2026 |
| 78 | handymanservices.hu | - | 9 Sep 2024 | - | - |
| 79 | handymanservicesd.com | Domaincatcher LLC | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 80 | handymanservicesma.com | Google, Inc. | 28 Oct 2020 | 13 Oct 2024 | 28 Oct 2025 |
| 81 | handymanservicesbybrad.com | Betterthanaveragedomains.com LLC | 14 Feb 2020 | 14 Feb 2020 | 14 Feb 2021 |
| 82 | handymanservicesmarietta.us | GoDaddy.com, LLC | 6 Jun 2014 | 6 Jun 2015 | 5 Jun 2015 |
| 83 | handymanservicesunlimited.com | FastDomain Inc. | 1 Nov 2021 | 1 Nov 2021 | 1 Nov 2022 |
| 84 | handymanservices-4u.com | Domain.com, LLC | 21 Dec 2016 | 24 Dec 2017 | 21 Dec 2017 |
| 85 | handymanservicescapetown.com | GoDaddy.com, LLC | 12 Jun 2014 | 13 Jun 2015 | 12 Jun 2016 |
| 86 | handymanservicesbbrown.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 87 | handymanservicesla.com | NameCheap, Inc. | 5 Aug 2019 | 6 Jul 2024 | 5 Aug 2025 |
| 88 | handymanserviceswichita.com | GoDaddy.com, LLC | 13 Sep 2024 | 13 Sep 2024 | 13 Sep 2025 |
| 89 | handymanservicesbellevuene.com | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 90 | handymanservicesmodesto.com | GoDaddy.com, LLC | 25 Feb 2022 | 8 Apr 2025 | 25 Feb 2025 |
| 91 | handymanservices-911.com | GoDaddy.com, LLC | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2016 |
| 92 | handymanservicesphoenixaz.com | Name.com, Inc. | 27 Jan 2020 | 27 Jan 2020 | 27 Jan 2021 |
| 93 | handymanservicesinfortbend.com | GoDaddy.com, LLC | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 94 | handymanservicesireland.com | enom375, Incorporated | 14 Nov 2018 | 15 Nov 2018 | 14 Nov 2019 |
| 95 | handymanservicesmanchester.com | GoDaddy.com, LLC | 13 Feb 2024 | 1 Feb 2025 | 13 Feb 2026 |
| 96 | handymanservicesorangecounty.com | eNom, Inc. | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 97 | handymanservicesatlanta.com | Dynadot, LLC | 21 Mar 2021 | 22 Mar 2025 | 21 Mar 2026 |
| 98 | handymanservices4u.net | 1&1 Internet AG | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 99 | handymanservicesmurfreesboro.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 100 | handymanservicesrockledge.com | eNom, Inc. | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 101 | handymanservicesclevelandtx.com | GoDaddy.com, LLC | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 102 | handymanserviceskagitcounty.com | Tucows Domains Inc. | 10 Sep 2011 | 15 Sep 2014 | 10 Sep 2015 |
| 103 | handymanservicesrunningsprings.com | GoDaddy.com, LLC | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 104 | handymanservicesarlington.com | Beijing Lanhai Jiye Technology Co., Ltd | 3 Apr 2021 | 4 Apr 2025 | 3 Apr 2026 |
| 105 | handymanservicesmarvin.com | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 106 | handymanserviceswashingtondc.com | eNom, Inc. | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2017 |
| 107 | handymanservicesterling.com | GoDaddy.com, LLC | 17 Sep 2014 | 9 Sep 2016 | 17 Sep 2017 |
| 108 | handymanservicesjacksonville.com | GoDaddy.com, LLC | 8 Mar 2023 | 28 Feb 2025 | 8 Mar 2026 |
| 109 | handymanservicesnewrochelle.com | GoDaddy.com, LLC | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 110 | handymanservicesnaplesfl.com | GoDaddy.com, LLC | 8 Sep 2014 | 5 Sep 2016 | 8 Sep 2017 |
| 111 | handymanserviceshagerstownmd.com | Tucows Domains Inc. | 30 Sep 2012 | 4 Oct 2014 | 30 Sep 2015 |
| 112 | handymanservicesescondido.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 113 | handymanservicesbyben.mobi | eNom, Inc. | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 114 | handymanservicesbyjack.com | GoDaddy.com, LLC | 22 Sep 2014 | 3 Oct 2023 | 22 Sep 2025 |
| 115 | handymanservicesdenver.com | FastDomain Inc. | 2 Jul 2016 | 28 May 2017 | 2 Jul 2018 |
| 116 | handymanservicesofvermont.com | Tucows Domains Inc. | 24 Sep 2010 | 27 Sep 2014 | 24 Sep 2015 |
| 117 | handymanservicesatlantaga.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Apr 2017 | 28 Jun 2017 | 28 Apr 2018 |
| 118 | handymanservicesftlauderdale.com | Tucows Domains Inc. | 22 Sep 2010 | 25 Sep 2014 | 22 Sep 2015 |
| 119 | handymanservicesforaustinmetroplex.com | GoDaddy.com, LLC | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2016 |
| 120 | handymanservicesforaustinmetroplex.net | GoDaddy.com, LLC | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 121 | handymanservicesalbuquerque.com | GoDaddy.com, LLC | 4 Jul 2024 | 31 Dec 2024 | 4 Jul 2025 |
| 122 | handymanserviceslasvegas.net | NameCheap, Inc. | 20 Sep 2024 | 31 Dec 2024 | 20 Sep 2025 |
| 123 | handymanservicesdurham.com | register.com, Inc. | 19 Jan 2023 | 30 Dec 2024 | 19 Jan 2026 |
| 124 | handymanservicesmemphis.com | LiquidNet Ltd. | 8 Dec 2014 | 3 Nov 2024 | 8 Dec 2025 |
| 125 | handymanserviceswashington.com | Name.com, Inc. | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 126 | handymanservicesportsmouth.com | GoDaddy.com, LLC | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 127 | handymanservicesanantoniotexas.com | eNom, Inc. | 11 Dec 2014 | 29 Nov 2016 | 11 Dec 2017 |
| 128 | handymanservicesorlandofl.com | GoDaddy.com, LLC | 5 May 2020 | 5 May 2020 | 5 May 2021 |
| 129 | handymanservicesdresden.com | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 130 | handymanservicesbybrianalleyne.com | register.com, Inc. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 131 | handymanservicescoloradosprings.net | Name.com, Inc. | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 132 | handymanservicesilverspring.com | GoDaddy.com, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 133 | handymanserviceswoodstock.com | GoDaddy.com, LLC | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 134 | handymanservicesva.com | 1&1 Internet AG | 30 Dec 2014 | 31 May 2017 | 30 Dec 2017 |
| 135 | handymanservicesanfrancisco.com | NameCheap, Inc. | 31 Dec 2014 | 1 Dec 2024 | 31 Dec 2025 |
| 136 | handymanservicesinmonroemi.info | GoDaddy.com, LLC | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 137 | handymanservicesindundeemi.info | GoDaddy.com, LLC | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 138 | handymanservicesofwilmington.com | GoDaddy.com, LLC | 16 Feb 2017 | 16 Feb 2017 | 16 Feb 2018 |
| 139 | handymanservicesnottingham.com | Tucows Domains Inc. | 13 Aug 2015 | 17 Aug 2019 | 13 Aug 2019 |
| 140 | handymanserviceslongmont.com | Name.com, Inc. | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 141 | handymanservicesboulder.com | GoDaddy.com, LLC | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 142 | handymanservicesavon.com | Name.com, Inc. | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 143 | handymanservices24.com | Webfusion Ltd. | 29 Mar 2016 | 9 Apr 2024 | 29 Mar 2025 |
| 144 | handymanserviceslascruces.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2017 |
| 145 | handymanservicesgreenvillenorthcarolina.com | GoDaddy.com, LLC | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 146 | handymanservicesri.com | eNom, Inc. | 18 Jan 2015 | 18 Jan 2015 | 18 Jan 2016 |
| 147 | handymanservices3000.com | FastDomain Inc. | 21 Jan 2015 | 21 Jan 2017 | 21 Jan 2018 |
| 148 | handymanserviceslouisville.com | GoDaddy.com, LLC | 8 Aug 2019 | 8 Aug 2019 | 8 Aug 2020 |
| 149 | handymanserviceshatboro.com | eNom, Inc. | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 150 | handymanservicessarasota.com | GoDaddy.com, LLC | 15 Feb 2017 | 16 Feb 2025 | 15 Feb 2026 |
| 151 | handymanserviceschicago.com | GoDaddy.com, LLC | 10 Dec 2018 | 11 Dec 2024 | 10 Dec 2025 |
| 152 | handymanservicessanantonio.net | Name.com, Inc. | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 153 | handymanservicestx.com | GoDaddy.com, LLC | 8 Nov 2023 | 9 Nov 2024 | 8 Nov 2025 |
| 154 | handymanservicesandmore.com | NameCheap, Inc. | 15 Oct 2024 | 16 Oct 2024 | 15 Oct 2025 |
| 155 | handymanserviceshoustontx.com | GoDaddy.com, LLC | 10 Jun 2020 | 11 Jun 2024 | 10 Jun 2025 |
| 156 | handymanservicesa.com | GoDaddy.com, LLC | 24 Oct 2023 | 5 Dec 2024 | 24 Oct 2024 |
| 157 | handymanserviceseagle.com | DreamHost, LLC | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 158 | handymanservicesarlingtontx.com | Tucows Domains Inc. | 17 Aug 2011 | 21 Aug 2015 | 17 Aug 2016 |
| 159 | handymanservicesfairview.com | eNom, Inc. | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 160 | handymanservicesofgeorgia.com | Launchpad, Inc. | 13 Feb 2015 | 29 Jan 2025 | 13 Feb 2026 |
| 161 | handymanservicessacramento.net | Name.com, Inc. | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 162 | handymanservicesaintlouismo.com | eNom, Inc. | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 163 | handymanservicesknoxville.com | GoDaddy.com, LLC | 20 Feb 2015 | 20 Feb 2015 | 20 Feb 2016 |
| 164 | handymanservicesservingmississauga.com | Tucows Domains Inc. | 19 Feb 2014 | 23 Feb 2018 | 19 Feb 2018 |
| 165 | handymanservicesclarksville.com | Name.com, Inc. | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 166 | handymanservicespricing.com | Register.ca Inc. | 26 Feb 2012 | 2 Mar 2021 | 26 Feb 2021 |
| 167 | handymanservicestacoma.com | GoDaddy.com, LLC | 11 Feb 2025 | 11 Feb 2025 | 11 Feb 2026 |
| 168 | handymanservicestarponsprings.com | GoDaddy.com, LLC | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 169 | handymanservicesdenville.com | GoDaddy.com, LLC | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 170 | handymanservicesalpine.com | eNom, Inc. | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2016 |
| 171 | handymanservices999.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Jul 2016 | 1 Sep 2017 | 21 Jul 2017 |
| 172 | handymanservicesyracuse.com | Name.com, Inc. | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 173 | handymanservicesinpontevedrabeachfl.com | eNom, Inc. | 25 Aug 2015 | 27 Jul 2016 | 25 Aug 2016 |
| 174 | handymanserviceseasthampton.com | GoDaddy.com, LLC | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 175 | handymanservicesinnapervilleil.com | NameCheap, Inc. | 17 Mar 2015 | 18 Mar 2024 | 17 Mar 2025 |
| 176 | handymanservicessanjose.com | GoDaddy.com, LLC | 3 Aug 2022 | 14 Sep 2024 | 3 Aug 2024 |
| 177 | handymanserviceselizabeth.com | GoDaddy.com, LLC | 30 Jan 2023 | 12 Mar 2024 | 30 Jan 2024 |
| 178 | handymanservicesfortlauderdale.com | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2017 |
| 179 | handymanservicessugarland.com | Name.com, Inc. | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 180 | handymanservicesmaryland.com | Dynadot, LLC | 14 Feb 2023 | 25 Apr 2024 | 14 Feb 2024 |
| 181 | handymanservicestampabay.com | GoDaddy.com, LLC | 15 Apr 2015 | 15 Apr 2015 | 15 Apr 2016 |
| 182 | handymanserviceshinesville.com | Name.com, Inc. | 28 Apr 2017 | 26 Sep 2017 | 28 Apr 2018 |
| 183 | handymanservices1.com | Network Solutions, LLC | 15 Apr 2015 | 28 Jun 2024 | 15 Apr 2024 |
| 184 | handymanservicesdothanal.com | Tucows Domains Inc. | 3 Sep 2010 | 7 Sep 2015 | 3 Sep 2016 |
| 185 | handymanservicesarizona.com | - | 9 Aug 2016 | 9 Aug 2016 | 9 Aug 2017 |
| 186 | handymanservicespro.com | NameCheap, Inc. | 24 Apr 2021 | 25 Mar 2024 | 24 Apr 2025 |
| 187 | handymanservicesdelmarva.com | GoDaddy.com, LLC | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 188 | handymanservicessimpsonville.com | Name.com, Inc. | 27 Apr 2015 | 29 Mar 2017 | 27 Apr 2018 |
| 189 | handymanservicescottsdale.com | EvoPlus Ltd. | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2016 |
| 190 | handymanservicesinsanantoniotx.com | NameCheap, Inc. | 8 Sep 2015 | 8 Aug 2019 | 8 Sep 2020 |
| 191 | handymanservicesfortmyers.com | GoDaddy.com, LLC | 31 Aug 2021 | 1 Sep 2024 | 31 Aug 2025 |
| 192 | handymanservicesanderson.com | GoDaddy.com, LLC | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 193 | handymanservicesallegan.com | - | - | - | - |
| 194 | handymanservicessugarland.net | Name.com, Inc. | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 195 | handymanservicesuk.com | GoDaddy.com, LLC | 12 Feb 2023 | 25 Apr 2024 | 12 Feb 2024 |
| 196 | handymanservicesjim.com | GoDaddy.com, LLC | 11 May 2015 | 12 May 2015 | 11 May 2016 |
| 197 | handymanservicesnaples.com | Tucows Domains Inc. | 13 May 2015 | 13 May 2015 | 13 May 2017 |
| 198 | handymanserviceslasvegasnevada.com | eNom, Inc. | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 199 | handymanservicesinc.com | Google, Inc. | 6 May 2025 | 6 May 2025 | 6 May 2026 |
| 200 | handymanservicesroyaloak.com | GoDaddy.com, LLC | 23 May 2015 | 23 May 2015 | 23 May 2016 |
| 201 | handymanservicesnearme.com | Google, Inc. | 23 May 2015 | 28 May 2024 | 23 May 2025 |
| 202 | handymanservicescovington.com | Name.com, Inc. | 26 May 2015 | 26 May 2015 | 26 May 2016 |
| 203 | handymanservicesspringfield.com | Name.com, Inc. | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 204 | handymanservicesinwhitelakemi.com | eNom, Inc. | 14 Sep 2015 | 14 Sep 2015 | 14 Sep 2017 |
| 205 | handymanservicescorp.com | Wild West Domains, LLC | 5 Nov 2023 | 6 Nov 2024 | 5 Nov 2025 |
| 206 | handymanservicesmogadore.com | Name.com, Inc. | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 207 | handymanservicesgta.com | Dynadot, LLC | 11 Oct 2023 | 21 Dec 2024 | 11 Oct 2024 |
| 208 | handymanservicesbyralph.net | Tucows Domains Inc. | 13 Sep 2010 | 17 Sep 2015 | 13 Sep 2016 |
| 209 | handymanserviceswirral.com | Wild West Domains, LLC | 9 Jun 2015 | 9 Jun 2015 | 9 Jun 2016 |
| 210 | handymanservicespringfield.com | GoDaddy.com, LLC | 26 Jul 2021 | 26 Jul 2021 | 26 Jul 2022 |
| 211 | handymanservicesjunctioncity.com | GoDaddy.com, LLC | 11 Sep 2020 | 11 Sep 2020 | 11 Sep 2021 |
| 212 | handymanservices4you.com | Automattic Inc. | 15 Jun 2015 | 11 Apr 2025 | 15 Jun 2026 |
| 213 | handymanservicespageland.com | Name.com, Inc. | 17 Jun 2015 | 17 Jun 2015 | 17 Jun 2016 |
| 214 | handymanservicesandcity.com | Name.com, Inc. | 17 Jun 2015 | 17 Jun 2015 | 17 Jun 2016 |
| 215 | handymanservicessewi.com | GoDaddy.com, LLC | 24 Jan 2023 | 6 Apr 2024 | 24 Jan 2024 |
| 216 | handymanservicesfarrockaway.com | Name.com, Inc. | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 217 | handymanservicesbellevuewa.com | eNom, Inc. | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 218 | handymanservicesnewboston.com | Tucows Domains Inc. | 18 Jun 2014 | 22 Jun 2015 | 18 Jun 2016 |
| 219 | handymanservicespringfieldor.com | eNom, Inc. | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2016 |
| 220 | handymanserviceselpaso.com | Dynadot, LLC | 3 Mar 2022 | 13 May 2023 | 3 Mar 2023 |
| 221 | handymanserviceseugene.com | GoDaddy.com, LLC | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 222 | handymanservicesclermont.com | Name.com, Inc. | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 223 | handymanservices-therenaissanceman.com | - | 22 Sep 2015 | 22 Sep 2015 | 22 Sep 2017 |
| 224 | handymanservicessedrowoolleywa.com | Tucows Domains Inc. | 26 Jun 2015 | 30 Jun 2017 | 26 Jun 2017 |
| 225 | handymanservicesglencove.com | Name.com, Inc. | 26 Jun 2015 | 26 Jun 2015 | 26 Jun 2016 |
| 226 | handymanservicesofnewcumberland.com | Name.com, Inc. | 26 Jun 2014 | 28 Jun 2015 | 26 Jun 2016 |
| 227 | handymanservices27.com | Tucows Domains Inc. | 29 Jun 2014 | 3 Jul 2015 | 29 Jun 2016 |
| 228 | handymanservicesmilton.com | GoDaddy.com, LLC | 6 Jul 2015 | 6 Jul 2015 | 6 Jul 2016 |
| 229 | handymanservicesal.com | eNom, Inc. | 22 Jul 2015 | 22 Jul 2015 | 22 Jul 2016 |
| 230 | handymanservicesnj.net | eNom, Inc. | 22 Jul 2015 | 22 Jul 2015 | 22 Jul 2016 |
| 231 | handymanservicessummerville.com | Name.com, Inc. | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 232 | handymanserviceslosangeles.com | DropCatch.com 1208 LLC | 20 Nov 2023 | 31 Dec 2024 | 20 Nov 2024 |
| 233 | handymanservicesathens.com | Name.com, Inc. | 29 Sep 2015 | 29 Sep 2015 | 29 Sep 2016 |
| 234 | handymanservicesforyourhome.com | GoDaddy.com, LLC | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2017 |
| 235 | handymanservicesg.com | NameCheap, Inc. | 9 Mar 2024 | 15 Mar 2025 | 9 Mar 2026 |
| 236 | handymanservicesbydave.com | register.com, Inc. | 7 Aug 2015 | 9 Feb 2017 | 7 Aug 2017 |
| 237 | handymanservicesquad.com | Realtime Register B.V. | 24 Nov 2022 | 7 Jan 2024 | 24 Nov 2023 |
| 238 | handymanservicesofwisconsin.com | GoDaddy.com, LLC | 7 Aug 2015 | 7 Aug 2015 | 7 Aug 2016 |
| 239 | handymanservicesmayflower.com | Name.com, Inc. | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 240 | handymanservicesleeds.com | Tucows Domains Inc. | 12 Oct 2013 | 16 Oct 2015 | 12 Oct 2016 |
| 241 | handymanservicesfranchise.com | Porkbun, LLC | 5 Dec 2022 | 22 Nov 2024 | 5 Dec 2025 |
| 242 | handymanservicesplus.com | DropCatch.com 1208 LLC | 16 Jan 2018 | 16 Jan 2018 | 16 Jan 2019 |
| 243 | handymanserviceslivonia.com | Wild West Domains, LLC | 29 Oct 2015 | 29 Oct 2015 | 29 Oct 2016 |
| 244 | handymanservicesgainesville.com | Name.com, Inc. | 4 Nov 2015 | 6 Oct 2018 | 4 Nov 2019 |
| 245 | handymanservicesottawa.com | Namesilo, LLC | 24 Jul 2024 | 24 Jul 2024 | 24 Jul 2025 |
| 246 | handymanservicesalexandria.com | GoDaddy.com, LLC | 23 Sep 2019 | 23 Sep 2019 | 23 Sep 2020 |
| 247 | handymanservicesinwestminsterco.com | eNom, Inc. | 20 Nov 2015 | 20 Nov 2015 | 20 Nov 2016 |
| 248 | handymanservicesspringfieldil.com | GoDaddy.com, LLC | 30 Nov 2015 | 30 Nov 2015 | 30 Nov 2016 |
| 249 | handymanservicesbusinesssoftware.com | GoDaddy.com, LLC | 4 Dec 2015 | 4 Dec 2015 | 4 Dec 2016 |
| 250 | handymanservicesandiego.net | Name.com, Inc. | 10 Dec 2015 | 10 Dec 2015 | 10 Dec 2016 |
| 251 | handymanservicessouthflorida.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 13 Dec 2015 | 13 Dec 2015 | 13 Dec 2016 |
| 252 | handymanservices4u.com | GoDaddy.com, LLC | 8 Dec 2024 | 8 Dec 2024 | 8 Dec 2025 |
| 253 | handymanservicesms.com | GoDaddy.com, LLC | 11 Sep 2019 | 12 Sep 2024 | 11 Sep 2025 |
| 254 | handymanservicessource.xyz | TLD Registrar Solutions Ltd. | 31 Dec 2015 | 6 Jan 2016 | 31 Dec 2016 |
| 255 | handymanservicesbrooklynny.com | GoDaddy.com, LLC | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2018 |
| 256 | handymanservicescombs.com | Name.com, Inc. | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 257 | handymanserviceslondon.com | GoDaddy.com, LLC | 28 Aug 2024 | 21 Sep 2024 | 28 Aug 2025 |
| 258 | handymanservicesanrafael.com | eNom, Inc. | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 259 | handymanserviceslynchburg.com | GoDaddy.com, LLC | 19 Jan 2016 | 19 Jan 2016 | 19 Jan 2017 |
| 260 | handymanservicesmumbai.com | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 261 | handymanserviceskolkata.com | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 262 | handymanservicesindia.com | GoDaddy.com, LLC | 2 Sep 2018 | 2 Sep 2018 | 2 Sep 2020 |
| 263 | handymanserviceshyderabad.com | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 264 | handymanservicesdelhi.com | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 265 | handymanserviceschennai.com | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 266 | handymanservicesbangalore.com | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 267 | handymanservicesahmedabad.com | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 268 | handymanservicesdansville.com | Name.com, Inc. | 4 Feb 2016 | 4 Feb 2016 | 4 Feb 2017 |
| 269 | handymanservices0516.com | Tucows Domains Inc. | 7 Feb 2016 | 11 Feb 2017 | 7 Feb 2017 |
| 270 | handymanservicesilwi.com | Tucows Domains Inc. | 4 Feb 2011 | 8 Feb 2016 | 4 Feb 2017 |
| 271 | handymanservicesofnj.com | GoDaddy.com, LLC | 4 Sep 2024 | 4 Sep 2024 | 4 Sep 2025 |
| 272 | handymanserviceshoustontexas.com | eNom, Inc. | 17 Feb 2016 | 17 Feb 2016 | 17 Feb 2017 |
| 273 | handymanservicesdefuniaksprings.com | Name.com, Inc. | 22 Feb 2016 | 22 Feb 2016 | 22 Feb 2017 |
| 274 | handymanservicestarzana.com | Name.com, Inc. | 23 Feb 2016 | 23 Feb 2016 | 23 Feb 2017 |
| 275 | handymanservicessaintpaul.net | Name.com, Inc. | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 276 | handymanservicesnashvillenc.com | eNom, Inc. | 29 Feb 2016 | 29 Feb 2016 | 28 Feb 2017 |
| 277 | handymanservicesbaycity.com | GoDaddy.com, LLC | 29 Feb 2016 | 29 Feb 2016 | 28 Feb 2017 |
| 278 | handymanservicesofsouthnewjersey.com | GoDaddy.com, LLC | 4 Mar 2016 | 16 May 2024 | 4 Mar 2024 |
| 279 | handymanservicesincolumbus.com | Tucows Domains Inc. | 5 Mar 2013 | 9 Mar 2016 | 5 Mar 2017 |
| 280 | handymanservicescentralcoast.com | GoDaddy.com, LLC | 11 Mar 2016 | 11 Mar 2016 | 11 Mar 2017 |
| 281 | handymanservicesutah.com | Dynadot, LLC | 12 Mar 2021 | 12 Mar 2021 | 12 Mar 2022 |
| 282 | handymanservicescalifornia.com | GoDaddy.com, LLC | 18 Mar 2016 | 18 Mar 2016 | 18 Mar 2017 |
| 283 | handymanservicesugarland.com | Name.com, Inc. | 21 Mar 2016 | 21 Mar 2016 | 21 Mar 2017 |
| 284 | handymanservicestemecula.com | GoDaddy.com, LLC | 24 Mar 2016 | 24 Mar 2016 | 24 Mar 2017 |
| 285 | handymanservices24.website | - | 29 Mar 2016 | 29 Mar 2016 | 29 Mar 2017 |
| 286 | handymanservicesgarland.com | Name.com, Inc. | 31 Mar 2016 | 31 Mar 2016 | 31 Mar 2017 |
| 287 | handymanservicesinny.com | Network Solutions, LLC | 8 Apr 2016 | 8 Apr 2016 | 8 Apr 2019 |
| 288 | handymanservicesangabriel.com | Name.com, Inc. | 11 Apr 2016 | 11 Apr 2016 | 11 Apr 2017 |
| 289 | handymanservicesplusllc.com | GoDaddy.com, LLC | 18 Apr 2016 | 22 Apr 2025 | 18 Apr 2026 |
| 290 | handymanservicesbradenton.com | GoDaddy.com, LLC | 30 Apr 2024 | 30 Apr 2024 | 30 Apr 2025 |
| 291 | handymanservicesriverside.com | Name.com, Inc. | 22 Apr 2016 | 22 Apr 2016 | 22 Apr 2017 |
| 292 | handymanservicessomervilletx.com | GoDaddy.com, LLC | 25 Apr 2016 | 25 Apr 2016 | 25 Apr 2017 |
| 293 | handymanservicesga.com | Namesilo, LLC | 13 Apr 2023 | 18 Mar 2025 | 13 Apr 2026 |
| 294 | handymanservicesaz.com | GoDaddy.com, LLC | 25 Apr 2016 | 26 Apr 2025 | 25 Apr 2026 |
| 295 | handymanservicessingapore.org | eNom, Inc. | 25 Apr 2016 | 26 Mar 2017 | 25 Apr 2018 |
| 296 | handymanservicescarthage.com | GoDaddy.com, LLC | 3 Aug 2022 | 15 Oct 2023 | 3 Aug 2023 |
| 297 | handymanservicessoddydaisy.com | Name.com, Inc. | 3 May 2016 | 3 May 2016 | 3 May 2017 |
| 298 | handymanservicesalem.com | Tucows Domains Inc. | 2 May 2011 | 2 May 2011 | 2 May 2017 |
| 299 | handymanservicesrus.com | GoDaddy.com, LLC | 6 May 2016 | 6 May 2016 | 6 May 2017 |
| 300 | handymanserviceslapuente.com | Namesilo, LLC | 9 Aug 2017 | 10 Aug 2017 | 9 Aug 2018 |
| 301 | handymanservicesirving.com | Name.com, Inc. | 10 May 2016 | 10 May 2016 | 10 May 2017 |
| 302 | handymanserviceswilmington.com | GoDaddy.com, LLC | 21 Jul 2021 | 21 Jul 2021 | 21 Jul 2022 |
| 303 | handymanservicesfortwhite.com | Name.com, Inc. | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 304 | handymanservicessouthernpines.com | Name.com, Inc. | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 305 | handymanservicesnorthwoods.com | Tucows Domains Inc. | 26 May 2016 | 30 May 2017 | 26 May 2017 |
| 306 | handymanservicesedinburgh.com | GoDaddy.com, LLC | 23 Feb 2022 | 7 May 2023 | 23 Feb 2023 |
| 307 | handymanservicessalinas.com | eNom, Inc. | 31 May 2016 | 31 May 2016 | 31 May 2017 |
| 308 | handymanservicesmi.com | GoDaddy.com, LLC | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 309 | handymanservicesgroup.net | NetRegistry Pty Ltd. | 9 Jun 2016 | 9 May 2017 | 9 Jun 2018 |
| 310 | handymanservicesforyoufirst.com | GoDaddy.com, LLC | 16 Jun 2016 | 16 Jun 2016 | 16 Jun 2017 |
| 311 | handymanservicesantabarbara.com | Name.com, Inc. | 16 Jun 2016 | 16 Jun 2016 | 16 Jun 2017 |
| 312 | handymanservicestreamwoodil.com | register.com, Inc. | 18 Jun 2016 | 18 Jun 2016 | 18 Jun 2017 |
| 313 | handymanservicesoncall.com | GoDaddy.com, LLC | 19 Jun 2016 | 6 Jun 2024 | 19 Jun 2025 |
| 314 | handymanservicesprescott.com | Wild West Domains, LLC | 23 Jun 2016 | 23 Jun 2024 | 23 Jun 2025 |
| 315 | handymanservicesng.com | Domain.com, LLC | 22 Jun 2016 | 22 Jun 2016 | 22 Jun 2017 |
| 316 | handymanserviceslasvegasnv.com | GoDaddy.com, LLC | 8 Dec 2018 | 9 Dec 2024 | 8 Dec 2025 |
| 317 | handymanservicesroundrock.com | Tucows Domains Inc. | 20 Dec 2016 | 24 Dec 2018 | 20 Dec 2018 |
| 318 | handymanservicesbycarl.com | GoDaddy.com, LLC | 8 Jun 2016 | 8 Jun 2016 | 8 Jun 2017 |
| 319 | handymanservicesbristow.com | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 320 | handymanservicesvirginia.com | FastDomain Inc. | 25 Jul 2016 | 27 Aug 2017 | 25 Jul 2017 |
| 321 | handymanservicesfarmersville.com | - | 26 Jul 2016 | 26 Jul 2016 | 26 Jul 2017 |
| 322 | handymanservicespensacola.com | Namesilo, LLC | 6 Aug 2016 | 8 Sep 2017 | 6 Aug 2017 |
| 323 | handymanservicesbyjohn.com | FastDomain Inc. | 7 Aug 2016 | 22 Jul 2017 | 7 Aug 2018 |
| 324 | handymanservicesfrisco.com | GoDaddy.com, LLC | 12 Mar 2022 | 2 Oct 2022 | 12 Mar 2027 |
| 325 | handymanservicescollincounty.com | - | 19 Aug 2016 | 19 Aug 2016 | 19 Aug 2017 |
| 326 | handymanservicesdfw.com | Automattic Inc. | 5 Mar 2024 | 16 Apr 2025 | 5 Mar 2026 |
| 327 | handymanservicesplano.com | GoDaddy.com, LLC | 11 Jul 2020 | 11 Jul 2020 | 11 Jul 2021 |
| 328 | handymanservicessanantonio.com | GoDaddy.com, LLC | 17 Sep 2021 | 5 Oct 2023 | 17 Sep 2025 |
| 329 | handymanservices-arnie.com | Tucows Domains Inc. | 15 May 2012 | 25 Jun 2024 | 15 May 2024 |
| 330 | handymanservicesca.com | GoDaddy.com, LLC | 18 Jun 2024 | 18 Jun 2024 | 18 Jun 2025 |
| 331 | handymanservicess.com | Wix.com Ltd. | 6 Jan 2025 | 6 Jan 2025 | 6 Jan 2026 |
| 332 | handymanserviceslasvegas.com | GoDaddy.com, LLC | 3 Nov 2008 | 4 Nov 2024 | 3 Nov 2025 |
| 333 | handymanservicestoronto.com | Dynadot, LLC | 27 Sep 2024 | 27 Sep 2024 | 27 Sep 2025 |
| 334 | handymanserviceslakeorion.com | GoDaddy.com, LLC | 25 Apr 2011 | 19 Apr 2015 | 25 Apr 2017 |
| 335 | handymanservices247.com | 1&1 Internet AG | 29 Dec 2011 | 13 Mar 2025 | 29 Dec 2024 |
| 336 | handymanserviceswailuku.com | - | 10 Oct 2024 | 8 Apr 2025 | 10 Oct 2025 |
| 337 | handymanservicesmichigan.com | GoDaddy.com, LLC | 20 Oct 2010 | 21 Oct 2024 | 20 Oct 2025 |
| 338 | handymanservices-az85296.com | register.com, Inc. | 13 Aug 2012 | 15 Aug 2016 | 13 Aug 2017 |
| 339 | handymanservicesmiami.com | GoDaddy.com, LLC | 6 Nov 2008 | 6 Nov 2024 | 6 Nov 2025 |
| 340 | handymanservicesoftware.com | Network Solutions, LLC | 15 Oct 2007 | 16 Aug 2021 | 15 Oct 2026 |
| 341 | handymanservicesmelbourne.com | Crazy Domains FZ-LLC | 3 Dec 2013 | 14 Dec 2017 | 3 Dec 2017 |
| 342 | handymanservicesbybobfraser.com | Wild West Domains, LLC | 25 Aug 2016 | 25 Aug 2016 | 25 Aug 2017 |
| 343 | handymanservicesusa.com | NameCheap, Inc. | 10 Dec 2024 | 10 Dec 2024 | 10 Dec 2025 |
| 344 | handymanservicesofcentralflorida.com | GoDaddy.com, LLC | 8 May 2013 | 9 May 2024 | 8 May 2026 |
| 345 | handymanservicessingapore.com | Crazy Domains FZ-LLC | 30 Mar 2021 | 1 Mar 2025 | 30 Mar 2027 |
| 346 | handymanserviceslive.com | Namesilo, LLC | 10 Apr 2012 | 14 Oct 2017 | 10 Apr 2018 |
| 347 | handymanservicesgroup.com | Melbourne IT, Ltd | 7 Jun 2018 | 30 May 2024 | 7 Jun 2025 |
| 348 | handymanservicesnc.com | GoDaddy.com, LLC | 12 Sep 2023 | 13 Sep 2024 | 12 Sep 2025 |
| 349 | handymanservices-ca.com | Namesilo, LLC | 15 Jan 2021 | 20 Mar 2024 | 15 Jan 2024 |
| 350 | handymanservicesperth.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 May 2023 | 13 May 2024 | 24 May 2025 |
| 351 | handymanservicesanantonio.com | GoDaddy.com, LLC | 20 Sep 2020 | 20 Sep 2020 | 20 Sep 2021 |
| 352 | handymanservicesoflongbeach.com | eNom, Inc. | 5 Nov 2010 | 7 Oct 2015 | 5 Nov 2016 |
| 353 | handymanservicesbrooklyn.com | Name.com, Inc. | 15 Oct 2012 | 17 Oct 2024 | 15 Oct 2025 |
| 354 | handymanservicesfarmingtonhills.com | GoDaddy.com, LLC | 3 Jan 2011 | 4 Jan 2018 | 3 Jan 2019 |
| 355 | handymanservicesbyd.com | GoDaddy.com, LLC | 11 Jul 2013 | 11 Jul 2016 | 11 Jul 2017 |
| 356 | handymanservicesinhouston.com | FastDomain Inc. | 31 Aug 2019 | 31 Aug 2019 | 31 Aug 2020 |
| 357 | handymanservicesofkaty.com | GoDaddy.com, LLC | 21 Mar 2013 | 2 Apr 2016 | 21 Mar 2017 |
| 358 | handymanservicescanton.com | GoDaddy.com, LLC | 18 Apr 2010 | 3 May 2016 | 18 Apr 2017 |
| 359 | handymanservicesannarbor.com | FastDomain Inc. | 29 Aug 2011 | 14 Aug 2024 | 29 Aug 2025 |
| 360 | handymanservicesbydon.com | Tucows Domains Inc. | 26 Apr 2013 | 30 Apr 2019 | 26 Apr 2019 |
| 361 | handymanservicesonline.com | Beijing Lanhai Jiye Technology Co., Ltd | 12 Apr 2023 | 13 Apr 2025 | 12 Apr 2026 |
| 362 | handymanservices609.com | PSI-USA, Inc. dba Domain Robot | 7 Apr 2021 | 8 Apr 2021 | 7 Apr 2022 |
| 363 | handymanservicesbymike.com | CloudFlare, Inc. | 10 May 2023 | 10 Apr 2025 | 10 May 2026 |
| 364 | handymanserviceslongbeach.com | - | 18 Oct 2023 | 1 Jan 2025 | 18 Oct 2024 |
| 365 | handymanserviceshyattsville.com | Name.com, Inc. | 19 Nov 2012 | 25 Sep 2017 | 19 Nov 2017 |
| 366 | handymanservicescorbin.com | GoDaddy.com, LLC | 1 Apr 2014 | 16 Apr 2025 | 15 Apr 2026 |
| 367 | handymanservicesindianapolis.com | GoDaddy.com, LLC | 24 Sep 2010 | 17 Oct 2024 | 24 Sep 2026 |
| 368 | handymanservicesllc.com | NameCheap, Inc. | 7 Mar 2025 | 7 Mar 2025 | 7 Mar 2026 |
| 369 | handymanservicesofct.com | GoDaddy.com, LLC | 2 Jun 2006 | 4 Mar 2025 | 2 Jun 2026 |
| 370 | handymanservicesaustin.com | Tucows Domains Inc. | 25 Sep 2010 | 10 Sep 2024 | 25 Sep 2025 |
| 371 | handymanservicesbirmingham.com | Tucows Domains Inc. | 25 Nov 2012 | 29 Nov 2020 | 25 Nov 2020 |
| 372 | handymanservicesdir.com | Name.com, Inc. | 3 Jun 2004 | 31 May 2024 | 3 Jun 2025 |
| 373 | handymanservicessaintpaul.com | GoDaddy.com, LLC | 9 May 2024 | 10 May 2024 | 9 May 2025 |
| 374 | handymanservicesremodelingjohnfarrug.com | Tucows Domains Inc. | 9 Jan 2012 | 13 Jan 2020 | 9 Jan 2020 |
| 375 | handymanservicesmadison.com | eNom, Inc. | 5 Nov 2013 | 10 Oct 2017 | 5 Nov 2018 |
| 376 | handymanservicespr.com | GoDaddy.com, LLC | 7 Mar 2021 | 12 Mar 2025 | 7 Mar 2026 |
| 377 | handymanservicesraleigh.com | GoDaddy.com, LLC | 13 Sep 2023 | 18 Sep 2024 | 13 Sep 2025 |
| 378 | handymanservicesvirginiabeach.com | GoDaddy.com, LLC | 25 Jun 2012 | 26 Jun 2024 | 25 Jun 2025 |
| 379 | handymanservicesnh.com | GoDaddy.com, LLC | 21 Dec 2006 | 17 Jan 2015 | 21 Dec 2016 |
| 380 | handymanservicessg.com | OnlineNIC, Inc. | 5 Sep 2023 | 5 Sep 2024 | 5 Sep 2024 |
| 381 | handymanservicestucson.com | GoDaddy.com, LLC | 23 Jul 2023 | 29 Aug 2024 | 23 Jul 2025 |
| 382 | handymanservicescolumbus.com | GoDaddy.com, LLC | 11 Nov 2010 | 23 Dec 2024 | 11 Nov 2024 |
| 383 | handymanservicesmarietta.com | GoDaddy.com, LLC | 11 Mar 2024 | 16 Mar 2025 | 11 Mar 2026 |
| 384 | handymanservicesanaheim.com | GoDaddy.com, LLC | 19 Mar 2014 | 19 Mar 2014 | 19 Mar 2017 |
| 385 | handymanservicespa.com | GoDaddy.com, LLC | 22 Apr 2014 | 4 Jul 2024 | 22 Apr 2024 |
| 386 | handymanservicesauburnhills.com | GoDaddy.com, LLC | 3 Nov 2010 | 26 Oct 2015 | 3 Nov 2016 |
| 387 | handymanservicesipswich.com | Crazy Domains FZ-LLC | 23 Feb 2011 | 18 Feb 2016 | 23 Feb 2017 |
| 388 | handymanservicesofmaine.com | GoDaddy.com, LLC | 23 Apr 2012 | 24 Apr 2023 | 23 Apr 2026 |
| 389 | handymanservicesbyyournamehere.com | Network Solutions, LLC | 13 Nov 2007 | 5 Mar 2017 | 13 Nov 2017 |
| 390 | handymanserviceslv.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Nov 2023 | 17 Nov 2024 | 16 Nov 2025 |
| 391 | handymanservicesmarroquinltdco.com | GoDaddy.com, LLC | 31 Jul 2012 | 24 Jul 2015 | 31 Jul 2016 |
| 392 | handymanservicesnj.com | 1&1 Internet AG | 12 Oct 2023 | 12 Oct 2023 | 12 Oct 2025 |
| 393 | handymanservicesbysteve.com | GoDaddy.com, LLC | 19 Sep 2023 | 20 Feb 2024 | 19 Sep 2025 |
| 394 | handymanservicesnyc.com | - | 2 May 2024 | 5 May 2025 | 2 May 2025 |
| 395 | handymanservicesbirminghamal.com | Tucows Domains Inc. | 25 Nov 2012 | 29 Nov 2020 | 25 Nov 2020 |
| 396 | handymanservicesmilwaukeewi.com | Wild West Domains, LLC | 6 Aug 2010 | 17 Sep 2024 | 6 Aug 2024 |
| 397 | handymanservicesvancouver.com | Namespro Solutions Inc. | 12 Feb 2014 | 15 Jan 2025 | 12 Feb 2026 |
| 398 | handymanservicesfl.com | Wix.com Ltd. | 26 May 2020 | 4 Jun 2024 | 26 May 2025 |
| 399 | handymanservicesmd.com | Tucows Domains Inc. | 13 Sep 2021 | 17 Sep 2022 | 13 Sep 2023 |
| 400 | handymanservicesandiegoca.com | eNom, Inc. | 11 Oct 2013 | 13 Jul 2016 | 11 Oct 2016 |
| 401 | handymanservicescolumbusohio.com | GoDaddy.com, LLC | 18 Aug 2023 | 18 Aug 2024 | 18 Aug 2025 |
| 402 | handymanserviceshenderson.com | GoDaddy.com, LLC | 1 Jun 2013 | 2 Jun 2016 | 1 Jun 2017 |
| 403 | handymanservicesingapore.com | NameCheap, Inc. | 16 Dec 2024 | 17 Dec 2024 | 16 Dec 2027 |
| 404 | handymanservicesofmiami.com | Wild West Domains, LLC | 24 Oct 2012 | 14 Sep 2015 | 13 Sep 2016 |
| 405 | handymanserviceskaty.com | GoDaddy.com, LLC | 30 Jul 2013 | 1 Aug 2016 | 30 Jul 2017 |
| 406 | handymanservicesplusil.com | eNom, Inc. | 26 Sep 2013 | 29 Sep 2017 | 26 Sep 2017 |
| 407 | handymanserviceswestsussex.com | Tucows Domains Inc. | 5 May 2010 | 16 Jul 2023 | 5 May 2023 |
| 408 | handymanservicesrichardsontx.com | GMO Internet Inc. | 24 Feb 2018 | 24 Feb 2018 | 24 Feb 2019 |
| 409 | handymanservicescontractor.com | Network Solutions, LLC | 26 Apr 2011 | 2 Jun 2017 | 26 Apr 2018 |
| 410 | handymanservicesmdva.com | GoDaddy.com, LLC | 24 Jun 2014 | 25 Jun 2016 | 24 Jun 2017 |
| 411 | handymanservicesofaustin.com | enom469, Incorporated | 27 Apr 2022 | 11 Jul 2023 | 27 Apr 2023 |
| 412 | handymanservicespalmdesert.com | NameCheap, Inc. | 22 May 2014 | 22 Apr 2024 | 22 May 2025 |
| 413 | handymanservicesamerica.com | Chengdu West Dimension Digital Technology Co., Ltd… | 2 Dec 2019 | 2 Dec 2019 | 2 Dec 2020 |
| 414 | handymanservicessalisbury.com | GoDaddy.com, LLC | 10 Jan 2011 | 16 Dec 2014 | 10 Jan 2017 |
| 415 | handymanservices-mn.com | Launchpad, Inc. | 21 Jun 2013 | 6 Jun 2017 | 21 Jun 2018 |
| 416 | handymanservicesbyjk.com | GoDaddy.com, LLC | 3 May 2012 | 24 Apr 2016 | 3 May 2017 |
| 417 | handymanservicesorlando.com | NameCheap, Inc. | 19 Nov 2023 | 24 Nov 2024 | 19 Nov 2025 |
| 418 | handymanservicesnashville.com | CloudFlare, Inc. | 7 Mar 2024 | 16 Apr 2025 | 7 Mar 2025 |
| 419 | handymanservicesgeorgia.com | Squarespace Domains LLC | 2 Nov 2011 | 18 Oct 2024 | 2 Nov 2025 |
| 420 | handymanservicesnetworkllc.com | Wild West Domains, LLC | 28 May 2011 | 5 May 2016 | 28 May 2018 |
| 421 | handymanservicescobbcounty.com | GoDaddy.com, LLC | 31 Aug 2011 | 1 Sep 2015 | 31 Aug 2016 |
| 422 | handymanservicesonly.com | - | 23 Apr 2008 | 25 Feb 2024 | 23 Apr 2026 |
| 423 | handymanservicesdallas.com | GoDaddy.com, LLC | 6 Sep 2012 | 7 Sep 2024 | 6 Sep 2026 |
| 424 | handymanservicespeterbray.com | Tucows Domains Inc. | 25 Oct 2010 | 9 May 2025 | 25 Oct 2025 |
| 425 | handymanservicesofmaryland.com | Wild West Domains, LLC | 21 Nov 2008 | 26 Nov 2015 | 21 Nov 2016 |
| 426 | handymanservicesandiego.com | GoDaddy.com, LLC | 2 Dec 2024 | 2 Dec 2024 | 2 Dec 2025 |
| 427 | handymanservicesofsouthjersey.com | GoDaddy.com, LLC | 19 Jul 2014 | 7 Aug 2015 | 19 Jul 2016 |
| 428 | handymanservicesjacksonvillefl.com | Namesilo, LLC | 10 Jun 2014 | 11 Jun 2024 | 10 Jun 2025 |
| 429 | handymanservicesphoenix.com | GoDaddy.com, LLC | 11 Mar 2014 | 16 Mar 2025 | 11 Mar 2026 |
| 430 | handymanservicesindependencemo.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 20 Jun 2022 | 6 Jul 2023 | 20 Jun 2023 |
| 431 | handymanservicesmalaysia.com | Tucows Domains Inc. | 2 Oct 2012 | 6 Oct 2017 | 2 Oct 2017 |
| 432 | handymanservicescontractors.com | Network Solutions, LLC | 26 Apr 2011 | 2 Jun 2017 | 26 Apr 2018 |
| 433 | handymanservicesservingmississuaga.com | GoDaddy.com, LLC | 12 Feb 2014 | 5 Feb 2015 | 12 Feb 2017 |
| 434 | handymanserviceswaynenj.com | GoDaddy.com, LLC | 22 Oct 2012 | 26 Oct 2015 | 22 Oct 2017 |
| 435 | handymanservicesrocklandcountyny.com | GoDaddy.com, LLC | 8 Mar 2011 | 9 Mar 2016 | 8 Mar 2017 |
| 436 | handymanservicesnetwork.com | GoDaddy.com, LLC | 19 Aug 2024 | 19 Aug 2024 | 19 Aug 2025 |
| 437 | handymanservicesplymouthmi.com | GoDaddy.com, LLC | 18 Apr 2010 | 3 May 2016 | 18 Apr 2017 |
| 438 | handymanservicesdenton.com | GMO Internet Inc. | 23 Jan 2018 | 23 Jan 2018 | 23 Jan 2019 |
| 439 | handymanservicesflorida.com | GoDaddy.com, LLC | 28 Sep 2022 | 28 Sep 2022 | 28 Sep 2027 |
| 440 | handymanservicesofamerica.com | GoDaddy.com, LLC | 9 Jun 2021 | 30 Oct 2024 | 9 Jun 2025 |
| 441 | handymanservicesofsa.com | - | 24 Oct 2013 | 24 Oct 2013 | 24 Oct 2017 |
| 442 | handymanservicesdoneright.com | GoDaddy.com, LLC | 12 Jun 2018 | 12 Jun 2018 | 12 Jun 2020 |
| 443 | handymanservicesnewcityny.com | GoDaddy.com, LLC | 18 Aug 2011 | 19 Aug 2016 | 18 Aug 2017 |
| 444 | handymanservicesin.com | GoDaddy.com, LLC | 3 Feb 2024 | 17 Mar 2025 | 3 Feb 2025 |
| 445 | handymanservicessteve.com | Tucows Domains Inc. | 4 Dec 2012 | 8 Dec 2018 | 4 Dec 2018 |
| 446 | handymanservicespittsburgh.com | GoDaddy.com, LLC | 2 Oct 2024 | 2 Oct 2024 | 2 Oct 2025 |
| 447 | handymanservicesstockton.com | GoDaddy.com, LLC | 22 Oct 2020 | 3 Dec 2024 | 22 Oct 2024 |
| 448 | handymanservicesandrepairs-kaminskiy.com | 1&1 Internet AG | 19 Jun 2009 | 20 Jun 2016 | 19 Jun 2018 |
| 449 | handymanservicesnearyou.com | GoDaddy.com, LLC | 17 May 2014 | 18 May 2016 | 17 May 2017 |
| 450 | handymanservicescharlotte.com | eNom, Inc. | 21 Mar 2023 | 16 Mar 2025 | 21 Mar 2026 |
| 451 | handymanservicesgreensburg.com | Tucows Domains Inc. | 25 Aug 2024 | 25 Aug 2024 | 25 Aug 2025 |
| 452 | handymanservicesdubai.com | GoDaddy.com, LLC | 27 Aug 2016 | 31 Aug 2023 | 27 Aug 2025 |
| 453 | handymanservicesindy.com | eNom, Inc. | 27 Aug 2016 | 17 Aug 2017 | 27 Aug 2018 |
| 454 | handymanservicespringtx.com | eNom, Inc. | 7 Sep 2016 | 20 Oct 2017 | 7 Sep 2017 |
| 455 | handymanservicestoledo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Sep 2016 | 25 Oct 2017 | 13 Sep 2017 |
| 456 | handymanservicesoddjobsandmaintenance.com | - | 17 Sep 2016 | 17 Sep 2016 | 17 Sep 2017 |
| 457 | handymanservicesofphoenix.com | GoDaddy.com, LLC | 21 Sep 2016 | 3 Dec 2024 | 21 Sep 2024 |
| 458 | handymanservicesofasheville.com | - | 22 Sep 2016 | 22 Sep 2016 | 22 Sep 2021 |
| 459 | handymanservicesinzephyrhillsfl.com | Tucows Domains Inc. | 25 Sep 2016 | 10 Sep 2024 | 25 Sep 2025 |
| 460 | handymanservicesonline.info | Tucows Domains Inc. | 1 Nov 2024 | 27 Apr 2025 | 1 Nov 2025 |
| 461 | handymanservicesmiami.info | Wild West Domains, LLC | 25 Aug 2013 | 6 Oct 2016 | 25 Aug 2017 |
| 462 | handymanservicesofamerica.info | Wild West Domains, LLC | 19 Aug 2013 | 30 Sep 2016 | 19 Aug 2017 |
| 463 | handymanservices-ap.com | - | 29 Dec 2024 | 27 Apr 2025 | 29 Dec 2025 |
| 464 | handymanservicesmiami.net | Wild West Domains, LLC | 25 Aug 2013 | 14 Sep 2015 | 13 Sep 2016 |
| 465 | handymanservicesvirginiabeach.net | GoDaddy.com, LLC | 25 Jun 2012 | 25 Jun 2016 | 25 Jun 2017 |
| 466 | handymanservicesofkaty.net | GoDaddy.com, LLC | 13 Jul 2012 | 29 Apr 2016 | 13 Jul 2017 |
| 467 | handymanservicesllc.net | Google, Inc. | 7 Aug 2024 | 24 Jan 2025 | 7 Aug 2025 |
| 468 | handymanservicesdallas.net | GoDaddy.com, LLC | 5 Nov 2012 | 18 Nov 2024 | 5 Nov 2025 |
| 469 | handymanserviceshouston.net | Tucows Domains Inc. | 20 Nov 2013 | 22 Oct 2015 | 20 Nov 2016 |
| 470 | handymanserviceseattle.com | GoDaddy.com, LLC | 15 Dec 2023 | 15 Dec 2023 | 15 Dec 2026 |
| 471 | handymanservicesriverview.com | - | 24 Oct 2016 | 24 Oct 2016 | 24 Oct 2017 |
| 472 | handymanservicesusa.xyz | NameCheap, Inc. | 17 Sep 2015 | 26 Sep 2016 | 17 Sep 2017 |
| 473 | handymanservicesnear.xyz | NameCheap, Inc. | 9 Sep 2015 | 22 Oct 2016 | 9 Sep 2016 |
| 474 | handymanservicescabot.com | - | 25 Oct 2016 | 25 Oct 2016 | 25 Oct 2017 |
| 475 | handymanservicesnottinghill.co.uk | - | 15 Apr 2013 | 23 May 2017 | 15 Apr 2018 |
| 476 | handymanservicesfulham.co.uk | - | 15 Apr 2013 | 15 Apr 2017 | 15 Apr 2018 |
| 477 | handymanservicessandiego.com | eNom, Inc. | 1 Nov 2016 | 13 Dec 2017 | 1 Nov 2017 |
| 478 | handymanservicesdetroit.com | Wild West Domains, LLC | 8 Jun 2022 | 9 Jun 2024 | 8 Jun 2025 |
| 479 | handymanservicesllc.website | Tucows Domains Inc. | 15 Nov 2016 | 15 Nov 2016 | 15 Nov 2017 |
| 480 | handymanservicesfulton.com | eNom, Inc. | 15 Nov 2016 | 18 Nov 2017 | 15 Nov 2017 |
| 481 | handymanservicesnearme.site | GoDaddy.com, LLC | 2 Dec 2019 | 14 Dec 2020 | 2 Dec 2021 |
| 482 | handymanservicesindiana.com | NameCheap, Inc. | 10 Feb 2021 | - | 10 Feb 2022 |
| 483 | handymanservicesapp.com | Launchpad, Inc. | 22 Nov 2016 | 4 Dec 2017 | 22 Nov 2017 |
| 484 | handymanservicespgh.com | GoDaddy.com, LLC | 29 Nov 2016 | 29 Nov 2016 | 29 Nov 2018 |
| 485 | handymanservicessilverspringmd.com | eNom, Inc. | 9 Dec 2016 | 17 Mar 2025 | 9 Dec 2026 |
| 486 | handymanservicesforless.com | PSI-USA, Inc. dba Domain Robot | 7 Sep 2023 | 7 Oct 2024 | 7 Sep 2024 |
| 487 | handymanservicesmn.com | DNC Holdings, Inc. | 13 Mar 2024 | 24 Apr 2025 | 13 Mar 2025 |
| 488 | handymanservicesftmyers.com | GoDaddy.com, LLC | 29 Dec 2016 | 29 Dec 2016 | 29 Dec 2017 |
| 489 | handymanservices29.com | register.com, Inc. | 1 Jan 2017 | 3 Jan 2018 | 1 Jan 2019 |
| 490 | handymanservicesmountainview.com | GMO Internet Inc. | 25 Oct 2024 | 25 Oct 2024 | 25 Oct 2025 |
| 491 | handymanservicesdenver.net | Tucows Domains Inc. | 4 Jan 2017 | 8 Jan 2019 | 4 Jan 2019 |
| 492 | handymanservicesseattle.com | GoDaddy.com, LLC | 6 Nov 2022 | 10 Nov 2024 | 6 Nov 2027 |
| 493 | handymanservicesobanargyll.com | GoDaddy.com, LLC | 15 Jan 2017 | 15 Jan 2017 | 15 Jan 2018 |
| 494 | handymanservicesteam.com | GoDaddy.com, LLC | 5 Apr 2024 | 17 Jul 2024 | 5 Apr 2025 |
| 495 | handymanserviceswinchester.com | GoDaddy.com, LLC | 4 Oct 2023 | 15 Nov 2024 | 4 Oct 2024 |
| 496 | handymanserviceseasideca.com | register.com, Inc. | 30 Jan 2017 | 29 Sep 2017 | 30 Jan 2018 |
| 497 | handymanservicescanada.com | GoDaddy.com, LLC | 31 Jan 2017 | 31 Jan 2017 | 31 Jan 2018 |
| 498 | handymanservicestomball.com | Name.com, Inc. | 3 Feb 2017 | 3 Feb 2017 | 3 Feb 2018 |
| 499 | handymanservicescroydon.com | GoDaddy.com, LLC | 14 Feb 2017 | 14 Feb 2017 | 14 Feb 2019 |
| 500 | handymanservicesonecalldoesitall.com | eNom, Inc. | 17 Feb 2017 | 19 Jan 2018 | 17 Feb 2018 |
| 501 | handymanservicesbylou.com | Tucows Domains Inc. | 21 Feb 2017 | 25 Feb 2019 | 21 Feb 2019 |
| 502 | handymanservicesparker.com | GoDaddy.com, LLC | 22 Feb 2017 | 22 Feb 2017 | 22 Feb 2018 |
| 503 | handymanservicesofcincinnati.com | Tucows Domains Inc. | 27 Feb 2017 | 11 Mar 2017 | 27 Feb 2018 |
| 504 | handymanservicesimivalley.com | register.com, Inc. | 27 Feb 2017 | 27 Feb 2017 | 27 Feb 2018 |
| 505 | handymanservicespros.com | GoDaddy.com, LLC | 1 Jun 2018 | 1 Jun 2018 | 1 Jun 2019 |
| 506 | handymanservices82aa.com | Network Solutions, LLC | 14 Mar 2017 | 14 Mar 2017 | 14 Mar 2018 |
| 507 | handymanservicesacramento.com | GoDaddy.com, LLC | 20 Aug 2018 | 20 Aug 2018 | 20 Aug 2019 |
| 508 | handymanserviceshaughton.com | Name.com, Inc. | 16 Mar 2017 | 16 Mar 2017 | 16 Mar 2018 |
| 509 | handymanservicesbyeddie.com | GoDaddy.com, LLC | 18 Mar 2017 | 3 Apr 2019 | 18 Mar 2021 |
| 510 | handymanservices4usa.com | GoDaddy.com, LLC | 19 Mar 2017 | 19 Mar 2017 | 19 Mar 2018 |
| 511 | handymanservicesfusionwv.com | Wild West Domains, LLC | 21 Mar 2017 | 21 Mar 2017 | 21 Mar 2018 |
| 512 | handymanservicesarchercity.com | Name.com, Inc. | 24 Mar 2017 | 24 Mar 2017 | 24 Mar 2018 |
| 513 | handymanservicesaurora.com | GoDaddy.com, LLC | 5 Feb 2024 | 1 Feb 2025 | 5 Feb 2026 |
| 514 | handymanserviceskingston.com | GoDaddy.com, LLC | 29 Mar 2017 | 29 Mar 2017 | 29 Mar 2018 |
| 515 | handymanservicesofwny.com | Google, Inc. | 17 Sep 2021 | 2 Nov 2024 | 17 Sep 2025 |
| 516 | handymanserviceslibertyhill.com | Name.com, Inc. | 6 Apr 2017 | 6 Apr 2017 | 6 Apr 2018 |
| 517 | handymanservicesconway.com | GoDaddy.com, LLC | 10 Apr 2017 | 10 Apr 2017 | 10 Apr 2018 |
| 518 | handymanservicesmanchesterltd.co.uk | - | 16 May 2011 | 17 Apr 2025 | 16 May 2026 |
| 519 | handymanservicesglasgow.com | GoDaddy.com, LLC | 17 Apr 2017 | 18 Apr 2025 | 17 Apr 2026 |
| 520 | handymanservicespring.com | Name.com, Inc. | 27 Apr 2017 | 27 Apr 2017 | 27 Apr 2018 |
| 521 | handymanservicesltd.com | - | 21 Sep 2022 | 23 Oct 2023 | 21 Sep 2023 |
| 522 | handymanserviceshutto.com | Name.com, Inc. | 8 May 2017 | 8 May 2017 | 8 May 2018 |
| 523 | handymanservicesauckland.com | Network Solutions, LLC | 10 May 2017 | 10 May 2017 | 10 May 2018 |
| 524 | handymanservicesflagstaff.com | register.com, Inc. | 25 May 2017 | 25 May 2017 | 25 May 2018 |
| 525 | handymanserviceswilmingtonde.com | Name.com, Inc. | 30 May 2017 | 30 May 2017 | 30 May 2018 |
| 526 | handymanserviceschicagoil.com | Hongkong Domain Name Information Management Co., L… | 7 Jan 2021 | 7 Jan 2021 | 7 Jan 2022 |
| 527 | handymanservices-orlando.com | Name.com, Inc. | 5 Jun 2017 | 5 Jun 2017 | 5 Jun 2018 |
| 528 | handymanservicespanama.com | Tucows Domains Inc. | 8 Jun 2017 | 12 Jun 2018 | 8 Jun 2018 |
| 529 | handymanservicesbridgeport.com | Name.com, Inc. | 8 Jun 2017 | 8 Jun 2017 | 8 Jun 2018 |
| 530 | handymanservicescork.com | GoDaddy.com, LLC | 13 Jun 2017 | 13 Jun 2017 | 13 Jun 2018 |
| 531 | handymanservicesclinton.com | Name.com, Inc. | 13 Jun 2017 | 13 Jun 2017 | 13 Jun 2018 |
| 532 | handymanservicessaintlouis.com | Name.com, Inc. | 14 Jun 2017 | 14 Jun 2017 | 14 Jun 2018 |
| 533 | handymanservicesdiamondbar.com | Name.com, Inc. | 14 Jun 2017 | 26 Sep 2017 | 14 Jun 2018 |
| 534 | handymanservices-indianapolis.com | Name.com, Inc. | 19 Jun 2017 | 26 Sep 2017 | 19 Jun 2018 |
| 535 | handymanservicesvb.com | Network Solutions, LLC | 21 Jun 2017 | 22 Oct 2017 | 21 Jun 2018 |
| 536 | handymanservicesinfortlauderdale.com | NameCheap, Inc. | 23 Jun 2017 | 22 Aug 2017 | 23 Jun 2018 |
| 537 | handymanservicesindc.com | GoDaddy.com, LLC | 3 Jul 2017 | 3 Jul 2024 | 3 Jul 2025 |
| 538 | handymanservicesrichmondca.com | register.com, Inc. | 3 Jul 2017 | 3 Jul 2017 | 3 Jul 2018 |
| 539 | handymanservicesarasotafl.com | register.com, Inc. | 12 Jul 2017 | 12 Jul 2017 | 12 Jul 2018 |
| 540 | handymanservicesthewoodlands.com | 1&1 Internet AG | 23 Jul 2017 | 23 Jul 2017 | 23 Jul 2018 |
| 541 | handymanservicesllc.org | DomainPeople, Inc. | 27 Jun 2024 | 2 Jul 2024 | 27 Jun 2025 |
| 542 | handymanservicesarlingtonva.com | FastDomain Inc. | 2 Sep 2017 | 2 Sep 2017 | 2 Sep 2018 |
| 543 | handymanservicesbaypointca.com | register.com, Inc. | 6 Sep 2017 | 6 Sep 2017 | 6 Sep 2018 |
| 544 | handymanservicesstewartville.com | Name.com, Inc. | 8 Sep 2017 | 8 Sep 2017 | 8 Sep 2018 |
| 545 | handymanserviceskauai.com | NameCheap, Inc. | 8 Sep 2017 | 8 Sep 2017 | 8 Sep 2018 |
| 546 | handymanservicesfairfaxva.com | FastDomain Inc. | 11 Sep 2017 | 11 Sep 2017 | 11 Sep 2018 |
| 547 | handymanservicesrva.com | NameCheap, Inc. | 13 Sep 2017 | 13 Sep 2017 | 13 Sep 2018 |
| 548 | handymanservicesnashua.com | Name.com, Inc. | 15 Sep 2017 | 15 Sep 2017 | 15 Sep 2018 |
| 549 | handymanservicesberry.com | Name.com, Inc. | 18 Sep 2017 | 18 Sep 2017 | 18 Sep 2018 |
| 550 | handymanservicesyorktown.com | Name.com, Inc. | 9 Oct 2017 | 9 Oct 2017 | 9 Oct 2018 |
| 551 | handymanservicesbyarea.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Oct 2017 | 13 Oct 2017 | 13 Oct 2018 |
| 552 | handymanservicesbayarea.com | Dynadot, LLC | 12 Apr 2021 | 13 Apr 2021 | 12 Apr 2022 |
| 553 | handymanservicesgreer.com | Name.com, Inc. | 13 Oct 2017 | 13 Oct 2017 | 13 Oct 2018 |
| 554 | handymanservicesjustintime.com | Tucows Domains Inc. | 28 Oct 2017 | 1 Nov 2018 | 28 Oct 2018 |
| 555 | handymanserviceshockley.co.uk | Hello Internet Corp. | 13 Apr 2017 | 14 May 2018 | 13 Apr 2019 |
| 556 | handymanservicesstcharles.com | register.com, Inc. | 8 Nov 2017 | 8 Nov 2017 | 8 Nov 2018 |
| 557 | handymanservicesforyou.com | FastDomain Inc. | 13 Nov 2017 | 28 Oct 2024 | 13 Nov 2025 |
| 558 | handymanservicesorlandparkil.com | register.com, Inc. | 27 Nov 2017 | 28 Nov 2024 | 27 Nov 2025 |
| 559 | handymanservicesoceancity.com | Tucows Domains Inc. | 29 Nov 2017 | 3 Dec 2018 | 29 Nov 2018 |
| 560 | handymanservicesofoc.com | Tucows Domains Inc. | 12 Dec 2017 | 16 Dec 2021 | 12 Dec 2021 |
| 561 | handymanservicesbylee.com | Tucows Domains Inc. | 17 Dec 2017 | 27 Feb 2024 | 17 Dec 2023 |
| 562 | handymanservicesofcenla.site | NameCheap, Inc. | 24 Dec 2017 | 24 Dec 2017 | 24 Dec 2018 |
| 563 | handymanservicestroudsburg.com | Name.com, Inc. | 2 Jan 2018 | 2 Jan 2018 | 2 Jan 2019 |
| 564 | handymanservicesforyou.co.uk | - | 12 Feb 2024 | 6 Mar 2024 | 12 Feb 2025 |
| 565 | handymanservicesrichmond.co.uk | - | 15 Apr 2013 | 15 Apr 2017 | 15 Apr 2018 |
| 566 | handymanservicessurray.co.uk | Reserved | 29 Sep 2012 | 19 Jul 2017 | 29 Sep 2019 |
| 567 | handymanservices-fulham.co.uk | Reserved | 24 May 2017 | 2 Jun 2017 | 24 May 2019 |
| 568 | handymanservices-portsmouth.uk | - | 19 Nov 2015 | 18 Nov 2024 | 19 Nov 2025 |
| 569 | handymanservicesblackpool.co.uk | - | 22 Jul 2015 | 22 Jul 2023 | 22 Jul 2025 |
| 570 | handymanservicesdirect.co.uk | Reserved | 24 Mar 2005 | 23 Mar 2017 | 24 Mar 2019 |
| 571 | handymanservicesbolton.co.uk | Reserved | 25 May 2016 | 24 May 2017 | 25 May 2018 |
| 572 | handymanservicesacton.co.uk | - | 17 Dec 2016 | 7 Feb 2017 | 17 Dec 2017 |
| 573 | handymanservicesmanchester.co.uk | Hello Internet Corp. | 24 Jun 2012 | 24 Jun 2017 | 24 Jun 2018 |
| 574 | handymanserviceswarrington.co.uk | Reserved | 16 May 2016 | 17 Nov 2016 | 16 May 2018 |
| 575 | handymanserviceschelsea.co.uk | - | 7 Feb 2016 | 7 Feb 2017 | 7 Feb 2019 |
| 576 | handymanserviceskensington.co.uk | - | 31 Mar 2011 | 14 Dec 2017 | 31 Mar 2019 |
| 577 | handymanservicesbalham.co.uk | - | 15 Apr 2013 | 15 Apr 2017 | 15 Apr 2018 |
| 578 | handymanservices-clapham.co.uk | Reserved | 24 May 2017 | 2 Jun 2017 | 24 May 2019 |
| 579 | handymanservicesearlscourt.co.uk | - | 17 Dec 2016 | 7 Feb 2017 | 17 Dec 2017 |
| 580 | handymanservicesearlsfield.co.uk | - | 19 Dec 2016 | 7 Feb 2017 | 19 Dec 2017 |
| 581 | handymanservices-muswellhill.co.uk | Reserved | 24 May 2017 | 2 Jun 2017 | 24 May 2019 |
| 582 | handymanservicesbromsgrove.co.uk | - | 9 Sep 2024 | 15 Oct 2024 | 9 Sep 2025 |
| 583 | handymanservicescheltenham.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 23 Mar 2011 | 12 Oct 2017 | 23 Mar 2019 |
| 584 | handymanserviceshandymen.co.uk | - | 12 Dec 2013 | 18 Dec 2024 | 12 Dec 2025 |
| 585 | handymanservicesputney.co.uk | - | 7 Feb 2016 | 7 Feb 2017 | 7 Feb 2019 |
| 586 | handymanservices-harrow.co.uk | Reserved | 24 May 2017 | 2 Jun 2017 | 24 May 2019 |
| 587 | handymanserviceshampstead.co.uk | - | 17 Dec 2016 | 7 Feb 2017 | 17 Dec 2017 |
| 588 | handymanservicesperth.co.uk | - | 25 Jul 2009 | 18 Jul 2017 | 25 Jul 2018 |
| 589 | handymanservicesliverpool.co.uk | Reserved | 16 May 2016 | 17 Nov 2016 | 16 May 2018 |
| 590 | handymanservicescheshire.co.uk | Hello Internet Corp. | 12 Nov 2016 | 12 Nov 2017 | 12 Nov 2018 |
| 591 | handymanservicesglasgow.co.uk | - | 17 Apr 2017 | 18 Apr 2025 | 17 Apr 2026 |
| 592 | handymanserviceslondon.org.uk | - | 7 May 2014 | 19 Jun 2024 | 7 May 2025 |
| 593 | handymanservicesinbolton.co.uk | Hello Internet Corp. | 16 Nov 2017 | 16 Nov 2017 | 16 Nov 2018 |
| 594 | handymanserviceshandymen.org.uk | eNom, Inc. | 12 Dec 2013 | 24 Nov 2017 | 12 Dec 2018 |
| 595 | handymanserviceschiswick.co.uk | - | 7 Feb 2016 | 7 Feb 2017 | 7 Feb 2019 |
| 596 | handymanserviceslondon.me.uk | Reserved | 16 May 2012 | 22 Jan 2017 | 16 May 2018 |
| 597 | handymanserviceswandsworth.co.uk | - | 15 Apr 2013 | 15 Apr 2017 | 15 Apr 2018 |
| 598 | handymanservices24.co.uk | - | 29 Mar 2016 | 5 Dec 2023 | 29 Mar 2024 |
| 599 | handymanserviceskent.co.uk | - | 3 Jul 2024 | 10 Nov 2024 | 3 Jul 2025 |
| 600 | handymanservicesclapham.co.uk | - | 15 Dec 2016 | 7 Feb 2017 | 15 Dec 2017 |
| 601 | handymanservicessouthwestlondon.co.uk | Hello Internet Corp. | 8 Jun 2017 | 8 Jun 2017 | 8 Jun 2018 |
| 602 | handymanserviceskew.co.uk | - | 17 Dec 2016 | 7 Feb 2017 | 17 Dec 2017 |
| 603 | handymanserviceseastsheen.co.uk | - | 19 Dec 2016 | 7 Feb 2017 | 19 Dec 2017 |
| 604 | handymanservicesealing.co.uk | - | 12 Dec 2016 | 7 Feb 2017 | 12 Dec 2017 |
| 605 | handymanserviceslondon.co.uk | - | 15 Jun 2018 | 12 Sep 2024 | 15 Jun 2025 |
| 606 | handymanservices24hours.co.uk | - | 26 May 2016 | 26 May 2016 | 26 May 2018 |
| 607 | handymanservicesbarnes.co.uk | - | 16 Dec 2016 | 7 Feb 2017 | 16 Dec 2017 |
| 608 | handymanservicesbywc.co.uk | - | 20 Dec 2017 | 20 Dec 2017 | 20 Dec 2018 |
| 609 | handymanservicesstockport.co.uk | Reserved | 17 May 2016 | 17 Nov 2016 | 17 May 2018 |
| 610 | handymanservicesguildford.co.uk | - | 31 Mar 2011 | 14 Dec 2017 | 31 Mar 2019 |
| 611 | handymanservicesporthmadog.co.uk | - | 21 Jul 2015 | 9 Aug 2017 | 21 Jul 2019 |
| 612 | handymanservices247.co.uk | - | 29 Dec 2011 | 29 Dec 2024 | 29 Dec 2025 |
| 613 | handymanservicestwickenham.co.uk | - | 7 Feb 2016 | 7 Feb 2017 | 7 Feb 2019 |
| 614 | handymanservicesfraserburgh.co.uk | Key-Systems GmbH | 3 May 2017 | 3 May 2017 | 3 May 2018 |
| 615 | handymanservices-hull.co.uk | register.com, Inc. | 1 Nov 2017 | 1 Nov 2017 | 1 Nov 2018 |
| 616 | handymanserviceschester.co.uk | Reserved | 16 May 2016 | 17 Nov 2016 | 16 May 2018 |
| 617 | handymanserviceshampton.co.uk | eNom, Inc. | 15 Dec 2017 | 15 Dec 2017 | 15 Dec 2018 |
| 618 | handymanservicescroydon.co.uk | - | 9 Sep 2023 | 1 Sep 2024 | 9 Sep 2024 |
| 619 | handymanservicesharrow.co.uk | - | 15 Dec 2016 | 7 Feb 2017 | 15 Dec 2017 |
| 620 | handymanservicesinlondon.co.uk | - | 28 Mar 2013 | 28 Mar 2017 | 28 Mar 2018 |
| 621 | handymanserviceshammersmith.co.uk | - | 12 Dec 2016 | 7 Feb 2017 | 12 Dec 2017 |
| 622 | handymanservicesplymouth.co.uk | - | 16 Jul 2017 | 15 Jul 2024 | 16 Jul 2025 |
| 623 | handymanservices-highgate.co.uk | Reserved | 24 May 2017 | 2 Jun 2017 | 24 May 2019 |
| 624 | handymanservicesuk.co.uk | - | 28 Mar 2013 | 28 Mar 2017 | 28 Mar 2018 |
| 625 | handymanservicesbattersea.co.uk | - | 15 Apr 2013 | 15 Apr 2017 | 15 Apr 2018 |
| 626 | handymanservices-portsmouth.co.uk | - | 19 Nov 2015 | 18 Nov 2023 | 19 Nov 2025 |
| 627 | handymanservicescrewe.co.uk | Reserved | 17 May 2016 | 17 Nov 2016 | 17 May 2018 |
| 628 | handymanserviceswimbledon.co.uk | - | 5 Mar 2013 | 5 Mar 2017 | 5 Mar 2018 |
| 629 | handymanservicesedinburgh.co.uk | - | 16 Jun 2022 | 12 Aug 2024 | 16 Jun 2025 |
| 630 | handymanserviceswirral.co.uk | register.com, Inc. | 19 Feb 2016 | 5 Feb 2017 | 19 Feb 2018 |
| 631 | handymanserviceswigan.co.uk | Hello Internet Corp. | 11 Oct 2016 | 11 Oct 2017 | 11 Oct 2018 |
| 632 | handymanservicespembs.co.uk | - | 8 Jan 2018 | 8 Jan 2018 | 8 Jan 2019 |
| 633 | handymanservices-balham.co.uk | Reserved | 24 May 2017 | 2 Jun 2017 | 24 May 2019 |
| 634 | handymanserviceskilburn.co.uk | - | 17 Dec 2016 | 7 Feb 2017 | 17 Dec 2017 |
| 635 | handymanservices-bromley.co.uk | Reserved | 24 May 2017 | 2 Jun 2017 | 24 May 2019 |
| 636 | handymanservicesburnley.co.uk | - | 4 Mar 2013 | 4 Oct 2017 | 4 Mar 2018 |
| 637 | handymanservices-london.co.uk | - | 11 May 2012 | 11 Apr 2016 | 11 May 2018 |
| 638 | handymanservices-chiswick.co.uk | Reserved | 24 May 2017 | 2 Jun 2017 | 24 May 2019 |
| 639 | handymanservicesacrosslondon.co.uk | - | 13 May 2016 | 13 May 2016 | 13 May 2018 |
| 640 | handymanservicesbumpass.com | Tucows Domains Inc. | 11 Jan 2018 | 15 Jan 2019 | 11 Jan 2019 |
| 641 | handymanservicesmiltonkeynes.co.uk | Gandi SAS | 16 Jan 2018 | 16 Jan 2018 | 16 Jan 2019 |
| 642 | handymanservicesstirling.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 11 Feb 2018 | 11 Feb 2018 | 11 Feb 2020 |
| 643 | handymanservicesar.com | NameCheap, Inc. | 18 Jul 2023 | 19 Jul 2024 | 18 Jul 2025 |
| 644 | handymanservicesdumfries.com | NameCheap, Inc. | 4 Feb 2024 | 5 Jan 2025 | 4 Feb 2026 |
| 645 | handymanserviceswestorange.com | Tucows Domains Inc. | 22 Feb 2018 | 26 Feb 2019 | 22 Feb 2019 |
| 646 | handymanservicesunion.com | Tucows Domains Inc. | 22 Feb 2018 | 26 Feb 2019 | 22 Feb 2019 |
| 647 | handymanservicesmaplewood.com | Tucows Domains Inc. | 22 Feb 2018 | 26 Feb 2019 | 22 Feb 2019 |
| 648 | handymanservices08.com | NameCheap, Inc. | 4 Jun 2019 | 4 Jun 2019 | 4 Jun 2020 |
| 649 | handymanservicesnorthlake.com | DomainName Driveway, Inc. | 19 Mar 2019 | 19 Mar 2019 | 19 Mar 2020 |
| 650 | handymanservicesberkeley.com | Tucows Domains Inc. | 6 Mar 2018 | 10 Mar 2019 | 6 Mar 2019 |
| 651 | handymanservicesni.co.uk | Reserved | 9 Mar 2018 | 9 Mar 2018 | 9 Mar 2019 |
| 652 | handymanservicesinthehighdesert.com | Name.com, Inc. | 12 Mar 2018 | 12 Mar 2018 | 12 Mar 2019 |
| 653 | handymanservicesetobicoke.com | Wild West Domains, LLC | 19 Feb 2021 | 19 Feb 2021 | 19 Feb 2022 |
| 654 | handymanservicesbrampton.com | Tucows Domains Inc. | 15 Mar 2018 | 19 Mar 2019 | 15 Mar 2019 |
| 655 | handymanservicescaledon.com | Tucows Domains Inc. | 15 Mar 2018 | 19 Mar 2019 | 15 Mar 2019 |
| 656 | handymanservicesthornhill.com | Tucows Domains Inc. | 15 Mar 2018 | 19 Mar 2019 | 15 Mar 2019 |
| 657 | handymanservicesofarizona.com | Google, Inc. | 17 Mar 2018 | 17 Mar 2018 | 17 Mar 2019 |
| 658 | handymanservicesofaz.com | eNom, Inc. | 17 Mar 2018 | 17 Mar 2018 | 17 Mar 2019 |
| 659 | handymanservicescabbagetown.com | Tucows Domains Inc. | 19 Mar 2018 | 19 Mar 2018 | 19 Mar 2019 |
| 660 | handymanservicesyorkville.com | Tucows Domains Inc. | 19 Mar 2018 | 19 Mar 2018 | 19 Mar 2019 |
| 661 | handymanservicespainandpleasure.com | NameCheap, Inc. | 24 Mar 2018 | 24 Mar 2018 | 24 Mar 2019 |
| 662 | handymanservicesrosedale.com | Tucows Domains Inc. | 27 Mar 2018 | 31 Mar 2019 | 27 Mar 2019 |
| 663 | handymanserviceswanlesspark.com | Tucows Domains Inc. | 27 Mar 2018 | 31 Mar 2019 | 27 Mar 2019 |
| 664 | handymanservicesontario.com | register.com, Inc. | 28 Mar 2018 | 28 Mar 2018 | 28 Mar 2019 |
| 665 | handymanservicesguelph.com | Tucows Domains Inc. | 3 Apr 2018 | 7 Apr 2019 | 3 Apr 2019 |
| 666 | handymanserviceshaltonhills.com | Tucows Domains Inc. | 3 Apr 2018 | 7 Apr 2019 | 3 Apr 2019 |
| 667 | handymanserviceshillsburgh.com | Tucows Domains Inc. | 3 Apr 2018 | 7 Apr 2019 | 3 Apr 2019 |
| 668 | handymanservicespalmerston.com | Tucows Domains Inc. | 12 Apr 2018 | 16 Apr 2019 | 12 Apr 2019 |
| 669 | handymanservicesharbordvillage.com | Tucows Domains Inc. | 12 Apr 2018 | 16 Apr 2019 | 12 Apr 2019 |
| 670 | handymanservicestrinitybellwoods.com | Tucows Domains Inc. | 12 Apr 2018 | 16 Apr 2019 | 12 Apr 2019 |
| 671 | handymanserviceslibertyvillage.com | Tucows Domains Inc. | 12 Apr 2018 | 16 Apr 2019 | 12 Apr 2019 |
| 672 | handymanservicestheannex.com | Tucows Domains Inc. | 12 Apr 2018 | 16 Apr 2019 | 12 Apr 2019 |
| 673 | handymanservicesmk.com | GoDaddy.com, LLC | 2 May 2018 | 16 Nov 2023 | 12 Jul 2028 |
| 674 | handymanserviceshouston.com | GoDaddy.com, LLC | 24 Sep 2019 | 25 Sep 2024 | 24 Sep 2025 |
| 675 | handymanservicesmilwaukee.com | Google, Inc. | 5 May 2018 | 20 Apr 2025 | 5 May 2026 |
| 676 | handymanservices24hemerg.com | Gandi SAS | 11 Jun 2018 | 11 Jun 2018 | 11 Jun 2019 |
| 677 | handymanservicestomsrivernj.com | GoDaddy.com, LLC | 13 Jun 2018 | 13 Jun 2018 | 13 Jun 2019 |
| 678 | handymanservicesbyrael.com | register.com, Inc. | 18 Jun 2018 | 18 Jun 2018 | 18 Jun 2019 |
| 679 | handymanservicessm.com | GoDaddy.com, LLC | 23 Jun 2018 | 23 Jun 2018 | 23 Jun 2019 |
| 680 | handymanservicesgaithersburg.com | GoDaddy.com, LLC | 26 Jun 2018 | 7 Aug 2024 | 26 Jun 2024 |
| 681 | handymanserviceswhitby.com | GoDaddy.com, LLC | 23 Sep 2019 | 23 Sep 2019 | 23 Sep 2020 |
| 682 | handymanservicesofdayton.com | GoDaddy.com, LLC | 14 Jul 2018 | 14 Jul 2018 | 14 Jul 2019 |
| 683 | handymanservicesbyandrew.com | 1&1 Internet AG | 18 Oct 2024 | 18 Oct 2024 | 18 Oct 2025 |
| 684 | handymanservicesjax.com | GoDaddy.com, LLC | 18 Jul 2018 | 18 Jul 2018 | 18 Jul 2019 |
| 685 | handymanservicesdc.com | GoDaddy.com, LLC | 24 Jul 2018 | 25 Jul 2023 | 24 Jul 2025 |
| 686 | handymanservicesboston.com | Dynadot, LLC | 11 Feb 2025 | 12 Feb 2025 | 11 Feb 2026 |
| 687 | handymanservicesscarborough.com | Tucows Domains Inc. | 2 Aug 2018 | 6 Aug 2019 | 2 Aug 2019 |
| 688 | handymanservicesny.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Dec 2024 | 15 Feb 2025 | 16 Dec 2025 |
| 689 | handymanservicespdx.com | Internet Domain Services BS Corp | 17 Aug 2018 | 17 Aug 2018 | 17 Aug 2019 |
| 690 | handymanservicesus.com | Google, Inc. | 14 Nov 2020 | 14 Nov 2020 | 14 Nov 2021 |
| 691 | handymanservicesmanassasva.com | GoDaddy.com, LLC | 31 Aug 2018 | 31 Aug 2018 | 31 Aug 2019 |
| 692 | handymanservicespomona.com | GoDaddy.com, LLC | 31 Aug 2018 | 12 Nov 2024 | 31 Aug 2024 |
| 693 | handymanservicesnearme.co.uk | - | 7 Sep 2018 | 7 Sep 2018 | 7 Sep 2019 |
| 694 | handymanservicesnearme.uk | - | 7 Sep 2018 | 7 Sep 2018 | 7 Sep 2019 |
| 695 | handymanserviceshollywoodca.com | register.com, Inc. | 12 Sep 2018 | 13 Sep 2024 | 12 Sep 2025 |
| 696 | handymanservicestulsa.com | DropCatch.com 1105 LLC | 29 Jul 2022 | 10 Sep 2023 | 29 Jul 2023 |
| 697 | handymanservicesco.com | GoDaddy.com, LLC | 24 Aug 2023 | 25 Aug 2024 | 24 Aug 2025 |
| 698 | handymanservicesmarkham.com | Tucows Domains Inc. | 26 Sep 2018 | 30 Sep 2020 | 26 Sep 2020 |
| 699 | handymanservicesscarboroughon.com | Tucows Domains Inc. | 26 Sep 2018 | 30 Sep 2020 | 26 Sep 2020 |
| 700 | handymanservicescompany.com | Porkbun, LLC | 4 Aug 2024 | 2 Nov 2024 | 4 Aug 2025 |
| 701 | handymanservicesinlondon.com | Mesh Digital Limited | 2 Oct 2018 | 2 Oct 2018 | 2 Oct 2019 |
| 702 | handymanservicespickering.com | GoDaddy.com, LLC | 6 Jan 2020 | 6 Jan 2020 | 6 Jan 2021 |
| 703 | handymanservicesscarboroughontario.com | Tucows Domains Inc. | 3 Oct 2018 | 7 Oct 2019 | 3 Oct 2019 |
| 704 | handymanservicesmarkhamon.com | GoDaddy.com, LLC | 23 Dec 2019 | 23 Dec 2019 | 23 Dec 2020 |
| 705 | handymanservicesnearby.com | FastDomain Inc. | 14 Aug 2022 | 26 Sep 2024 | 14 Aug 2024 |
| 706 | handymanservicesoflincoln.com | GoDaddy.com, LLC | 5 Nov 2018 | 5 Nov 2018 | 5 Nov 2019 |
| 707 | handymanservicesoflittleton.com | Google, Inc. | 14 Nov 2018 | 14 Nov 2018 | 14 Nov 2019 |
| 708 | handymanservicesandhomeimprovementskansascity.com | Network Solutions, LLC | 14 Nov 2018 | 14 Nov 2018 | 14 Nov 2019 |
| 709 | handymanservicessanmarcos.com | DropCatch.com 346 LLC | 18 Jun 2023 | 29 Aug 2024 | 18 Jun 2024 |
| 710 | handymanservicesandremodeling.com | Wild West Domains, LLC | 21 Nov 2018 | 21 Nov 2018 | 21 Nov 2019 |
| 711 | handymanservicesneeded.com | 1&1 Internet AG | 26 Nov 2018 | 2 Nov 2024 | 26 Nov 2025 |
| 712 | handymanservicesco.net | GoDaddy.com, LLC | 28 Nov 2018 | 28 Nov 2018 | 28 Nov 2019 |
| 713 | handymanservicessanfrancisco.com | GoDaddy.com, LLC | 27 Jun 2024 | 27 Jun 2024 | 27 Jun 2025 |
| 714 | handymanservicesoahu.com | GoDaddy.com, LLC | 13 Dec 2018 | 13 Jan 2025 | 13 Dec 2024 |
| 715 | handymanserviceslongisland.com | Name.com, Inc. | 19 Dec 2018 | 19 Dec 2018 | 19 Dec 2019 |
| 716 | handymanservicesphx.com | CloudFlare, Inc. | 26 Sep 2017 | 27 Dec 2024 | 26 Sep 2025 |
| 717 | handymanservicesgoffstown.com | Name.com, Inc. | 20 Dec 2018 | 20 Dec 2018 | 20 Dec 2019 |
| 718 | handymanservicesbaltimore.com | NameCheap, Inc. | 15 Nov 2023 | 27 Jan 2025 | 15 Nov 2024 |
| 719 | handymanservicesuae.com | GoDaddy.com, LLC | 2 Jan 2019 | 3 Jan 2025 | 2 Jan 2026 |
| 720 | handymanservicesofnashville.com | GoDaddy.com, LLC | 6 Jan 2019 | 6 Jan 2019 | 6 Jan 2020 |
| 721 | handymanservicespokane.com | GoDaddy.com, LLC | 8 Jan 2019 | 8 Jan 2025 | 8 Jan 2026 |
| 722 | handymanservicesofmcallen.com | GoDaddy.com, LLC | 21 Feb 2018 | 24 Jul 2023 | 21 Feb 2029 |
| 723 | handymanservices-fl.com | GoDaddy.com, LLC | 21 Jan 2019 | 4 Mar 2025 | 21 Jan 2025 |
| 724 | handymanservicesut.mobi | eNom, Inc. | 24 Jan 2019 | 31 Dec 2024 | 24 Jan 2026 |
| 725 | handymanservicesut.com | eNom, Inc. | 24 Jan 2019 | 26 Dec 2024 | 24 Jan 2026 |
| 726 | handymanservicesspokane.com | DropCatch.com 908 LLC | 16 Apr 2021 | 16 Apr 2021 | 16 Apr 2022 |
| 727 | handymanservicesphiladelphia.com | GoDaddy.com, LLC | 2 Feb 2019 | 3 Feb 2025 | 2 Feb 2027 |
| 728 | handymanservicesbytonyocampo.com | GoDaddy.com, LLC | 19 Feb 2019 | 19 Feb 2019 | 19 Feb 2020 |
| 729 | handymanservices2.com | Name.com, Inc. | 2 Mar 2019 | 2 Mar 2019 | 2 Mar 2020 |
| 730 | handymanservicesindothan.com | Name.com, Inc. | 2 Mar 2019 | 2 Mar 2019 | 2 Mar 2020 |
| 731 | handymanservicesnow.com | GoDaddy.com, LLC | 5 Oct 2022 | 6 Oct 2024 | 5 Oct 2026 |
| 732 | handymanservicesbydrbrando.com | Tucows Domains Inc. | 8 Mar 2019 | 12 Mar 2020 | 8 Mar 2020 |
| 733 | handymanservicesnorthwesttexas.com | Wild West Domains, LLC | 4 Jun 2020 | 4 Jun 2020 | 4 Jun 2021 |
| 734 | handymanservicesverobeach.com | Ad Valorem Domains, LLC | 28 Apr 2021 | 11 Jul 2023 | 28 Apr 2023 |
| 735 | handymanservices-az.com | GoDaddy.com, LLC | 11 Mar 2019 | 11 Mar 2019 | 11 Mar 2020 |
| 736 | handymanservicesmoscowmillsmo.com | Name.com, Inc. | 21 Mar 2019 | 21 Mar 2019 | 21 Mar 2020 |
| 737 | handymanservicesfairfaxstatonva.com | GoDaddy.com, LLC | 31 May 2021 | 12 Aug 2024 | 31 May 2024 |
| 738 | handymanservicescandlernc.com | Name.com, Inc. | 25 Mar 2019 | 25 Mar 2019 | 25 Mar 2020 |
| 739 | handymanservicesoakland.com | GoDaddy.com, LLC | 12 Feb 2024 | 1 Feb 2025 | 12 Feb 2026 |
| 740 | handymanservicesbixby.com | GoDaddy.com, LLC | 27 Mar 2019 | 27 Mar 2019 | 27 Mar 2020 |
| 741 | handymanservicesbyveterans.com | Google, Inc. | 10 Apr 2019 | 10 Apr 2019 | 10 Apr 2020 |
| 742 | handymanservicesokc.com | GoDaddy.com, LLC | 14 Dec 2017 | 22 Nov 2022 | 14 Dec 2026 |
| 743 | handymanservicesbrisbane.com | GoDaddy.com, LLC | 25 Apr 2019 | 25 Apr 2025 | 25 Apr 2026 |
| 744 | handymanserviceshonoluluhi.com | Name.com, Inc. | 2 May 2019 | 2 May 2019 | 2 May 2020 |
| 745 | handymanservicesbatonrouge.com | Name.com, Inc. | 3 May 2019 | 4 Apr 2025 | 3 May 2026 |
| 746 | handymanserviceskailuahi.com | Name.com, Inc. | 7 May 2019 | 7 May 2019 | 7 May 2020 |
| 747 | handymanserviceslosangelesca.com | Name.com, Inc. | 10 May 2019 | 10 May 2019 | 10 May 2020 |
| 748 | handymanservicesannarbormi.com | DROPCATCH.COM 790 LLC | 4 Aug 2021 | 5 Aug 2022 | 4 Aug 2023 |
| 749 | handymanservices21.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Feb 2021 | 25 Nov 2021 | 1 Feb 2022 |
| 750 | handymanservices-hemet-san-jacinto-winchester.com | GoDaddy.com, LLC | 1 Jun 2019 | 1 Jun 2019 | 1 Jun 2020 |
| 751 | handymanservicesofdc.com | Wild West Domains, LLC | 3 Jun 2019 | 29 May 2024 | 3 Jun 2025 |
| 752 | handymanserviceselgin.com | GoDaddy.com, LLC | 10 Jun 2019 | 10 Jun 2019 | 10 Jun 2020 |
| 753 | handymanservicesofhouston.com | GoDaddy.com, LLC | 26 Jun 2019 | 27 Jun 2023 | 26 Jun 2025 |
| 754 | handymanserviceseynsham.com | Google, Inc. | 27 Jun 2019 | 27 Jun 2019 | 27 Jun 2020 |
| 755 | handymanservicescompany.net | GoDaddy.com, LLC | 24 Feb 2021 | 27 Oct 2022 | 24 Feb 2026 |
| 756 | handymanserviceshuntsvilleal.com | Name.com, Inc. | 9 Jul 2019 | 9 Jul 2019 | 9 Jul 2020 |
| 757 | handymanservicesbracknell.com | Namesilo, LLC | 15 Jul 2019 | 16 Jul 2019 | 15 Jul 2020 |
| 758 | handymanserviceskettering.com | GoDaddy.com, LLC | 19 Oct 2020 | 19 Oct 2020 | 19 Oct 2021 |
| 759 | handymanservicesofsouthernmaine.com | eNom, Inc. | 18 Jul 2019 | 18 Jul 2019 | 18 Jul 2020 |
| 760 | handymanservicesquote.com | GoDaddy.com, LLC | 22 Jul 2019 | 22 Jul 2024 | 22 Jul 2025 |
| 761 | handymanservicesbyjimtalpey.com | Tucows Domains Inc. | 22 Jul 2019 | 26 Jul 2020 | 22 Jul 2020 |
| 762 | handymanserviceslocally.com | GoDaddy.com, LLC | 4 Aug 2019 | 4 Aug 2019 | 4 Aug 2020 |
| 763 | handymanserviceswashingtonut.com | Name.com, Inc. | 6 Aug 2019 | 6 Aug 2019 | 6 Aug 2020 |
| 764 | handymanserviceswestmelbournefl.com | Name.com, Inc. | 8 Aug 2019 | 8 Aug 2019 | 8 Aug 2020 |
| 765 | handymanservicesnewalbanyms.com | Name.com, Inc. | 22 Aug 2019 | 22 Aug 2019 | 22 Aug 2020 |
| 766 | handymanservicescharlottenc.com | GoDaddy.com, LLC | 23 Aug 2019 | 4 Nov 2023 | 23 Aug 2023 |
| 767 | handymanservicesni.com | NameCheap, Inc. | 29 Aug 2019 | - | 29 Aug 2020 |
| 768 | handymanservicesopalocka.com | Name.com, Inc. | 11 Sep 2019 | 11 Sep 2019 | 11 Sep 2020 |
| 769 | handymanservicesenglewood.com | Name.com, Inc. | 13 Sep 2019 | 13 Sep 2019 | 13 Sep 2020 |
| 770 | handymanservicesinfo.com | Tucows Domains Inc. | 20 Sep 2019 | 24 Sep 2020 | 20 Sep 2020 |
| 771 | handymanservices-cairns.com | Tucows Domains Inc. | 27 Sep 2019 | 1 Oct 2020 | 27 Sep 2020 |
| 772 | handymanservicesfortlauderdalefl.com | Name.com, Inc. | 27 Sep 2019 | 27 Sep 2019 | 27 Sep 2020 |
| 773 | handymanservicesexpert.com | NameCheap, Inc. | 28 Sep 2019 | - | 28 Sep 2020 |
| 774 | handymanserviceslist.com | Porkbun, LLC | 24 Feb 2022 | 6 Apr 2023 | 24 Feb 2023 |
| 775 | handymanservicesdmv.com | GoDaddy.com, LLC | 23 Feb 2021 | 23 Feb 2021 | 23 Feb 2022 |
| 776 | handymanservicescan.com | GoDaddy.com, LLC | 1 Nov 2019 | 1 Nov 2019 | 1 Nov 2020 |
| 777 | handymanservicesnearme.net | Launchpad, Inc. | 11 Nov 2019 | 11 Nov 2019 | 11 Nov 2020 |
| 778 | handymanservicesadelaide.com | NameCheap, Inc. | 15 Nov 2019 | 27 Jan 2025 | 15 Nov 2025 |
| 779 | handymanservicesvt.com | GoDaddy.com, LLC | 18 Nov 2019 | 18 Nov 2019 | 18 Nov 2020 |
| 780 | handymanservicesnamibia.com | GoDaddy.com, LLC | 22 Nov 2019 | 23 Oct 2021 | 22 Nov 2022 |
| 781 | handymanservicessilverspring.com | eNom, Inc. | 22 Nov 2019 | 17 Mar 2025 | 22 Nov 2025 |
| 782 | handymanservices-pro.com | Google, Inc. | 4 Dec 2019 | 4 Dec 2019 | 4 Dec 2020 |
| 783 | handymanservicespace.com | Name.com, Inc. | 16 Dec 2019 | 16 Dec 2019 | 16 Dec 2020 |
| 784 | handymanservicesofalbuquerque.com | Launchpad, Inc. | 23 Dec 2019 | 1 Sep 2024 | 23 Dec 2025 |
| 785 | handymanservices24h.com | NameCheap, Inc. | 26 Dec 2019 | 26 Nov 2024 | 26 Dec 2025 |
| 786 | handymanservicescallnow.com | NameCheap, Inc. | 31 Dec 2019 | 11 Feb 2024 | 31 Dec 2023 |
| 787 | handymanservicesstlouis.com | NameCheap, Inc. | 28 Dec 2022 | 28 Nov 2024 | 28 Dec 2025 |
| 788 | handymanservicesofsarasota.com | GoDaddy.com, LLC | 5 Jan 2020 | 5 Jan 2020 | 5 Jan 2021 |
| 789 | handymanservicesphilly.com | Tucows Domains Inc. | 11 Jan 2020 | 15 Jan 2023 | 11 Jan 2023 |
| 790 | handymanservices-usa.com | NameCheap, Inc. | 15 Jan 2020 | - | 15 Jan 2021 |
| 791 | handymanservicesolutions.net | Tucows Domains Inc. | 18 Jan 2020 | 22 Jan 2023 | 18 Jan 2023 |
| 792 | handymanservicesgetfixed.com | Google, Inc. | 30 Jan 2020 | 30 Jan 2020 | 30 Jan 2021 |
| 793 | handymanservices-rochester.com | Namesilo, LLC | 8 Feb 2020 | 9 Feb 2020 | 8 Feb 2021 |
| 794 | handymanserviceslancaster.com | Wild West Domains, LLC | 16 Feb 2020 | 16 Feb 2020 | 16 Feb 2021 |
| 795 | handymanservices-laurel.com | DreamHost, LLC | 18 Feb 2020 | 3 May 2023 | 18 Feb 2023 |
| 796 | handymanservicesmodestoca.com | Wild West Domains, LLC | 21 Feb 2020 | 21 Feb 2020 | 21 Feb 2021 |
| 797 | handymanservicesoc.com | NameCheap, Inc. | 14 Feb 2023 | 15 Jan 2025 | 14 Feb 2026 |
| 798 | handymanserviceslexington.com | GoDaddy.com, LLC | 25 Feb 2020 | 25 Feb 2020 | 25 Feb 2021 |
| 799 | handymanserviceslex.com | Wild West Domains, LLC | 5 Mar 2020 | 6 Mar 2025 | 5 Mar 2026 |
| 800 | handymanservicesne.com | Google, Inc. | 19 Mar 2020 | 5 Apr 2020 | 19 Mar 2021 |
| 801 | handymanservicesnorfolk.com | Name.com, Inc. | 25 Mar 2020 | 25 Mar 2020 | 25 Mar 2021 |
| 802 | handymanservicesbyluis.com | GoDaddy.com, LLC | 20 Apr 2020 | 21 Apr 2025 | 20 Apr 2026 |
| 803 | handymanservicesinoakland.com | eNom, Inc. | 23 Apr 2020 | 23 Apr 2020 | 23 Apr 2021 |
| 804 | handymanservicessouthhills.com | GoDaddy.com, LLC | 24 Apr 2020 | 25 Apr 2025 | 24 Apr 2026 |
| 805 | handymanservicesindubai.com | GoDaddy.com, LLC | 28 Apr 2020 | 28 Apr 2020 | 28 Apr 2021 |
| 806 | handymanservicesab.com | FastDomain Inc. | 3 May 2020 | 3 May 2020 | 3 May 2021 |
| 807 | handymanservicestucsonaz.com | Namesilo, LLC | 17 May 2020 | 18 May 2020 | 17 May 2021 |
| 808 | handymanservicescedarcity.com | GoDaddy.com, LLC | 10 Nov 2023 | 22 Jan 2025 | 10 Nov 2024 |
| 809 | handymanservicesportorange.com | GoDaddy.com, LLC | 9 Sep 2024 | 9 Sep 2024 | 9 Sep 2025 |
| 810 | handymanservicespuntagorda.com | GoDaddy.com, LLC | 19 May 2020 | 19 May 2020 | 19 May 2021 |
| 811 | handymanservicesvenice.com | GoDaddy.com, LLC | 19 May 2020 | 19 May 2020 | 19 May 2021 |
| 812 | handymanservicesportcharlotte.com | GoDaddy.com, LLC | 19 May 2020 | 19 May 2020 | 19 May 2021 |
| 813 | handymanservicesam.com | GoDaddy.com, LLC | 8 Jun 2020 | 8 Jun 2020 | 8 Jun 2021 |
| 814 | handymanservicesocal.com | GoDaddy.com, LLC | 25 May 2020 | 25 May 2020 | 25 May 2021 |
| 815 | handymanserviceseloy.com | GoDaddy.com, LLC | 18 Jun 2020 | 18 Jun 2020 | 18 Jun 2021 |
| 816 | handymanservicesbylarnell.com | GoDaddy.com, LLC | 4 Jul 2020 | 27 Oct 2024 | 4 Jul 2025 |
| 817 | handymanservicesredcreek.com | Name.com, Inc. | 23 Jul 2020 | 23 Jul 2020 | 23 Jul 2021 |
| 818 | handymanservicespronto.com | Tucows Domains Inc. | 26 Jul 2020 | 26 Jul 2020 | 26 Jul 2021 |
| 819 | handymanservicesgilbert.com | GoDaddy.com, LLC | 5 Aug 2020 | 5 Aug 2020 | 5 Aug 2021 |
| 820 | handymanserviceshamilton.com | - | 21 Jan 2025 | 14 Mar 2025 | 21 Jan 2026 |
| 821 | handymanservicesblockisland.com | GoDaddy.com, LLC | 19 Aug 2020 | 19 Aug 2020 | 19 Aug 2022 |
| 822 | handymanservicesstafford.com | GoDaddy.com, LLC | 30 Apr 2024 | 1 May 2025 | 30 Apr 2026 |
| 823 | handymanservicesf.com | GoDaddy.com, LLC | 26 Aug 2020 | 7 Nov 2023 | 26 Aug 2023 |
| 824 | handymanservicesinwashingtondc.com | eNom, Inc. | 28 Aug 2020 | 28 Aug 2020 | 28 Aug 2021 |
| 825 | handymanservicesbykhody.com | GoDaddy.com, LLC | 31 Aug 2020 | 31 Aug 2020 | 31 Aug 2021 |
| 826 | handymanservicesracine.com | Name.com, Inc. | 17 Sep 2020 | 17 Sep 2020 | 17 Sep 2021 |
| 827 | handymanserviceswichitakansas.com | Epik Inc. | 13 Jan 2025 | 26 Feb 2025 | 13 Jan 2026 |
| 828 | handymanservices-ltd.com | GoDaddy.com, LLC | 25 Oct 2020 | 6 Jan 2024 | 25 Oct 2023 |
| 829 | handymanservicesjacksonvilleflorida.com | GoDaddy.com, LLC | 10 Jul 2024 | 10 Jul 2024 | 10 Jul 2025 |
| 830 | handymanservicesonduty.com | GoDaddy.com, LLC | 28 Oct 2020 | 28 Oct 2020 | 28 Oct 2021 |
| 831 | handymanservicespalacios.com | GoDaddy.com, LLC | 28 Oct 2020 | 28 Oct 2020 | 28 Oct 2021 |
| 832 | handymanservicesgreenbrierar.com | Name.com, Inc. | 11 Nov 2020 | 11 Nov 2020 | 11 Nov 2021 |
| 833 | handymanservicesonduties.com | GoDaddy.com, LLC | 18 Nov 2020 | 19 Nov 2024 | 18 Nov 2025 |
| 834 | handymanservicesspringhill.com | GoDaddy.com, LLC | 20 Nov 2020 | 20 Nov 2020 | 20 Nov 2021 |
| 835 | handymanservicesdaily.com | NameCheap, Inc. | 2 Apr 2024 | 3 Mar 2025 | 2 Apr 2026 |
| 836 | handymanservicescala.com | GoDaddy.com, LLC | 7 Jun 2023 | 29 May 2024 | 7 Jun 2025 |
| 837 | handymanservices101.com | GoDaddy.com, LLC | 8 Dec 2020 | 9 Dec 2024 | 8 Dec 2025 |
| 838 | handymanservicessanfranciscoca.com | Name.com, Inc. | 8 Dec 2020 | 10 Nov 2024 | 8 Dec 2025 |
| 839 | handymanservicesmyarea.com | Google, Inc. | 16 Dec 2020 | 16 Dec 2020 | 16 Dec 2021 |
| 840 | handymanservicesbytammi.com | 1&1 Internet AG | 20 Dec 2020 | 20 Dec 2020 | 20 Dec 2021 |
| 841 | handymanservicestn.com | GoDaddy.com, LLC | 28 Oct 2024 | 28 Oct 2024 | 28 Oct 2025 |
| 842 | handymanservicesnear.com | GoDaddy.com, LLC | 9 Apr 2024 | 18 Mar 2025 | 9 Apr 2026 |
| 843 | handymanservicescotland.com | GoDaddy.com, LLC | 28 Jan 2021 | 28 Jan 2021 | 28 Jan 2022 |
| 844 | handymanservicesarasota.com | GoDaddy.com, LLC | 30 Jan 2021 | 30 Jan 2021 | 30 Jan 2022 |
| 845 | handymanserviceshayward.com | GoDaddy.com, LLC | 26 Feb 2021 | 16 Apr 2025 | 26 Feb 2026 |
| 846 | handymanservicesamarillo.com | NameCheap, Inc. | 1 Mar 2021 | 31 Mar 2025 | 1 Mar 2026 |
| 847 | handymanservicestallahassee.com | Namesilo, LLC | 1 Mar 2021 | 16 Apr 2025 | 1 Mar 2026 |
| 848 | handymanservicesdaily.digital | GoDaddy.com, LLC | 2 Mar 2021 | 13 Apr 2024 | 2 Mar 2024 |
| 849 | handymanservicespress.digital | GoDaddy.com, LLC | 2 Mar 2021 | 13 Apr 2024 | 2 Mar 2024 |
| 850 | handymanservicesgazette.digital | GoDaddy.com, LLC | 2 Mar 2021 | 13 Apr 2024 | 2 Mar 2024 |
| 851 | handymanservicesjournal.digital | GoDaddy.com, LLC | 2 Mar 2021 | 13 Apr 2024 | 2 Mar 2024 |
| 852 | handymanservicesnorthwestwales.com | Tucows Domains Inc. | 2 Mar 2021 | 12 Apr 2023 | 2 Mar 2023 |
| 853 | handymanservicesgazette.today | GoDaddy.com, LLC | 2 Mar 2021 | 13 Apr 2024 | 2 Mar 2024 |
| 854 | handymanservicesjournal.today | GoDaddy.com, LLC | 2 Mar 2021 | 13 Apr 2024 | 2 Mar 2024 |
| 855 | handymanservicesdaily.today | GoDaddy.com, LLC | 2 Mar 2021 | 13 Apr 2024 | 2 Mar 2024 |
| 856 | handymanservicespress.today | GoDaddy.com, LLC | 2 Mar 2021 | 13 Apr 2024 | 2 Mar 2024 |
| 857 | handymanservicesgeneral.com | Google, Inc. | 10 Mar 2021 | 10 Mar 2021 | 10 Mar 2022 |
| 858 | handymanservicesantaclaritaca.com | GoDaddy.com, LLC | 18 Mar 2021 | 18 Mar 2021 | 18 Mar 2022 |
| 859 | handymanservicesmontvale.com | Name.com, Inc. | 24 Mar 2021 | 24 Mar 2021 | 24 Mar 2022 |
| 860 | handymanservices-tx.com | Namesilo, LLC | 25 Mar 2021 | 25 Mar 2021 | 25 Mar 2022 |
| 861 | handymanservicess.online | GoDaddy.com, LLC | 2 Apr 2021 | 2 Apr 2021 | 2 Apr 2022 |
| 862 | handymanservicessingapore.net | Crazy Domains FZ-LLC | 4 Apr 2021 | 1 Mar 2025 | 4 Apr 2027 |
| 863 | handymanservicesdrake.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Apr 2021 | 7 Apr 2021 | 7 Apr 2022 |
| 864 | handymanservicesanddist.com | Tucows Domains Inc. | 8 Apr 2021 | 26 Mar 2025 | 8 Apr 2026 |
| 865 | handymanservices38drgmail.com | Network Solutions, LLC | 16 Apr 2021 | 16 Apr 2021 | 16 Apr 2022 |
| 866 | handymanservicesofmountainview.com | Launchpad, Inc. | 25 Apr 2021 | 27 Apr 2025 | 25 Apr 2026 |
| 867 | handymanservicestylertx.com | GoDaddy.com, LLC | 22 Jul 2023 | 3 Oct 2024 | 22 Jul 2024 |
| 868 | handymanservices0809.com | Network Solutions, LLC | 2 May 2021 | 2 May 2021 | 2 May 2022 |
| 869 | handymanservicesmalta.com | Domain.com, LLC | 11 May 2021 | 23 Apr 2025 | 11 May 2026 |
| 870 | handymanservices3524542925.com | 1API GmbH | 29 May 2021 | 5 Aug 2023 | 29 May 2025 |
| 871 | handymanservicesbethesda.com | eNom, Inc. | 8 Jun 2021 | 17 Mar 2025 | 8 Jun 2025 |
| 872 | handymanservicesantaanaca.com | GoDaddy.com, LLC | 10 Jun 2021 | 10 Jun 2021 | 10 Jun 2022 |
| 873 | handymanservicesanchorage.com | CloudFlare, Inc. | 16 Jun 2023 | 22 May 2024 | 16 Jun 2025 |
| 874 | handymanservicesmv.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 17 Jun 2021 | 17 Jun 2021 | 17 Jun 2022 |
| 875 | handymanservices864.com | Google, Inc. | 18 Jun 2021 | 18 Jun 2021 | 18 Jun 2022 |
| 876 | handymanservicesindxb.com | Tucows Domains Inc. | 20 Oct 2023 | 24 Oct 2024 | 20 Oct 2025 |
| 877 | handymanservicesllc.biz | Google, Inc. | 30 Oct 2024 | 14 Nov 2024 | 30 Oct 2025 |
| 878 | handymanserviceslakeland.com | GoDaddy.com, LLC | 6 Jul 2021 | 7 Jul 2023 | 6 Jul 2025 |
| 879 | handymanservicesofhayward.com | Launchpad, Inc. | 17 Jul 2021 | 4 Oct 2024 | 17 Jul 2025 |
| 880 | handymanservicesgreenville.com | GoDaddy.com, LLC | 23 Jul 2021 | 23 Jul 2021 | 23 Jul 2022 |
| 881 | handymanservicesfresno.com | Namearsenal.com LLC | 21 Oct 2022 | 4 Jan 2024 | 21 Oct 2023 |
| 882 | handymanservicescentralfl.com | Network Solutions, LLC | 4 Aug 2021 | 4 Aug 2021 | 4 Aug 2022 |
| 883 | handymanserviceslakelandfl.com | GoDaddy.com, LLC | 5 Aug 2021 | 17 Oct 2023 | 5 Aug 2023 |
| 884 | handymanservicesanjoseca.com | GoDaddy.com, LLC | 6 Aug 2021 | 6 Aug 2021 | 6 Aug 2022 |
| 885 | handymanservicesinnj.com | GoDaddy.com, LLC | 10 Aug 2021 | 10 Aug 2021 | 10 Aug 2022 |
| 886 | handymanservicesup.com | GoDaddy.com, LLC | 31 Aug 2021 | 31 Aug 2021 | 31 Aug 2022 |
| 887 | handymanservicescleveland.com | GoDaddy.com, LLC | 7 Sep 2021 | 19 Nov 2023 | 7 Sep 2023 |
| 888 | handymanservicessc.com | GoDaddy.com, LLC | 7 Sep 2021 | 7 Sep 2021 | 7 Sep 2022 |
| 889 | handymanservicessouthbeloit.com | GoDaddy.com, LLC | 20 Sep 2021 | 20 Sep 2021 | 20 Sep 2022 |
| 890 | handymanservicesmidwest.com | Cronon AG | 20 Sep 2021 | 20 Sep 2021 | 20 Sep 2022 |
| 891 | handymanservicesfortwaltonbeach.com | GoDaddy.com, LLC | 7 Oct 2021 | 7 Oct 2021 | 7 Oct 2022 |
| 892 | handymanservicesnantucket.com | GoDaddy.com, LLC | 11 Oct 2021 | 11 Oct 2021 | 11 Oct 2022 |
| 893 | handymanservicesdubai.net | NameCheap, Inc. | 16 Oct 2021 | - | 16 Oct 2022 |
| 894 | handymanservicesbyleerockfordill.com | Tucows Domains Inc. | 5 Nov 2021 | 16 Jan 2024 | 5 Nov 2023 |
| 895 | handymanservicesdracut.com | GoDaddy.com, LLC | 16 Nov 2021 | 16 Nov 2021 | 16 Nov 2022 |
| 896 | handymanservicessacramento.com | GoDaddy.com, LLC | 23 Nov 2021 | 23 Nov 2021 | 23 Nov 2022 |
| 897 | handymanservicesknoxvilletn.com | FastDomain Inc. | 5 Dec 2021 | 16 Jan 2024 | 5 Dec 2023 |
| 898 | handymanservicesca.pro | Name.com, Inc. | 6 Dec 2021 | 6 Dec 2021 | 6 Dec 2022 |
| 899 | handymanservicesgreeley.com | GoDaddy.com, LLC | 21 Dec 2021 | 21 Dec 2021 | 21 Dec 2022 |
| 900 | handymanservicesmesa.com | Dynadot, LLC | 25 Dec 2021 | 25 Dec 2021 | 25 Dec 2022 |
| 901 | handymanservicesor.com | GoDaddy.com, LLC | 5 Jan 2022 | 17 Mar 2024 | 5 Jan 2024 |
| 902 | handymanservicesbymnoveir.com | GoDaddy.com, LLC | 14 Jan 2022 | 14 Jan 2022 | 14 Jan 2023 |
| 903 | handymanservicesbroward.com | Google, Inc. | 16 Jan 2022 | 16 Jan 2022 | 16 Jan 2023 |
| 904 | handymanservices360.com | GoDaddy.com, LLC | 15 Jan 2022 | 15 Jan 2022 | 15 Jan 2023 |
| 905 | handymanservicessherwood.com | Hosting Concepts B.V. dba Openprovider | 17 Jan 2022 | 17 Jan 2025 | 17 Jan 2026 |
| 906 | handymanserviceslafayette.com | GoDaddy.com, LLC | 1 Feb 2022 | 1 Feb 2025 | 1 Feb 2026 |
| 907 | handymanservicesburtonsville.com | GoDaddy.com, LLC | 1 Feb 2022 | 14 Feb 2023 | 1 Feb 2024 |
| 908 | handymanservicesmacias.com | GoDaddy.com, LLC | 1 Feb 2022 | 15 Mar 2023 | 1 Feb 2023 |
| 909 | handymanservicesmississauga.ca | - | 8 Feb 2022 | 8 Feb 2023 | 8 Feb 2024 |
| 910 | handymanservicesgreenvillesc.com | GoDaddy.com, LLC | 10 Feb 2022 | 22 Feb 2024 | 10 Feb 2025 |
| 911 | handymanservices305.com | GoDaddy.com, LLC | 10 Feb 2022 | 23 Apr 2024 | 10 Feb 2024 |
| 912 | handymanservicesinglasgow.com | GoDaddy.com, LLC | 18 Feb 2022 | 27 Feb 2025 | 18 Feb 2027 |
| 913 | handymanservicesplus.net | Tucows Domains Inc. | 25 Sep 2022 | 6 Dec 2024 | 25 Sep 2024 |
| 914 | handymanservices-lasvegas.com | DreamHost, LLC | 3 Mar 2022 | 15 May 2024 | 3 Mar 2024 |
| 915 | handymanserviceswj.com | Wild West Domains, LLC | 4 Mar 2022 | 15 Apr 2025 | 4 Mar 2025 |
| 916 | handymanservicesbyjuan.com | GoDaddy.com, LLC | 4 Mar 2022 | 15 Apr 2023 | 4 Mar 2023 |
| 917 | handymanservicesmakawao.com | Google, Inc. | 10 Mar 2022 | 10 May 2023 | 10 Mar 2023 |
| 918 | handymanservicesredlands.com | GoDaddy.com, LLC | 11 Mar 2022 | 23 May 2023 | 11 Mar 2023 |
| 919 | handymanservicestampa.com | GoDaddy.com, LLC | 12 Mar 2022 | 2 Oct 2022 | 12 Mar 2027 |
| 920 | handymanservicesnearsaintpaul.com | Google, Inc. | 19 Mar 2022 | 19 May 2024 | 19 Mar 2024 |
| 921 | handymanservicesetc.com | Google, Inc. | 22 Mar 2022 | 22 May 2023 | 22 Mar 2023 |
| 922 | handymanservicesdale.com | GoDaddy.com, LLC | 5 Apr 2022 | 17 Apr 2023 | 5 Apr 2024 |
| 923 | handymanservicesofseattle.com | Automattic Inc. | 9 Apr 2022 | 6 Sep 2023 | 9 Apr 2025 |
| 924 | handymanservicespetaluma.com | GoDaddy.com, LLC | 19 Apr 2022 | 1 May 2023 | 19 Apr 2024 |
| 925 | handymanservicesmerrittisland.com | NameCheap, Inc. | 25 Apr 2022 | 25 Apr 2025 | 25 Apr 2026 |
| 926 | handymanserviceslehighton.com | GoDaddy.com, LLC | 26 Apr 2022 | 8 Jul 2023 | 26 Apr 2023 |
| 927 | handymanservicesbakersfield.com | GoDaddy.com, LLC | 26 Apr 2022 | 8 Jul 2023 | 26 Apr 2023 |
| 928 | handymanservicesoftucson.com | Tucows Domains Inc. | 7 May 2022 | 22 Apr 2025 | 7 May 2026 |
| 929 | handymanservicesvijayawada.com | GoDaddy.com, LLC | 24 May 2022 | 5 Jul 2023 | 24 May 2023 |
| 930 | handymanservices311.com | Wix.com Ltd. | 27 Jun 2022 | 7 Aug 2024 | 27 Jun 2024 |
| 931 | handymanservicesunionky.com | GoDaddy.com, LLC | 29 Jun 2022 | 10 Sep 2023 | 29 Jun 2023 |
| 932 | handymanservicesdesmoines.com | GoDaddy.com, LLC | 18 Jul 2022 | 29 Sep 2023 | 18 Jul 2023 |
| 933 | handymanservicesperry.com | GoDaddy.com, LLC | 19 Jul 2022 | 30 Sep 2023 | 19 Jul 2023 |
| 934 | handymanservicesreno.com | GoDaddy.com, LLC | 25 Jul 2022 | 5 Sep 2023 | 25 Jul 2023 |
| 935 | handymanserviceskansascity.com | GoDaddy.com, LLC | 27 Jul 2022 | 8 Oct 2023 | 27 Jul 2023 |
| 936 | handymanservicespalmbeach.com | GoDaddy.com, LLC | 27 Jul 2022 | 28 Jul 2024 | 27 Jul 2025 |
| 937 | handymanservicesmyrtlebeach.com | GoDaddy.com, LLC | 1 Aug 2022 | 1 Aug 2024 | 1 Aug 2025 |
| 938 | handymanserviceslongbeachca.com | GoDaddy.com, LLC | 3 Aug 2022 | 15 Oct 2023 | 3 Aug 2023 |
| 939 | handymanservicesglencarbon.com | GoDaddy.com, LLC | 4 Aug 2022 | 16 Oct 2023 | 4 Aug 2023 |
| 940 | handymanservicesnorcross.com | GoDaddy.com, LLC | 5 Aug 2022 | 17 Oct 2023 | 5 Aug 2023 |
| 941 | handymanservicesannandale.com | GoDaddy.com, LLC | 5 Aug 2022 | 16 Sep 2024 | 5 Aug 2024 |
| 942 | handymanservicesoflouisiana.com | GoDaddy.com, LLC | 22 Aug 2022 | 3 Oct 2023 | 22 Aug 2023 |
| 943 | handymanservicesliveoak.com | GoDaddy.com, LLC | 30 Aug 2022 | 1 Aug 2024 | 30 Aug 2025 |
| 944 | handymanservicesgeneva.com | GoDaddy.com, LLC | 2 Sep 2022 | 14 Nov 2024 | 2 Sep 2024 |
| 945 | handymanservicesbytim.com | Wix.com Ltd. | 30 Aug 2021 | 3 Sep 2022 | 30 Aug 2022 |
| 946 | handymanserviceswillis.com | GoDaddy.com, LLC | 7 Sep 2022 | 19 Nov 2023 | 7 Sep 2023 |
| 947 | handymanservicesnearmellc.com | Google, Inc. | 6 Sep 2022 | 22 Aug 2024 | 6 Sep 2025 |
| 948 | handymanservicestivertondevon.com | Tucows Domains Inc. | 7 Sep 2022 | 18 Oct 2023 | 7 Sep 2023 |
| 949 | handymanservicesranchocucamonga.com | GoDaddy.com, LLC | 8 Sep 2022 | 20 Nov 2023 | 8 Sep 2023 |
| 950 | handymanserviceszone.com | NameCheap, Inc. | 13 Sep 2022 | 25 Nov 2023 | 13 Sep 2023 |
| 951 | handymanservicesportjeffersonstation.com | GoDaddy.com, LLC | 14 Sep 2022 | 30 Aug 2024 | 14 Sep 2025 |
| 952 | handymanservicesofjax.com | GoDaddy.com, LLC | 24 Apr 2024 | 24 Apr 2024 | 24 Apr 2027 |
| 953 | handymanservicespk.com | NameCheap, Inc. | 19 Sep 2022 | 14 Oct 2023 | 19 Sep 2024 |
| 954 | handymanservicesbyjason.com | Wix.com Ltd. | 14 Mar 2022 | 24 Apr 2025 | 14 Mar 2025 |
| 955 | handymanservicesge.net | Google, Inc. | 20 Sep 2022 | 21 Sep 2023 | 20 Sep 2024 |
| 956 | handymanservicesvallejo.com | GoDaddy.com, LLC | 23 Sep 2022 | 5 Dec 2024 | 23 Sep 2024 |
| 957 | handymanservicesdenverllc.com | GoDaddy.com, LLC | 27 Sep 2022 | 9 Dec 2023 | 27 Sep 2023 |
| 958 | handymanservicesroofing.com | GoDaddy.com, LLC | 28 Sep 2022 | 28 Sep 2022 | 28 Sep 2027 |
| 959 | handymanservicesoflasvegas.com | GoDaddy.com, LLC | 30 Sep 2022 | 1 Oct 2024 | 30 Sep 2026 |
| 960 | handymanservicesbymark.com | Google, Inc. | 2 Oct 2022 | 17 Sep 2024 | 2 Oct 2025 |
| 961 | handymanservicessydney.com.au | - | - | 20 Jul 2023 | - |
| 962 | handymanservicesmelbourne.net.au | - | - | 29 Mar 2024 | - |
| 963 | handymanservices740.com | Google, Inc. | 4 Oct 2022 | 5 Oct 2023 | 4 Oct 2024 |
| 964 | handymanservicesjs.org | Google, Inc. | 6 Oct 2022 | 6 Oct 2022 | 6 Oct 2023 |
| 965 | handymanservicesapp.co.uk | - | 6 Oct 2022 | 6 Oct 2022 | 6 Oct 2023 |
| 966 | handymanservicesge.com | Wix.com Ltd. | 7 Oct 2022 | 17 Nov 2023 | 7 Oct 2023 |
| 967 | handymanservicesofcedarrapids.com | Tucows Domains Inc. | 7 Oct 2022 | 22 Sep 2024 | 7 Oct 2025 |
| 968 | handymanservicesbulldogremodelingllc.com | Google, Inc. | 14 Oct 2022 | 15 Oct 2023 | 14 Oct 2024 |
| 969 | handymanservicesdarwin.com.au | - | - | 2 Jun 2024 | - |
| 970 | handymanservicesofsanjose.com | Tucows Domains Inc. | 18 Oct 2022 | 3 Oct 2024 | 18 Oct 2025 |
| 971 | handymanservicesgc.com.au | - | - | 9 Feb 2025 | - |
| 972 | handymanservicesofchicago.com | Hostinger, UAB | 24 Oct 2022 | 28 Oct 2024 | 24 Oct 2025 |
| 973 | handymanservicesnv.com | GoDaddy.com, LLC | 9 Nov 2022 | 21 Jan 2024 | 9 Nov 2023 |
| 974 | handymanservicesnortheast.co.uk | - | 12 Nov 2022 | 13 Oct 2024 | 12 Nov 2025 |
| 975 | handymanservicesmccook.com | GoDaddy.com, LLC | 18 Nov 2022 | 30 Dec 2023 | 18 Nov 2023 |
| 976 | handymanservicesbyedwin.online | GoDaddy.com, LLC | 1 Dec 2022 | 2 Dec 2023 | 1 Dec 2024 |
| 977 | handymanservicesummerville.com | GoDaddy.com, LLC | 30 Nov 2022 | 11 Feb 2024 | 30 Nov 2023 |
| 978 | handymanservicesofhamptonroads.com | Squarespace Domains LLC | 14 Dec 2022 | 9 Feb 2024 | 14 Dec 2025 |
| 979 | handymanservicesofsouthhamptonroads.com | Squarespace Domains LLC | 14 Dec 2022 | 9 Feb 2024 | 14 Dec 2025 |
| 980 | handymanservicesoftheyear.com | GoDaddy.com, LLC | 22 Dec 2022 | 2 Jan 2025 | 22 Dec 2025 |
| 981 | handymanservicesgoldcoast.com | Wix.com Ltd. | 22 Dec 2020 | 26 Dec 2022 | 22 Dec 2022 |
| 982 | handymanservicesasap.com | Dynadot, LLC | 28 Dec 2022 | 8 Mar 2024 | 28 Dec 2023 |
| 983 | handymanservicestlouis.com | NameCheap, Inc. | 28 Dec 2022 | 28 Nov 2024 | 28 Dec 2025 |
| 984 | handymanserviceslittlerock.com | GoDaddy.com, LLC | 29 Dec 2022 | 12 Mar 2025 | 29 Dec 2024 |
| 985 | handymanservicesmidwestcity.com | NameCheap, Inc. | 7 Jan 2023 | 23 Dec 2024 | 7 Jan 2026 |
| 986 | handymanservicesoffresno.com | Google, Inc. | 7 Jan 2023 | 8 Jan 2024 | 7 Jan 2025 |
| 987 | handymanservicesfresnoca.com | GoDaddy.com, LLC | 9 Jan 2023 | 21 Mar 2024 | 9 Jan 2024 |
| 988 | handymanservicesbath.com | GoDaddy.com, LLC | 10 Jan 2023 | 20 Feb 2025 | 10 Jan 2025 |
| 989 | handymanservicesmiamigardens.com | GoDaddy.com, LLC | 17 Jan 2023 | 29 Jan 2024 | 17 Jan 2025 |
| 990 | handymanservicessunman.com | GoDaddy.com, LLC | 24 Jan 2023 | 6 Apr 2024 | 24 Jan 2024 |
| 991 | handymanserviceschilliwack.ca | - | 23 Nov 2018 | 25 Sep 2024 | 23 Nov 2025 |
| 992 | handymanservicesspanishfort.com | GoDaddy.com, LLC | 30 Jan 2023 | 12 Mar 2024 | 30 Jan 2024 |
| 993 | handymanservicesnorthtexas.com | Squarespace Domains LLC | 2 Feb 2023 | 24 Jan 2025 | 2 Feb 2026 |
| 994 | handymanservicesct.com | Dynadot, LLC | 5 Feb 2023 | 16 Mar 2024 | 5 Feb 2024 |
| 995 | handymanservicessaintjoseph.com | GoDaddy.com, LLC | 3 Feb 2023 | 17 Mar 2025 | 3 Feb 2025 |
| 996 | handymanservicesoflc.com | GoDaddy.com, LLC | 18 Apr 2024 | 19 Apr 2025 | 18 Apr 2026 |
| 997 | handymanservicesjournal.news | GoDaddy.com, LLC | 2 Mar 2021 | 13 Apr 2024 | 2 Mar 2024 |
| 998 | handymanservicesdenbighshire.co.uk | - | 5 Jun 2024 | 5 Jun 2024 | 5 Jun 2025 |
| 999 | handymanservicesnewyorkcity.com | Google, Inc. | 20 Feb 2023 | 3 Apr 2025 | 20 Feb 2025 |
| 1000 | handymanservicesvegas.com | GoDaddy.com, LLC | 18 Aug 2017 | 19 Aug 2023 | 18 Aug 2025 |
Displaying 1,000 out of 1,300 domains starting with the keyword "HANDYMANSERVICES". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=handymanservices
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |