Our database now contains whois records of 701 Million (701,167,677) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1596 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [701 Million Domains] $10,000 Details

Keyword: GLOBALFINANCIALSERVICES

Reverse Whois » KEYWORD [globalfinancialservices ]  { 34 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1globalfinancialservices.helpGoDaddy.com, LLC15 Apr 201527 May 201715 Apr 2017
2globalfinancialservices.us-7 Oct 20167 Oct 20166 Oct 2017
3globalfinancialservices.netGoDaddy.com, LLC11 Dec 20252 Apr 202611 Dec 2029
4globalfinancialservices.comUniregistrar Corp27 Feb 201614 Mar 202527 Feb 2034
5globalfinancialservices.info-3 Mar 20253 Mar 2025-
6globalfinancialservices.bizPDR Ltd. d/b/a PublicDomainRegistry.com12 Oct 201611 Oct 201911 Oct 2019
7globalfinancialservices.orgGoDaddy.com, LLC2 Feb 201717 Jul 20242 Feb 2027
8globalfinancialservices.co.uk-13 Dec 202229 Nov 202513 Dec 2026
9globalfinancialservices.cloudCSC Corporate Domains, Inc.25 Sep 201923 Sep 202525 Sep 2026
10globalfinancialservices.siteHostinger, UAB2 Nov 20212 Nov 20212 Nov 2022
11globalfinancialservices.ltdGoDaddy.com, LLC14 Jan 202427 Mar 202514 Jan 2025
12globalfinancialservices.onlineNameCheap, Inc.31 Aug 202412 Oct 202531 Aug 2025
13globalfinancialservicesgroup.ca----
14globalfinancialservicesgroup.com1&1 Internet AG30 Jan 201830 Jan 201830 Jan 2019
15globalfinancialservicesllc.comGoDaddy.com, LLC23 Oct 20204 Jan 202423 Oct 2023
16globalfinancialservicesasia.comeNom, Inc.12 May 20087 May 201712 May 2018
17globalfinancialservicescuba.comeNom, Inc.6 Oct 200922 Sep 20176 Oct 2018
18globalfinancialservicesandassoc.comGoDaddy.com, LLC2 Oct 20182 Oct 20182 Oct 2020
19globalfinancialservicesystem.comXin Net Technology Corporation5 Aug 20239 Aug 20245 Aug 2025
20globalfinancialservicesinc.comHostinger, UAB10 Oct 20175 Feb 202610 Oct 2027
21globalfinancialservicescorporation.comGoDaddy.com, LLC16 Jan 201917 Jan 202516 Jan 2027
22globalfinancialservicescareercoaching.proNameCheap, Inc.28 Sep 20239 Dec 202428 Sep 2024
23globalfinancialservicescareersacademy.proNameCheap, Inc.28 Sep 20239 Dec 202428 Sep 2024
24globalfinancialservicescareercoaching.academyNameCheap, Inc.28 Sep 20239 Dec 202428 Sep 2024
25globalfinancialservicescareerscoaching.academyNameCheap, Inc.28 Sep 20239 Dec 202428 Sep 2024
26globalfinancialservicescareersacademy.artNameCheap, Inc.28 Sep 20239 Dec 202428 Sep 2024
27globalfinancialservicescareercoaching.comNameCheap, Inc.28 Sep 202310 Dec 202428 Sep 2024
28globalfinancialservicescareerscoaching.comNameCheap, Inc.28 Sep 202329 Sep 202428 Sep 2025
29globalfinancialservicescareeracademy.comNameCheap, Inc.28 Sep 202310 Dec 202428 Sep 2024
30globalfinancialservicescareersacademy.comNameCheap, Inc.28 Sep 202310 Dec 202428 Sep 2024
31globalfinancialservicescareeracademy.co.uk-28 Sep 202328 Sep 202428 Sep 2024
32globalfinancialservicescareercoaching.co.uk-28 Sep 202328 Sep 202428 Sep 2024
33globalfinancialservicescareersacademy.co.uk-28 Sep 202328 Sep 202428 Sep 2024
34globalfinancialservicescareerscoaching.co.uk-28 Sep 202328 Sep 202428 Sep 2024

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=globalfinancialservices

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now