With support for 
Keyword: FMT
Reverse Whois » KEYWORD [fmt ] { 6,884 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | fmt.org.mx | asf | 12 Aug 2007 | 14 Aug 2014 | 11 Aug 2015 |
| 2 | fmt.com.tw | - | 29 Oct 2004 | - | 29 Oct 2022 |
| 3 | fmt.mobi | GoDaddy.com, LLC | 20 Jul 2017 | 20 Jul 2017 | 20 Jul 2018 |
| 4 | fmt.today | - | 16 Mar 2025 | 16 Mar 2025 | 16 Mar 2026 |
| 5 | fmt.education | GoDaddy.com, LLC | 1 Mar 2017 | 22 Jul 2024 | 1 Mar 2027 |
| 6 | fmt.center | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 7 | fmt.church | eNom, Inc. | 26 Sep 2014 | 10 Nov 2020 | 26 Sep 2025 |
| 8 | fmt.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Aug 2020 | 1 May 2024 | 9 Aug 2032 |
| 9 | fmt.bzh | BDL Systemes SAS dba ProDomaines | 4 Dec 2014 | 18 Jan 2025 | 4 Dec 2025 |
| 10 | fmt.physio | eNom, Inc. | 6 Dec 2014 | 12 Nov 2017 | 6 Dec 2018 |
| 11 | fmt.solutions | GoDaddy.com, LLC | 13 Aug 2020 | 27 Sep 2024 | 13 Aug 2026 |
| 12 | fmt.kim | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 2 Feb 2018 | 3 Feb 2018 | 2 Feb 2019 |
| 13 | fmt.care | NameCheap, Inc. | 1 Feb 2021 | 1 Feb 2021 | 1 Feb 2022 |
| 14 | fmt.club | NameCheap, Inc. | 1 Apr 2022 | 16 Apr 2024 | 1 Apr 2024 |
| 15 | fmt.link | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 4 Jul 2020 | 5 Jun 2024 | 4 Jul 2025 |
| 16 | fmt.ren | Xin Net Technology Corporation | 15 Jun 2015 | - | 15 Jun 2016 |
| 17 | fmt.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Jun 2015 | 1 Jul 2017 | 27 Jun 2018 |
| 18 | fmt.support | Network Solutions, LLC | 7 Jul 2015 | 13 May 2017 | 7 Jul 2019 |
| 19 | fmt.click | NameCheap, Inc. | 8 Apr 2021 | 14 Mar 2025 | 8 Apr 2026 |
| 20 | fmt.rocks | 1API GmbH | 28 Jul 2015 | 3 Jul 2024 | 28 Jul 2025 |
| 21 | fmt.party | Alpnames Limited | 12 May 2015 | - | 11 May 2016 |
| 22 | fmt.red | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 22 Jun 2022 | 30 Jul 2024 | 22 Jun 2024 |
| 23 | fmt.online | West263 International Limited | 11 Dec 2016 | 12 Dec 2016 | 11 Dec 2017 |
| 24 | fmt.site | Chengdu West Dimension Digital Technology Co., Ltd… | 13 Oct 2015 | 18 Jul 2017 | 13 Oct 2017 |
| 25 | fmt.net | Above.com Pty Ltd. | 25 Sep 2000 | 7 Jun 2023 | 26 Sep 2026 |
| 26 | fmt.one | Cronon AG | 3 Oct 2017 | 17 Nov 2024 | 3 Oct 2025 |
| 27 | fmt.org | Dynadot, LLC | 12 Jan 2000 | 29 Mar 2025 | 12 Jan 2027 |
| 28 | fmt.com | Dynadot, LLC | 18 May 1995 | 4 Feb 2025 | 19 May 2027 |
| 29 | fmt.academy | GoDaddy.com, LLC | 11 Nov 2015 | 6 Jan 2017 | 11 Nov 2017 |
| 30 | fmt.global | Domain.com, LLC | 22 Aug 2019 | 12 Aug 2024 | 22 Aug 2025 |
| 31 | fmt.swiss | HOSTPOINT AG | 11 Dec 2015 | - | 11 Dec 2016 |
| 32 | fmt.ovh | OVH sas | 5 Jul 2023 | 2 Aug 2024 | 5 Jul 2024 |
| 33 | fmt.gift | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Dec 2015 | - | 19 Dec 2016 |
| 34 | fmt.lol | Dynadot, LLC | 9 Dec 2022 | 10 Dec 2023 | 9 Dec 2024 |
| 35 | fmt.tech | Chengdu West Dimension Digital Technology Co., Ltd… | 12 Jan 2016 | 12 Mar 2025 | 12 Jan 2026 |
| 36 | fmt.news | GoDaddy.com, LLC | 28 Jan 2022 | 14 Mar 2025 | 28 Jan 2026 |
| 37 | fmt.help | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Jan 2016 | - | 17 Jan 2017 |
| 38 | fmt.blue | Netowl, Inc. | 28 Mar 2022 | 29 Mar 2023 | 28 Mar 2024 |
| 39 | fmt.black | West263 International Limited | 19 Feb 2016 | - | 19 Feb 2017 |
| 40 | fmt.network | GoDaddy.com, LLC | 20 Nov 2019 | 13 Nov 2024 | 20 Nov 2025 |
| 41 | fmt.pink | West263 International Limited | 29 Feb 2016 | - | 28 Feb 2017 |
| 42 | fmt.ink | DNSPod, Inc. | 4 Sep 2021 | 20 Oct 2024 | 4 Sep 2025 |
| 43 | fmt.bet | Web Commerce Communications Limited dba WebNic.cc | 3 Mar 2016 | - | 3 Mar 2017 |
| 44 | fmt.press | NameCheap, Inc. | 8 Mar 2016 | 8 Mar 2016 | 8 Mar 2017 |
| 45 | fmt.co | Chengdu West Dimension Digital Technology Co., Ltd… | 23 Sep 2014 | 11 Sep 2024 | 22 Sep 2025 |
| 46 | fmt.company | GoDaddy.com, LLC | 27 Sep 2024 | 2 Oct 2024 | 27 Sep 2026 |
| 47 | fmt.biz | Key-Systems GmbH | 27 Mar 2002 | 6 Dec 2024 | 22 Oct 2025 |
| 48 | fmt.gmbh | Cronon AG | 22 Jun 2016 | 6 Aug 2024 | 22 Jun 2025 |
| 49 | fmt.ltd | Google, Inc. | 17 Aug 2022 | 7 Aug 2024 | 17 Aug 2025 |
| 50 | fmt.win | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 17 Jun 2016 | 4 Nov 2016 | 16 Jun 2019 |
| 51 | fmt.guru | NameCheap, Inc. | 26 Jul 2024 | 31 Jul 2024 | 26 Jul 2025 |
| 52 | fmt.shoes | GoDaddy.com, LLC | 23 May 2014 | 6 Jan 2017 | 23 May 2019 |
| 53 | fmt.systems | Melbourne IT, Ltd | 29 Nov 2015 | 1 Nov 2019 | 29 Nov 2020 |
| 54 | fmt.expert | Melbourne IT, Ltd | 29 Nov 2015 | 30 Nov 2019 | 29 Nov 2020 |
| 55 | fmt.store | NameCheap, Inc. | 3 Oct 2018 | 3 Oct 2018 | 3 Oct 2019 |
| 56 | fmt.vip | Hangzhou AiMing Network Co., LTD | 29 Aug 2016 | 11 Mar 2025 | 29 Aug 2025 |
| 57 | fmt.info | Dynadot, LLC | 26 Dec 2005 | 26 Feb 2024 | 26 Dec 2025 |
| 58 | fmt.us | GoDaddy.com, LLC | 24 Apr 2002 | 23 Apr 2025 | 23 Apr 2026 |
| 59 | fmt.cat | AB NameISP | 8 Feb 2015 | 13 Jan 2017 | 8 Feb 2018 |
| 60 | fmt.be | - | 19 Mar 2001 | - | - |
| 61 | fmt.cc | NameCheap, Inc. | 6 Aug 2014 | 7 Apr 2025 | 6 Aug 2026 |
| 62 | fmt.de | - | - | 7 Nov 2019 | - |
| 63 | fmt.fr | - | 24 Feb 2024 | 26 Mar 2025 | 24 Feb 2026 |
| 64 | fmt.me | Regional Network Information Center, JSC dba RU-CE… | 27 May 2013 | 1 Jun 2024 | 27 May 2025 |
| 65 | fmt.it | - | 19 Oct 1999 | 31 Mar 2025 | 15 Mar 2026 |
| 66 | fmt.kr | - | 19 May 2008 | 17 Oct 2017 | 19 May 2018 |
| 67 | fmt.pl | - | 6 Jun 2000 | 5 Jun 2017 | 5 Jun 2018 |
| 68 | fmt.co.uk | - | 23 Sep 1998 | 13 Nov 2024 | 23 Sep 2025 |
| 69 | fmt.tv | 1API GmbH | 21 Feb 2014 | 9 Apr 2024 | 21 Feb 2025 |
| 70 | fmt.space | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Jan 2017 | - | 20 Jan 2018 |
| 71 | fmt.photos | GoDaddy.com, LLC | 20 Jul 2017 | 20 Jul 2017 | 20 Jul 2018 |
| 72 | fmt.tips | GoDaddy.com, LLC | 20 Jul 2017 | 20 Jul 2017 | 20 Jul 2018 |
| 73 | fmt.org.uk | - | 2 Feb 2025 | 6 Feb 2025 | 2 Feb 2026 |
| 74 | fmt.taxi | GMO Internet Inc. | 15 Jun 2018 | 5 Jun 2024 | 15 Jun 2025 |
| 75 | fmt.equipment | Network Solutions, LLC | 18 Dec 2018 | 18 Dec 2018 | 18 Dec 2019 |
| 76 | fmt.pictures | Tucows Domains Inc. | 24 May 2019 | 25 May 2024 | 24 May 2025 |
| 77 | fmt.plus | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 22 Jun 2022 | 22 Aug 2024 | 22 Jun 2024 |
| 78 | fmt.codes | Gandi SAS | 19 Nov 2019 | 24 Nov 2019 | 19 Nov 2020 |
| 79 | fmt.uk | - | 29 Mar 2019 | 1 May 2025 | 29 Mar 2026 |
| 80 | fmt.email | GoDaddy.com, LLC | 14 Feb 2017 | 30 Mar 2020 | 14 Feb 2021 |
| 81 | fmt.agency | Regional Network Information Center, JSC dba RU-CE… | 28 Jul 2020 | 28 Jul 2020 | 28 Jul 2021 |
| 82 | fmt.fitness | NameCheap, Inc. | 14 Oct 2020 | 15 Oct 2020 | 14 Oct 2021 |
| 83 | fmt.cool | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Mar 2021 | 9 May 2024 | 9 Mar 2024 |
| 84 | fmt.world | GoDaddy.com, LLC | 27 Sep 2024 | 2 Oct 2024 | 27 Sep 2026 |
| 85 | fmt.co.id | - | 14 Nov 2016 | 29 Oct 2022 | 14 Nov 2023 |
| 86 | fmt.icu | Google, Inc. | 12 Nov 2021 | 20 Dec 2024 | 12 Nov 2025 |
| 87 | fmt.clinic | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Nov 2021 | 16 Nov 2021 | 16 Nov 2022 |
| 88 | fmt.rest | Porkbun, LLC | 4 Dec 2021 | 4 Dec 2021 | 4 Dec 2022 |
| 89 | fmt.wiki | Porkbun, LLC | 11 Dec 2021 | 21 Jan 2024 | 11 Dec 2023 |
| 90 | fmt.zone | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 12 Feb 2022 | 16 Feb 2025 | 12 Feb 2030 |
| 91 | fmt.digital | NameKing.com Inc. | 3 Oct 2024 | 23 Oct 2024 | 3 Oct 2025 |
| 92 | fmt.life | GoDaddy.com, LLC | 13 Sep 2024 | 18 Sep 2024 | 13 Sep 2025 |
| 93 | fmt.asia | Web Commerce Communications Limited dba WebNic.cc | 14 May 2020 | 19 Apr 2025 | 14 May 2026 |
| 94 | fmt.frl | Hosting Concepts B.V. dba Openprovider | 1 May 2019 | 27 Mar 2025 | 1 May 2026 |
| 95 | fmt.or.kr | - | 12 Aug 2005 | 20 Feb 2009 | 12 Aug 2025 |
| 96 | fmt.ma | - | 26 Aug 2015 | 19 Aug 2024 | 26 Aug 2025 |
| 97 | fmt.co.in | GoDaddy.com, LLC | 3 Jan 2012 | 26 Jan 2024 | 3 Jan 2028 |
| 98 | fmt.us.com | Network Solutions, LLC | 11 May 2008 | 21 Mar 2024 | 11 May 2029 |
| 99 | fmt.best | Limited Liability Company "Registrar of domain nam… | 4 Dec 2022 | 5 Dec 2023 | 4 Dec 2024 |
| 100 | fmt.dev | Google, Inc. | 17 May 2019 | 1 Jul 2024 | 17 May 2025 |
| 101 | fmt.la | Reserved for non-billable transactions where Regis… | 19 Nov 2023 | 13 Nov 2024 | 19 Nov 2025 |
| 102 | fmt.app | NameKing.com Inc. | 8 May 2018 | 23 Oct 2024 | 8 May 2025 |
| 103 | fmt.bar | NameCheap, Inc. | 16 Apr 2022 | 12 May 2022 | 16 Apr 2024 |
| 104 | fmt.co.th | - | 29 Mar 2000 | 26 Mar 2024 | 28 Mar 2029 |
| 105 | fmt.training | 1API GmbH | 1 Feb 2023 | 18 Mar 2025 | 1 Feb 2026 |
| 106 | fmt.fo | - | 3 Mar 2017 | 5 Mar 2025 | 3 Mar 2026 |
| 107 | fmt.llc | GoDaddy.com, LLC | 17 Oct 2022 | 1 Dec 2024 | 17 Oct 2025 |
| 108 | fmt.foundation | Network Solutions, LLC | 8 Aug 2022 | 10 Aug 2023 | 8 Aug 2024 |
| 109 | fmt.fun | NameCheap, Inc. | 17 Jun 2018 | 30 Jul 2023 | 17 Jun 2023 |
| 110 | fmt.in | Dynadot, LLC | 10 Aug 2010 | 5 Apr 2025 | 10 Aug 2026 |
| 111 | fmt.kiwi | eNom, Inc. | 29 Sep 2021 | 3 Sep 2024 | 29 Sep 2025 |
| 112 | fmt.co.jp | - | 25 Dec 1996 | 1 Jan 2025 | - |
| 113 | fmt.name | eNom, Inc. | - | - | - |
| 114 | fmt.ninja | Google, Inc. | 19 Apr 2022 | 19 Apr 2023 | 19 Apr 2024 |
| 115 | fmt.nl | - | 12 Sep 1996 | 12 Aug 2023 | - |
| 116 | fmt.co.nz | - | 4 Apr 2006 | 14 Mar 2025 | - |
| 117 | fmt.com.pl | - | 2 Aug 2019 | 2 Aug 2024 | 2 Aug 2025 |
| 118 | fmt.com.pt | - | - | - | - |
| 119 | fmt.pw | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jul 2015 | 31 Aug 2023 | 6 Jul 2030 |
| 120 | fmt.website | Mesh Digital Limited | 27 Aug 2015 | 10 Oct 2024 | 27 Aug 2024 |
| 121 | fmt.ai | - | - | - | - |
| 122 | fmt.lat | Porkbun, LLC | 25 Aug 2023 | 8 Oct 2024 | 25 Aug 2024 |
| 123 | fmt.md | - | 26 Jun 2023 | - | - |
| 124 | fmt.finance | 1&1 Internet AG | 4 Dec 2023 | 18 Jan 2025 | 4 Dec 2025 |
| 125 | fmt.gives | Tucows Domains Inc. | 20 Dec 2023 | 30 Jan 2025 | 20 Dec 2024 |
| 126 | fmt.monster | Namesilo, LLC | 19 Dec 2023 | 21 Feb 2025 | 19 Dec 2024 |
| 127 | fmt.jp | - | 23 May 2001 | 1 Jun 2024 | 31 May 2025 |
| 128 | fmt.org.pl | - | 12 Jan 2024 | 17 Apr 2025 | 12 Jan 2026 |
| 129 | fmt.com.au | - | - | 13 Dec 2024 | - |
| 130 | fmt.com.br | - | 25 Jun 2019 | 30 Sep 2024 | 25 Jun 2025 |
| 131 | fmt.com.cn | - | 16 Apr 2006 | - | 16 Apr 2030 |
| 132 | fmt.ro | - | 22 Jan 2019 | - | 20 Jan 2026 |
| 133 | fmt.services | - | 4 Oct 2024 | 17 Dec 2024 | 4 Oct 2025 |
| 134 | fmt.ru | - | 2 Jul 2019 | - | 2 Jul 2025 |
| 135 | fmt.sk | - | 23 Jan 2020 | 7 Feb 2025 | 23 Jan 2026 |
| 136 | fmt.dk | - | 24 Mar 1998 | - | 31 Mar 2026 |
| 137 | fmt.se | - | 18 Oct 1995 | 24 Dec 2024 | 31 Dec 2025 |
| 138 | fmt.com.co | HELLO.CO|CENTRAL COMERCIALIZADORA DE INTERNET S.A.… | 26 Apr 2023 | 2 Apr 2025 | 26 Apr 2026 |
| 139 | fmt.africa | 101domain, Inc. | 16 Jul 2024 | 31 Jan 2025 | 16 Jul 2025 |
| 140 | fmt.capital | Squarespace Domains LLC | 27 Jul 2024 | 1 Aug 2024 | 27 Jul 2025 |
| 141 | fmt.bot | NameCheap, Inc. | 1 Sep 2024 | 1 Sep 2024 | 1 Sep 2025 |
| 142 | fmt.fyi | NameCheap, Inc. | 1 Sep 2024 | 6 Sep 2024 | 1 Sep 2025 |
| 143 | fmt.wtf | NameCheap, Inc. | 1 Sep 2024 | 6 Sep 2024 | 1 Sep 2025 |
| 144 | fmt.financial | Tucows Domains Inc. | 18 Sep 2024 | 23 Sep 2024 | 18 Sep 2025 |
| 145 | fmt.cz | - | 10 Oct 2006 | 18 Nov 2024 | 10 Oct 2026 |
| 146 | fmt.io | - | 16 Feb 2016 | 22 Jan 2025 | 16 Feb 2026 |
| 147 | fmt.ae | - | - | - | - |
| 148 | fmt.au | - | - | 13 Sep 2024 | - |
| 149 | fmt.ca | Namespro Solutions Inc. | 18 May 2022 | 6 May 2024 | 18 May 2025 |
| 150 | fmt.eu | - | - | - | - |
| 151 | fmt.net.cn | - | 13 Jan 2025 | - | 13 Jan 2026 |
| 152 | fmtconsultants.com | GoDaddy.com, LLC | 29 Jan 2004 | 30 Jan 2025 | 29 Jan 2028 |
| 153 | fmtropical.net | Atomicdomainnames.com LLC | 1 Apr 2017 | 1 Apr 2017 | 1 Apr 2018 |
| 154 | fmtransport.co.uk | - | 15 Jul 2017 | 25 May 2024 | 15 Jul 2025 |
| 155 | fmtunerinfo.com | Tucows Domains Inc. | 9 Jan 2003 | 11 Dec 2024 | 9 Jan 2026 |
| 156 | fmtn.org | GoDaddy.com, LLC | 30 Nov 1998 | 13 Jan 2025 | 29 Nov 2025 |
| 157 | fmtek-shop.com | Hosting Concepts B.V. dba Openprovider | 23 Mar 2010 | 21 Feb 2025 | 23 Mar 2028 |
| 158 | fmtotal.de | - | - | 2 Sep 2024 | - |
| 159 | fmt-shop.de | - | - | 14 Jan 2021 | - |
| 160 | fmtc.co | NameCheap, Inc. | 3 Feb 2014 | 8 Jan 2025 | 2 Feb 2026 |
| 161 | fmtrader.com | GoDaddy.com, LLC | 17 Feb 2010 | 3 Feb 2025 | 17 Feb 2026 |
| 162 | fmturkey.net | GoDaddy.com, LLC | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 163 | fmturkiye.net | Beijing Lanhai Jiye Technology Co., Ltd | 26 Mar 2025 | 28 Mar 2025 | 26 Mar 2026 |
| 164 | fmtusd.org | Network Solutions, LLC | 28 Jul 1997 | 22 Jul 2024 | 27 Jul 2025 |
| 165 | fmtv.com | Melbourne IT, Ltd | 28 Sep 1999 | 20 Sep 2024 | 28 Sep 2025 |
| 166 | fmtvforum.net | Shanghai Meicheng Technology Information Co., Ltd | 23 Nov 2016 | 23 Nov 2016 | 23 Nov 2017 |
| 167 | fmtraderscam.com | Launchpad, Inc. | 21 Oct 2014 | 6 Oct 2017 | 21 Oct 2018 |
| 168 | fmtacademy.com | DropCatch.com 936 LLC | 9 Jan 2017 | 10 Jan 2018 | 9 Jan 2019 |
| 169 | fmtconstructionservicesllc.net | Tucows Domains Inc. | 16 Oct 2012 | 20 Oct 2014 | 16 Oct 2015 |
| 170 | fmtoday.info | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2016 |
| 171 | fmtrustonline.com | CloudFlare, Inc. | 16 Feb 2001 | 25 Mar 2025 | 16 Feb 2026 |
| 172 | fmtoday.biz | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 21 Oct 2016 |
| 173 | fmthihp.com | Network Solutions, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 174 | fmtoday.net | GoDaddy.com, LLC | 15 Nov 2024 | 15 Nov 2024 | 15 Nov 2025 |
| 175 | fmtazkz.us | - | 21 Oct 2014 | - | 20 Oct 2015 |
| 176 | fmt-nl.com | Tucows Domains Inc. | 25 Aug 2011 | 10 Oct 2024 | 25 Aug 2025 |
| 177 | fmtiempo.cl | - | 28 Aug 1998 | - | 23 Sep 2025 |
| 178 | fmtoday.org | Megazone Corp., dba HOSTING.KR | 14 Jun 2022 | 26 Jul 2023 | 14 Jun 2023 |
| 179 | fmthormone.net | GMO Internet Inc. | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 180 | fmtsintegrations.com | Tucows Domains Inc. | 24 Oct 2014 | 24 Sep 2024 | 24 Oct 2025 |
| 181 | fmt-egypt.com | GoDaddy.com, LLC | 19 Jul 2020 | 20 Jul 2024 | 19 Jul 2025 |
| 182 | fmtrout.com | Hongkong Domain Name Information Management Co., L… | 26 Mar 2022 | 2 Jun 2023 | 26 Mar 2023 |
| 183 | fmtrac.com | Name.com, Inc. | 1 Dec 2015 | 8 Apr 2017 | 1 Dec 2018 |
| 184 | fmtechnologysolutions.com | GoDaddy.com, LLC | 30 Jul 2018 | 30 Jul 2018 | 30 Jul 2019 |
| 185 | fmtj-c65.com | Cloud Yuqu LLC | 7 Sep 2019 | 7 Sep 2019 | 7 Sep 2020 |
| 186 | fmtrax.com | GoDaddy.com, LLC | 5 Jun 2013 | 6 Jun 2015 | 5 Jun 2016 |
| 187 | fmtrasporti.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Jul 2019 | 24 Jul 2024 | 26 Jul 2025 |
| 188 | fmtas.com | GoDaddy.com, LLC | 2 Apr 2021 | 21 Feb 2025 | 2 Apr 2026 |
| 189 | fmtechnology.com | GoDaddy.com, LLC | 27 Aug 2002 | 28 Feb 2025 | 27 Aug 2025 |
| 190 | fmtri.com | eNom, Inc. | 2 Aug 2012 | 2 Aug 2024 | 2 Aug 2025 |
| 191 | fmtiumts.biz | - | 28 Oct 2014 | - | 27 Oct 2015 |
| 192 | fmtiempovm.com | Dynadot, LLC | 21 Sep 2021 | 22 Sep 2024 | 21 Sep 2025 |
| 193 | fmt-api.com | Google, Inc. | 29 Oct 2014 | 14 Oct 2024 | 29 Oct 2025 |
| 194 | fmto.com | GoDaddy.com, LLC | 3 Apr 2005 | 16 Feb 2025 | 3 Apr 2026 |
| 195 | fmtoys.com | Xin Net Technology Corporation | 30 Oct 2014 | 26 Oct 2024 | 30 Oct 2025 |
| 196 | fmtagency.com | GoDaddy.com, LLC | 7 Apr 2021 | 8 Apr 2025 | 7 Apr 2026 |
| 197 | fmtueren.com | Cronon AG | 31 Oct 2014 | 1 Nov 2024 | 31 Oct 2025 |
| 198 | fmtraslochicirie.com | Register.it SPA | 31 Oct 2014 | 1 Oct 2016 | 31 Oct 2017 |
| 199 | fmtadvocates.com | Marcaria.com International, Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 200 | fmtransports.com | TurnCommerce, Inc. DBA NameBright.com | 21 Jan 2016 | 2 Apr 2025 | 21 Jan 2025 |
| 201 | fmtcanada.com | Above.com Pty Ltd. | 2 Jun 2022 | 2 Jun 2022 | 2 Jun 2023 |
| 202 | fmtraffic.com | GoDaddy.com, LLC | 26 Dec 2013 | 19 Jun 2015 | 26 Dec 2016 |
| 203 | fmtrax.net | eNom, Inc. | 17 Nov 2011 | 15 Nov 2016 | 17 Nov 2017 |
| 204 | fmtauxw.com | Network Solutions, LLC | 2 Jun 2014 | 4 Jun 2015 | 2 Jun 2016 |
| 205 | fmtricks.com | NameCheap, Inc. | 29 Sep 2021 | - | 29 Sep 2022 |
| 206 | fmtwz.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Nov 2021 | 22 Nov 2023 | 21 Nov 2024 |
| 207 | fmt-training.com | FastDomain Inc. | 8 Sep 2023 | 21 Nov 2024 | 8 Sep 2024 |
| 208 | fmtrk.com | Key-Systems GmbH | 28 Aug 2024 | 28 Jan 2025 | 28 Aug 2025 |
| 209 | fmtc.com | Network Solutions, LLC | 12 Oct 1995 | 8 Jul 2021 | 11 Oct 2026 |
| 210 | fmtzs886.com | Turbonames LLC | 5 Nov 2021 | 5 Nov 2021 | 5 Nov 2022 |
| 211 | fmt-tgf.com | Everyones Internet, Ltd. dba SoftLayer | 3 Nov 2014 | 5 Nov 2018 | 3 Nov 2019 |
| 212 | fmteaamm.us | - | 2 Nov 2014 | - | 1 Nov 2015 |
| 213 | fmtalk1005.com | Firstround Names LLC | 22 Mar 2021 | 27 Mar 2025 | 22 Mar 2026 |
| 214 | fmtransmittersrus.com | GMO Internet Inc. | 4 Nov 2014 | 5 Nov 2014 | 4 Nov 2015 |
| 215 | fmthaionline.com | - | - | - | - |
| 216 | fmtexpu.com | Domain Grabber LLC | 30 Sep 2019 | 1 Oct 2019 | 30 Sep 2020 |
| 217 | fmtprivateequity.com | BigRock Solutions Ltd. | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 218 | fmtipt.com | Tucows Domains Inc. | 21 Jun 2012 | 25 Jun 2015 | 21 Jun 2016 |
| 219 | fmtradersbd.com | NameCheap, Inc. | 24 Jun 2015 | 11 Dec 2023 | 24 Jun 2025 |
| 220 | fmtukiye.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 221 | fmtpbzy.com | Dynadot, LLC | 2 Jun 2019 | 2 Jun 2019 | 2 Jun 2020 |
| 222 | fmttx.com | - | 26 Oct 2024 | 29 Oct 2024 | 26 Oct 2025 |
| 223 | fmtabletennis.com | register.com, Inc. | 12 Jan 2015 | 14 Jan 2025 | 12 Jan 2027 |
| 224 | fmtradingresearch.com | Name Thread Corporation | 14 Jan 2020 | 16 Jan 2020 | 14 Jan 2021 |
| 225 | fmtcnc.com | HiChina Zhicheng Technology Limited | 7 Nov 2014 | 1 Dec 2021 | 7 Nov 2026 |
| 226 | fmtrees.com | GoDaddy.com, LLC | 21 Aug 2014 | 22 Aug 2024 | 21 Aug 2025 |
| 227 | fmtswkj.com | DNSPod, Inc. | 26 Jun 2023 | 27 Jun 2023 | 26 Jun 2026 |
| 228 | fmtexascares.com | register.com, Inc. | 6 Feb 2015 | 20 Feb 2017 | 6 Feb 2018 |
| 229 | fmtrucksllc.com | Wild West Domains, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 230 | fmting.net | Bizcn.com, Inc. | 23 Jun 2022 | 27 Jul 2023 | 23 Jun 2023 |
| 231 | fmteconecta.com | Realtime Register B.V. | 12 Nov 2022 | 26 Nov 2023 | 12 Nov 2023 |
| 232 | fmtechsolution.com | GoDaddy.com, LLC | 23 May 2023 | 23 May 2023 | 23 May 2025 |
| 233 | fmtjob.com | HiChina Zhicheng Technology Limited | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 234 | fmt46.net | GMO Internet Inc. | 6 Nov 2014 | 7 Nov 2014 | 6 Nov 2015 |
| 235 | fmtradicion971.com | GoDaddy.com, LLC | 12 Aug 2014 | 12 Aug 2024 | 12 Aug 2025 |
| 236 | fmteconecta.net | eNom, Inc. | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 237 | fmt-germany.com | Cronon AG | 25 Aug 2014 | 14 Oct 2024 | 25 Aug 2025 |
| 238 | fmtartgallery.com | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 239 | fmtnhk.com | Network Solutions, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 240 | fmtvshvf.com | GoDaddy.com, LLC | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 241 | fmtechsolution.net | GoDaddy.com, LLC | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2015 |
| 242 | fmtxc.com | DNSPod, Inc. | 19 Mar 2025 | 20 Mar 2025 | 19 Mar 2026 |
| 243 | fmth88.com | - | 21 Mar 2023 | 29 Mar 2025 | 21 Mar 2026 |
| 244 | fmtoolbox.com | eNom, Inc. | 28 Aug 2014 | 30 Jul 2024 | 28 Aug 2025 |
| 245 | fmtengineering.com | Cronon AG | 5 Jun 2024 | 25 Jul 2024 | 5 Jun 2025 |
| 246 | fmtdzs.com | Xin Net Technology Corporation | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 247 | fmteameli.com | Launchpad, Inc. | 12 Nov 2014 | 17 May 2017 | 12 Nov 2017 |
| 248 | fmtrader-singapore.com | GoDaddy.com, LLC | 13 Nov 2014 | 9 Sep 2015 | 8 Sep 2017 |
| 249 | fmtechnic.com | Hongkong Domain Name Information Management Co., L… | 12 Oct 2019 | 12 Oct 2019 | 12 Oct 2020 |
| 250 | fmtransitions.com | GoDaddy.com, LLC | 13 Sep 2014 | 14 Sep 2023 | 13 Sep 2025 |
| 251 | fmtxtz.com | Xin Net Technology Corporation | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 252 | fmtbe.com | TurnCommerce, Inc. DBA NameBright.com | 26 Mar 2020 | 27 Apr 2024 | 26 Mar 2024 |
| 253 | fmtcdb.com | Uniregistrar Corp | - | - | - |
| 254 | fmtzses.com | OnlineNIC, Inc. | 3 Dec 2015 | 27 Nov 2016 | 3 Dec 2017 |
| 255 | fmt-global.com | GoDaddy.com, LLC | 27 Sep 2024 | 27 Sep 2024 | 27 Sep 2026 |
| 256 | fmtu.net | NameCheap, Inc. | 15 Apr 2021 | 27 Jun 2024 | 15 Apr 2024 |
| 257 | fmtecnostore.com | Name.com, Inc. | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 258 | fmtfoodtech.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 14 Jun 2024 | 14 Jun 2024 | 14 Jun 2025 |
| 259 | fmtropical939.com | Dattatec.com SRL | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 260 | fmtumusica909.com | Dattatec.com SRL | 4 Sep 2014 | 25 Jul 2017 | 4 Sep 2018 |
| 261 | fmtkdubai.com | Wild West Domains, LLC | 17 Sep 2014 | 29 Nov 2024 | 17 Sep 2024 |
| 262 | fmtate.com | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Nov 2019 | 26 Nov 2019 | 26 Nov 2020 |
| 263 | fmtesche.com | 1API GmbH | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 264 | fmtekstil-bg.com | eNom, Inc. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 265 | fmtvshv.com | Network Solutions, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 266 | fmtzlc.com | Gandi SAS | 25 Nov 2016 | 26 Nov 2017 | 25 Nov 2017 |
| 267 | fmtire.com | - | 29 Sep 2024 | 29 Sep 2024 | 29 Sep 2025 |
| 268 | fmthmc.com | Names On The Drop LLC | 1 Dec 2021 | 2 Dec 2021 | 1 Dec 2022 |
| 269 | fmt688.com | HiChina Zhicheng Technology Limited | 15 Apr 2018 | 15 Apr 2018 | 15 Apr 2019 |
| 270 | fmt-ps5sb.com | GMO Internet Inc. | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 271 | fmticfhch.us | - | 15 Nov 2014 | - | 14 Nov 2015 |
| 272 | fmtginc.com | GoDaddy.com, LLC | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2016 |
| 273 | fmtvision.org | GoDaddy.com, LLC | 5 Sep 2014 | 6 Sep 2014 | 5 Sep 2015 |
| 274 | fmtemplate.com | Japan Registry Services Co., Ltd. | 29 Nov 2019 | 25 Sep 2024 | 29 Nov 2025 |
| 275 | fmt56.com | HiChina Zhicheng Technology Limited | 16 Nov 2018 | 25 Feb 2019 | 16 Nov 2019 |
| 276 | fmtvshow.com | WhatIsYourDomain LLC | 30 May 2014 | 31 May 2017 | 30 May 2018 |
| 277 | fmt-anlagen.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Sep 2014 | 9 Aug 2017 | 8 Sep 2018 |
| 278 | fmtransformation.com | GoDaddy.com, LLC | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 279 | fmtechacademy.com | Cosmotown, Inc. | 27 Aug 2024 | 25 Oct 2024 | 27 Aug 2025 |
| 280 | fmtueleccion.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2014 | 9 Sep 2017 | 9 Sep 2018 |
| 281 | fmtones.com | - | - | - | - |
| 282 | fmtropical952.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Nov 2014 | 23 Nov 2016 | 19 Nov 2017 |
| 283 | fmtropic.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 28 Feb 2021 | 28 Feb 2021 | 28 Feb 2022 |
| 284 | fmtefczu6k706xwi.com | GMO Internet Inc. | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 285 | fmt-wine.com | TurnCommerce, Inc. DBA NameBright.com | 3 Mar 2019 | 9 Apr 2019 | 3 Mar 2020 |
| 286 | fmteamhomes.com | GoDaddy.com, LLC | 1 Oct 2014 | 2 Oct 2016 | 1 Oct 2018 |
| 287 | fmtdbgi.com | Network Solutions, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 288 | fmtchina.com | HiChina Zhicheng Technology Limited | 2 Oct 2014 | 27 Sep 2024 | 2 Oct 2025 |
| 289 | fmtlp.com | eName Technology Co., Ltd. | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 290 | fmtransmitter.info | Namesilo, LLC | 21 Jan 2017 | 21 Jan 2018 | 21 Jan 2019 |
| 291 | fmtunebd.com | GoDaddy.com, LLC | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 292 | fmtzyy.com | Xin Net Technology Corporation | 6 Oct 2014 | 5 Dec 2024 | 6 Oct 2025 |
| 293 | fmtzyy.net | Xin Net Technology Corporation | 6 Oct 2014 | 7 Feb 2021 | 6 Oct 2021 |
| 294 | fmtglex.com | Network Solutions, LLC | 23 Sep 2014 | 24 Sep 2014 | 23 Sep 2015 |
| 295 | fmtdg.com | HiChina Zhicheng Technology Limited | 12 Mar 2018 | 12 Mar 2018 | 12 Mar 2019 |
| 296 | fmterraplenagem.com | DropCatch.com 509 LLC | 24 Dec 2016 | 25 Dec 2017 | 24 Dec 2018 |
| 297 | fmtumusica.com | NamePal.com #8025 | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 298 | fmtunited.com | Tucows Domains Inc. | 6 Oct 2014 | 10 Oct 2015 | 6 Oct 2016 |
| 299 | fmtmhhb.com | Xin Net Technology Corporation | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 300 | fmtrial.com | TurnCommerce, Inc. DBA NameBright.com | 10 Jul 2019 | 11 Aug 2024 | 10 Jul 2024 |
| 301 | fmtpill.com | GoDaddy.com, LLC | 5 May 2022 | 6 May 2024 | 5 May 2025 |
| 302 | fmtwealthmanagers.com | register.com, Inc. | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 303 | fmtfw.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Dec 2021 | 27 Aug 2024 | 20 Dec 2025 |
| 304 | fmtpills.com | GoDaddy.com, LLC | 5 May 2022 | 6 May 2024 | 5 May 2025 |
| 305 | fmtqh.com | Hangzhou AiMing Network Co., LTD | 19 Feb 2016 | 19 Feb 2016 | 19 Feb 2017 |
| 306 | fmtest1.com | Launchpad, Inc. | 27 Sep 2014 | 12 Sep 2017 | 27 Sep 2018 |
| 307 | fmt6-uhmgw.org | GMO Internet Inc. | 20 Nov 2014 | 21 Nov 2014 | 20 Nov 2015 |
| 308 | fmtdah.com | Arsys Internet, S.L. dba NICLINE.COM | 29 Sep 2014 | 30 Sep 2017 | 29 Sep 2018 |
| 309 | fmtrx.com | 1&1 Internet AG | 16 Sep 2020 | 16 Sep 2020 | 16 Sep 2025 |
| 310 | fmtph.com | HiChina Zhicheng Technology Limited | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 311 | fmtz388.com | Bizcn.com, Inc. | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 312 | fmtcyberindustry.com | GMO Internet Inc. | 12 Oct 2014 | 23 Mar 2015 | 12 Oct 2017 |
| 313 | fmtdayo.com | GMO Internet Inc. | 12 Oct 2014 | 13 Sep 2016 | 12 Oct 2019 |
| 314 | fmtdesign.com | Annulet LLC | 12 Oct 2014 | 29 Nov 2024 | 12 Oct 2025 |
| 315 | fmtm.info | West263 International Limited | 10 Apr 2017 | 9 Jun 2017 | 10 Apr 2018 |
| 316 | fmtq8jm.com | Soluciones Corporativas IP, SLU | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 317 | fmtok.com | GoDaddy.com, LLC | 9 Jan 2021 | 20 Feb 2025 | 9 Jan 2025 |
| 318 | fmtechkft.com | DotRoll Kft. | 27 Sep 2014 | 27 Sep 2017 | 27 Sep 2018 |
| 319 | fmt-machinery.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 14 Dec 2021 | 14 Dec 2021 | 14 Dec 2022 |
| 320 | fmtrikodizayn.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 13 Oct 2014 | 23 Nov 2024 | 13 Oct 2024 |
| 321 | fmtufp.com | eName Technology Co., Ltd. | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 322 | fmtrichy.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2017 |
| 323 | fmtllc.net | GoDaddy.com, LLC | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 324 | fmtfz.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Mar 2022 | 13 Mar 2025 | 19 Mar 2026 |
| 325 | fmtjsln.com | register.com, Inc. | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 326 | fmtworld.com | TurnCommerce, Inc. DBA NameBright.com | 1 Jan 2018 | 10 Feb 2025 | 1 Jan 2025 |
| 327 | fmtswjvhhieuopncycimfgqvgijca.biz | - | 25 Nov 2014 | 9 Jan 2017 | 24 Nov 2017 |
| 328 | fmtrepuestos.com | Cronon AG | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 329 | fmtsh.com | Sksa Technology Co., Ltd | 24 Feb 2025 | 24 Feb 2025 | 24 Feb 2026 |
| 330 | fmtp.us | - | 17 Oct 2014 | - | 16 Oct 2015 |
| 331 | fmtulsa.com | Click Registrar, Inc. d/b/a publicdomainregistry.c… | 28 Mar 2022 | 29 Mar 2023 | 28 Mar 2024 |
| 332 | fmtconstructionservicesllc.com | Tucows Domains Inc. | 16 Oct 2012 | 20 Oct 2014 | 16 Oct 2015 |
| 333 | fmt0728.com | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Mar 2018 | 19 Mar 2018 | 19 Mar 2019 |
| 334 | fmtdesigns.com | GoDaddy.com, LLC | 17 Jun 2019 | 17 Jun 2019 | 17 Jun 2020 |
| 335 | fmtfan.com | Web Commerce Communications Limited dba WebNic.cc | 24 Apr 2025 | 24 Apr 2025 | 24 Apr 2026 |
| 336 | fmt-n.com | eNom, Inc. | 28 Nov 2014 | 18 Nov 2017 | 28 Nov 2018 |
| 337 | fmtwydztpdylzprxqhewsxgeqqbi.info | Reserved for non-billable transactions where Regis… | 28 Nov 2014 | 28 Nov 2019 | 28 Nov 2020 |
| 338 | fmtextiles.com | TurnCommerce, Inc. DBA NameBright.com | 29 Nov 2014 | 8 Jan 2025 | 29 Nov 2024 |
| 339 | fmtvwrstrkdqohyylbuhekbrwvs.org | - | 28 Nov 2014 | 12 Jan 2025 | 28 Nov 2025 |
| 340 | fmtcpnirfydmgehqhhahytqgdkfyp.org | - | 28 Nov 2014 | 12 Jan 2025 | 28 Nov 2025 |
| 341 | fmtsapi.com | Tucows Domains Inc. | 1 Dec 2014 | 1 Nov 2024 | 1 Dec 2025 |
| 342 | fmtraduzioni.com | Network Solutions, LLC | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2016 |
| 343 | fmtswiss.com | eNom, Inc. | 6 Jun 2008 | 9 Jun 2017 | 6 Jun 2017 |
| 344 | fmtopo.com | OVH sas | 30 Nov 2010 | 1 Dec 2024 | 30 Nov 2025 |
| 345 | fmtemp.net | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 346 | fmttea.com | HiChina Zhicheng Technology Limited | 5 Dec 2014 | 5 Dec 2014 | 5 Dec 2015 |
| 347 | fmtribuna.com | Wild West Domains, LLC | 11 Jun 2021 | 11 Jun 2021 | 11 Jun 2022 |
| 348 | fmtmall.com | - | 19 Dec 2022 | 20 Dec 2023 | 19 Dec 2024 |
| 349 | fmtonline.net | HiChina Zhicheng Technology Limited | 5 Dec 2014 | 5 Dec 2014 | 5 Dec 2015 |
| 350 | fmtracker.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 351 | fmthings.com | NameCheap, Inc. | 7 Nov 2022 | 19 Jan 2024 | 7 Nov 2023 |
| 352 | fmttepa.org | register.com, Inc. | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 353 | fmtopdf.com | 1&1 Internet AG | 8 Dec 2014 | 10 Mar 2018 | 8 Dec 2025 |
| 354 | fmtang.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Jun 2021 | 7 Mar 2025 | 16 Jun 2025 |
| 355 | fmtmodel.com | Beijing Lanhai Jiye Technology Co., Ltd | 13 Mar 2022 | 14 Mar 2025 | 13 Mar 2026 |
| 356 | fmteknik.net | IHS Telekom, Inc. | 18 Jan 2019 | 18 Jan 2019 | 18 Jan 2021 |
| 357 | fmtcg.com | GoDaddy.com, LLC | 16 Mar 2024 | 16 Mar 2024 | 16 Mar 2029 |
| 358 | fmtscales.com | Tucows Domains Inc. | 12 Dec 2014 | 22 Jan 2024 | 12 Dec 2023 |
| 359 | fmtrzb.com | - | 24 Jul 2022 | 25 Sep 2023 | 24 Jul 2023 |
| 360 | fmtwiki.com | GoDaddy.com, LLC | 1 May 2019 | 1 May 2019 | 1 May 2020 |
| 361 | fmt-agency-studio.com | GMO Internet Inc. | 22 Dec 2014 | 23 Mar 2015 | 22 Dec 2017 |
| 362 | fmtdrycargo.com | Tucows Domains Inc. | 22 Dec 2014 | 7 Dec 2024 | 22 Dec 2025 |
| 363 | fmtwiki.org | Launchpad, Inc. | 21 Dec 2014 | 18 Dec 2016 | 21 Dec 2018 |
| 364 | fmtdrycargo.net | Tucows Domains Inc. | 22 Dec 2014 | 7 Dec 2024 | 22 Dec 2025 |
| 365 | fmtqp.com | GoDaddy.com, LLC | 5 Feb 2020 | 5 Feb 2020 | 5 Feb 2021 |
| 366 | fmtoxico.com | Dattatec.com SRL | 26 Dec 2014 | 2 Jan 2017 | 26 Dec 2017 |
| 367 | fmtxh.com | HiChina Zhicheng Technology Limited | 13 Mar 2016 | 25 Aug 2017 | 13 Mar 2018 |
| 368 | fmtrustlonline.com | Tucows Domains Inc. | 25 Dec 2011 | 29 Dec 2014 | 25 Dec 2015 |
| 369 | fmtmed.com | HiChina Zhicheng Technology Limited | 31 Dec 2014 | 3 Dec 2024 | 31 Dec 2033 |
| 370 | fmtzcgl.com | Xin Net Technology Corporation | 25 Jul 2017 | 25 Jul 2017 | 25 Jul 2018 |
| 371 | fmtrends.us | - | 6 Oct 2016 | 6 Oct 2016 | 5 Oct 2017 |
| 372 | fmtc.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Feb 2025 | 1 Mar 2025 | 13 Feb 2026 |
| 373 | fmtcew.xyz | GMO Internet Inc. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 374 | fmtwvs.xyz | Crazy Domains FZ-LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 375 | fmtg.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Nov 2015 | 8 Aug 2017 | 29 Nov 2018 |
| 376 | fmtzxq.xyz | Xin Net Technology Corporation | 12 Oct 2014 | - | 12 Oct 2015 |
| 377 | fmtqh.xyz | Xin Net Technology Corporation | 13 Oct 2014 | - | 13 Oct 2015 |
| 378 | fmthb1k.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Oct 2014 | - | 29 Oct 2015 |
| 379 | fmtp3z.xyz | Foshan YiDong Network Co., LTD | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 380 | fmtv.london | eNom, Inc. | 11 Nov 2014 | 10 Dec 2024 | 11 Nov 2025 |
| 381 | fmtpv.red | GMO Internet Inc. | 23 Dec 2014 | 23 Dec 2014 | 23 Dec 2015 |
| 382 | fmtt11750.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Mar 2015 | - | 20 Mar 2016 |
| 383 | fmtt11749.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Mar 2015 | - | 20 Mar 2016 |
| 384 | fmtt11748.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Mar 2015 | - | 20 Mar 2016 |
| 385 | fmtt11747.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Mar 2015 | - | 20 Mar 2016 |
| 386 | fmtt11746.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Mar 2015 | - | 20 Mar 2016 |
| 387 | fmtt11745.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Mar 2015 | - | 20 Mar 2016 |
| 388 | fmtt11744.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Mar 2015 | - | 20 Mar 2016 |
| 389 | fmtt11743.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Mar 2015 | - | 20 Mar 2016 |
| 390 | fmtt11742.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Mar 2015 | - | 20 Mar 2016 |
| 391 | fmtt11741.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Mar 2015 | - | 20 Mar 2016 |
| 392 | fmtt11570.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Mar 2015 | - | 19 Mar 2016 |
| 393 | fmtt11569.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Mar 2015 | - | 19 Mar 2016 |
| 394 | fmtt11568.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Mar 2015 | - | 19 Mar 2016 |
| 395 | fmtt11567.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Mar 2015 | - | 19 Mar 2016 |
| 396 | fmtt11566.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Mar 2015 | - | 19 Mar 2016 |
| 397 | fmtt11565.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Mar 2015 | - | 19 Mar 2016 |
| 398 | fmtt11564.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Mar 2015 | - | 19 Mar 2016 |
| 399 | fmtt11563.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Mar 2015 | - | 19 Mar 2016 |
| 400 | fmtt11562.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Mar 2015 | - | 19 Mar 2016 |
| 401 | fmtt11561.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Mar 2015 | - | 19 Mar 2016 |
| 402 | fmtcmeduwtg33.website | GMO Internet Inc. | 26 Mar 2015 | - | 26 Mar 2016 |
| 403 | fmtranslator.net | DNC Holdings, Inc. | 13 Aug 2015 | 2 Jul 2017 | 13 Aug 2018 |
| 404 | fmtarco.com | Network Solutions, LLC | 13 Aug 2015 | 14 Jun 2024 | 13 Aug 2025 |
| 405 | fmta.science | Alpnames Limited | 19 Apr 2015 | 19 Apr 2015 | 18 Apr 2016 |
| 406 | fmtxtv.science | Alpnames Limited | 17 Apr 2015 | - | 16 Apr 2016 |
| 407 | fmtpm.science | Alpnames Limited | 16 Apr 2015 | 16 Apr 2015 | 15 Apr 2016 |
| 408 | fmtmj.science | Alpnames Limited | 20 Apr 2015 | - | 19 Apr 2016 |
| 409 | fmtxi.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Apr 2015 | 28 Apr 2015 | 27 Apr 2016 |
| 410 | fmtl.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 May 2015 | 4 May 2015 | 3 May 2016 |
| 411 | fmtum.science | Alpnames Limited | 3 May 2015 | 3 May 2015 | 2 May 2016 |
| 412 | fmtextmessages.com | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 413 | fmtexpressllc.com | DomainPeople, Inc. | 5 Jan 2015 | 31 Dec 2024 | 5 Jan 2026 |
| 414 | fmtycollection.com | GoDaddy.com, LLC | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2017 |
| 415 | fmtaxlegal.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2015 | 10 Mar 2017 | 8 Jan 2019 |
| 416 | fmtai.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 22 Nov 2024 | 22 Nov 2024 | 22 Nov 2025 |
| 417 | fmtycollection.us | GoDaddy.com, LLC | 7 Jan 2015 | 7 Jan 2015 | 6 Jan 2017 |
| 418 | fmtransmittertest.com | NameCheap, Inc. | 15 Aug 2015 | 27 Oct 2023 | 15 Aug 2023 |
| 419 | fmtfloor.com | Eranet International Limited | 17 Jun 2022 | 18 Jun 2023 | 17 Jun 2023 |
| 420 | fmtaf.uno | 1API GmbH | 15 Aug 2015 | 15 Aug 2015 | 14 Aug 2016 |
| 421 | fmthq.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Mar 2022 | 20 Mar 2024 | 19 Mar 2025 |
| 422 | fmtsas.com | TLDs LLC dba SRSplus | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 423 | fmtracks.org | GoDaddy.com, LLC | 13 Jan 2015 | 8 Jul 2024 | 13 Jan 2026 |
| 424 | fmtracks.net | GoDaddy.com, LLC | 13 Jan 2015 | 17 Sep 2022 | 13 Jan 2026 |
| 425 | fmtks.com | - | 13 Oct 2022 | 14 Nov 2023 | 13 Oct 2023 |
| 426 | fmtz2m.org | Tucows Domains Inc. | 11 Jan 2014 | 15 Jan 2015 | 11 Jan 2016 |
| 427 | fmtov.party | Alpnames Limited | 20 May 2015 | - | 19 May 2016 |
| 428 | fmtv.wang | eName Technology Co., Ltd. | 18 May 2015 | 12 Nov 2016 | 18 May 2018 |
| 429 | fmtlss.party | Alpnames Limited | 1 Jun 2015 | - | 31 May 2016 |
| 430 | fmtkp.webcam | Alpnames Limited | 3 Jun 2015 | - | 2 Jun 2016 |
| 431 | fmte.pics | Uniregistrar Corp | 20 Jun 2015 | 20 Jun 2015 | 20 Jun 2016 |
| 432 | fmtc.wang | eName Technology Co., Ltd. | 1 Jul 2015 | 6 Nov 2016 | 1 Jul 2018 |
| 433 | fmtj.click | Uniregistrar Corp | 12 Jul 2015 | 12 Jul 2015 | 12 Jul 2016 |
| 434 | fmtoh.science | Alpnames Limited | 9 Jul 2015 | - | 8 Jul 2016 |
| 435 | fmt-pictures.news | Namesilo, LLC | 15 Jul 2015 | 7 Jul 2024 | 15 Jul 2025 |
| 436 | fmthmkht.xyz | GMO Internet Inc. | 25 Jul 2015 | 26 Jul 2015 | 25 Jul 2016 |
| 437 | fmttg.click | Uniregistrar Corp | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 438 | fmtda.click | Uniregistrar Corp | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 439 | fmtmf.click | Uniregistrar Corp | 30 Jul 2015 | 30 Jul 2015 | 30 Jul 2016 |
| 440 | fmtyn.cricket | Alpnames Limited | 4 Aug 2015 | - | 3 Aug 2016 |
| 441 | fmtu.date | Alpnames Limited | 5 Aug 2015 | - | 4 Aug 2016 |
| 442 | fmttd.cricket | Alpnames Limited | 7 Aug 2015 | - | 6 Aug 2016 |
| 443 | fmtwq.date | Alpnames Limited | 10 Aug 2015 | - | 9 Aug 2016 |
| 444 | fmtarif.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Dec 2017 | 4 Dec 2017 | 4 Dec 2018 |
| 445 | fmtcdc.com | Eranet International Limited | 30 May 2022 | 31 May 2023 | 30 May 2023 |
| 446 | fmtft.date | Alpnames Limited | 17 Aug 2015 | - | 16 Aug 2016 |
| 447 | fmteacher.com | - | - | - | - |
| 448 | fmtdrsd.com | Network Solutions, LLC | 20 Jan 2014 | 20 Jan 2015 | 20 Jan 2016 |
| 449 | fmtvaz.com | Limited Liability Company "Registrar of domain nam… | 21 Jan 2015 | 21 Jan 2015 | 21 Jan 2016 |
| 450 | fmtransportationservices.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Mar 2025 | 23 Mar 2025 | 22 Mar 2026 |
| 451 | fmtecno.com | Name.com, Inc. | 10 Feb 2024 | 25 Mar 2025 | 10 Feb 2025 |
| 452 | fmtband.com | Domain.com, LLC | 23 Jan 2015 | 8 Jan 2017 | 23 Jan 2018 |
| 453 | fmths.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Mar 2023 | 30 Apr 2024 | 29 Mar 2024 |
| 454 | fmtipz.net | BigRock Solutions Ltd. | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 455 | fmtag.us | eNom, Inc. | 18 Aug 2015 | 15 Mar 2017 | 17 Aug 2018 |
| 456 | fmtpaotui.com | Shanghai Meicheng Technology Information Co., Ltd | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2016 |
| 457 | fmtdevices.com | eNom, Inc. | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2016 |
| 458 | fmtihc.science | Alpnames Limited | 7 May 2015 | 7 May 2015 | 6 May 2016 |
| 459 | fmtm.party | Alpnames Limited | 11 May 2015 | - | 10 May 2016 |
| 460 | fmtech-ksa.com | GoDaddy.com, LLC | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2017 |
| 461 | fmtrt.com | Dynadot, LLC | 19 Jan 2022 | 21 Jan 2022 | 19 Jan 2023 |
| 462 | fmtserver.com | GoDaddy.com, LLC | 5 Feb 2015 | 6 Feb 2015 | 5 Feb 2016 |
| 463 | fmtour.net | Gabia, Inc. | 3 Feb 2006 | 4 Feb 2017 | 3 Feb 2018 |
| 464 | fmthairadio.com | Everyones Internet, Ltd. dba SoftLayer | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 465 | fmtbg.com | Eranet International Limited | 10 Jan 2025 | 15 Jan 2025 | 10 Jan 2026 |
| 466 | fmtyetfk.com | Xiamen Nawang Technology Co., Ltd | 10 Feb 2015 | 13 Feb 2016 | 10 Feb 2017 |
| 467 | fmtreeservices.com | GoDaddy.com, LLC | 11 Feb 2025 | 11 Feb 2025 | 11 Feb 2026 |
| 468 | fmtable.com | DropCatch.com 1052 LLC | 20 Nov 2023 | 30 Dec 2024 | 20 Nov 2024 |
| 469 | fmtutmqp.com | Xiamen Nawang Technology Co., Ltd | 10 Feb 2015 | 12 Feb 2016 | 10 Feb 2017 |
| 470 | fmtraderfx.com | GoDaddy.com, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2017 |
| 471 | fmtpnj.us | - | 11 Feb 2015 | - | 10 Feb 2016 |
| 472 | fmtoolset.com | GoDaddy.com, LLC | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 473 | fmtrim.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 474 | fmtccouponpress.com | NameCheap, Inc. | 14 Feb 2015 | 14 Oct 2024 | 14 Feb 2026 |
| 475 | fmtcclipper.com | NameCheap, Inc. | 14 Feb 2015 | 14 Oct 2024 | 14 Feb 2026 |
| 476 | fmtsf.us | - | 13 Feb 2015 | - | 12 Feb 2016 |
| 477 | fmtop100radio.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Feb 2015 | 15 Feb 2015 | 15 Feb 2016 |
| 478 | fmtmxzchgg0gunu3.com | GMO Internet Inc. | 16 Feb 2015 | 16 Feb 2015 | 16 Feb 2016 |
| 479 | fmtcg.net | - | 4 May 2021 | 5 May 2021 | 4 May 2022 |
| 480 | fmturko.com | FBS Inc. | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 481 | fmtrivia.com | NameCheap, Inc. | 12 Apr 2022 | 12 Apr 2025 | 12 Apr 2026 |
| 482 | fmtc-dz.com | OnlineNIC, Inc. | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 483 | fmtemizlik.com | IHS Telekom, Inc. | 3 Nov 2023 | 8 Dec 2024 | 3 Nov 2025 |
| 484 | fmtuner.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 May 2017 | 11 Jul 2017 | 11 May 2018 |
| 485 | fmtcr.com | - | 14 Mar 2022 | 14 Mar 2022 | 14 Mar 2023 |
| 486 | fmt8937.com | Network Solutions, LLC | 22 Feb 2014 | 24 Feb 2015 | 22 Feb 2016 |
| 487 | fmtsisagn.net | GMO Internet Inc. | 24 Feb 2015 | 9 Feb 2025 | 24 Feb 2026 |
| 488 | fmtpjnrvoxdymnlblvwdijrae.net | - | - | - | - |
| 489 | fmtitleco.org | GoDaddy.com, LLC | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2016 |
| 490 | fmtitleco.net | - | - | - | - |
| 491 | fmtitleco.info | GoDaddy.com, LLC | 24 Feb 2015 | - | 24 Feb 2016 |
| 492 | fmtb.com | - | 26 Feb 2015 | 15 Feb 2025 | 26 Feb 2026 |
| 493 | fmttenis.com | GMO Internet Inc. | 12 Nov 2016 | 16 Nov 2016 | 11 Nov 2017 |
| 494 | fmtsc88.com | HiChina Zhicheng Technology Limited | 23 Aug 2015 | 23 Aug 2015 | 23 Aug 2016 |
| 495 | fmtanks.org | - | 23 Aug 2015 | 23 Aug 2015 | 23 Aug 2017 |
| 496 | fmtailors.com | Tucows Domains Inc. | 3 Jan 2018 | 15 Mar 2024 | 3 Jan 2024 |
| 497 | fmtfacilitair.com | Key-Systems GmbH | 5 Mar 2015 | 6 Mar 2015 | 5 Mar 2016 |
| 498 | fmtettur.com | Network Solutions, LLC | 3 Mar 2014 | 5 Mar 2015 | 3 Mar 2016 |
| 499 | fmtranslates.com | Tucows Domains Inc. | 9 Mar 2015 | 27 Feb 2025 | 9 Mar 2026 |
| 500 | fmtjxrb.com | Network Solutions, LLC | 7 Mar 2014 | 9 Mar 2015 | 7 Mar 2016 |
| 501 | fmtitanium.com | TurnCommerce, Inc. DBA NameBright.com | 28 May 2017 | 29 Jun 2024 | 28 May 2024 |
| 502 | fmtocatudo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 503 | fmtyy.net | - | 23 Aug 2023 | 24 Aug 2024 | 23 Aug 2025 |
| 504 | fmtrade24.com | Mesh Digital Limited | 12 Mar 2015 | 11 Mar 2017 | 12 Mar 2018 |
| 505 | fmtju.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2016 |
| 506 | fmtna.net | PSI-USA, Inc. dba Domain Robot | 25 Aug 2015 | 14 Oct 2024 | 25 Aug 2025 |
| 507 | fmtsteelgulf.com | Name.com, Inc. | 15 Mar 2015 | 20 Feb 2017 | 15 Mar 2018 |
| 508 | fmthmjj.com | Namesilo, LLC | 30 Oct 2018 | 30 Oct 2018 | 30 Oct 2019 |
| 509 | fmtdubai.com | NameCheap, Inc. | 6 Jan 2023 | 20 Mar 2025 | 6 Jan 2025 |
| 510 | fmtdevents.com | Key-Systems GmbH | 20 Mar 2015 | 19 Mar 2017 | 20 Mar 2018 |
| 511 | fmtd-events.com | Key-Systems GmbH | 20 Mar 2015 | 19 Mar 2017 | 20 Mar 2018 |
| 512 | fmtgaming.com | Vautron Rechenzentrum AG | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 513 | fmtbbw.com | TurnCommerce, Inc. DBA NameBright.com | 7 Jul 2018 | 23 Aug 2024 | 7 Jul 2025 |
| 514 | fmtbank.com | HiChina Zhicheng Technology Limited | 23 Mar 2015 | 29 Mar 2024 | 23 Mar 2034 |
| 515 | fmtuan.com | Web Commerce Communications Limited dba WebNic.cc | 14 Aug 2024 | 26 Oct 2022 | 14 Aug 2025 |
| 516 | fmtim.com | DropCatch.com 1545 LLC | 22 Jun 2022 | 23 Jul 2023 | 22 Jun 2023 |
| 517 | fmtutoringservices.com | Tucows Domains Inc. | 21 Mar 2014 | 25 Mar 2015 | 21 Mar 2016 |
| 518 | fmtshop.com | OVH sas | 15 Mar 2025 | 15 Mar 2025 | 14 Mar 2026 |
| 519 | fmtuan.net | HiChina Zhicheng Technology Limited | 23 Mar 2015 | 12 Apr 2017 | 23 Mar 2018 |
| 520 | fmtvlive.com | NameCheap, Inc. | 6 Jul 2021 | 5 Jul 2024 | 6 Jul 2025 |
| 521 | fmtranslatorstore.com | GoDaddy.com, LLC | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 522 | fmtrusstent.com | GoDaddy.com, LLC | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 523 | fmtsafety.com | eNom, Inc. | 27 Mar 2015 | 1 Mar 2017 | 27 Mar 2018 |
| 524 | fmtrack.com | TurnCommerce, Inc. DBA NameBright.com | 28 Mar 2015 | 13 Feb 2025 | 28 Mar 2025 |
| 525 | fmtrader.asia | GMO Internet Inc. | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 526 | fmtywj.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 Feb 2024 | 5 Apr 2025 | 4 Feb 2026 |
| 527 | fmtsz.com | HiChina Zhicheng Technology Limited | 14 Jun 2016 | 6 Sep 2017 | 14 Jun 2018 |
| 528 | fmtrigueiros.com | GoDaddy.com, LLC | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2020 |
| 529 | fmtglobalresources.com | Beijing Lanhai Jiye Technology Co., Ltd | 26 Aug 2023 | 15 Apr 2025 | 26 Aug 2025 |
| 530 | fmtelugu.com | DomainName Driveway, Inc. | 18 Jun 2018 | 18 Jun 2018 | 18 Jun 2019 |
| 531 | fmtchem.com | Namesilo, LLC | 29 Aug 2020 | 29 Aug 2022 | 29 Aug 2022 |
| 532 | fmtzg.com | HiChina Zhicheng Technology Limited | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 533 | fmtwsbqkfvwuwtsrknbttkvwruc.biz | - | 28 Aug 2015 | 12 Oct 2017 | 27 Aug 2018 |
| 534 | fmtp9.com | 1&1 Internet AG | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 535 | fmtoursandsafaris-tz.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 536 | fmtlive.com | Google, Inc. | 28 May 2021 | 28 May 2021 | 28 May 2022 |
| 537 | fmtlife.com | GoDaddy.com, LLC | 31 May 2017 | 31 May 2017 | 31 May 2018 |
| 538 | fmt365.com | Beijing Lanhai Jiye Technology Co., Ltd | 1 Dec 2024 | 16 Mar 2025 | 1 Dec 2026 |
| 539 | fmtxcp.com | Namesilo, LLC | 9 Sep 2021 | 9 Sep 2024 | 9 Sep 2025 |
| 540 | fmtwelding.com | DROPCATCH.COM 792 LLC | 12 Jun 2017 | 13 Jun 2017 | 12 Jun 2018 |
| 541 | fmtellmp.com | GMO Internet Inc. | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 542 | fmtflnh.com | GoDaddy.com, LLC | 5 Apr 2015 | 5 Apr 2015 | 5 Apr 2016 |
| 543 | fmtoaqxy.us | - | 4 Apr 2015 | - | 3 Apr 2016 |
| 544 | fmttufxf.com | GMO Internet Inc. | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 545 | fmtjs.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 29 Apr 2021 | 30 Apr 2023 | 29 Apr 2023 |
| 546 | fmtaylor.com | GoDaddy.com, LLC | 21 Dec 2021 | 27 Oct 2024 | 21 Dec 2026 |
| 547 | fmtrain.com | Gabia, Inc. | 2 Feb 2024 | 21 Jan 2025 | 1 Feb 2026 |
| 548 | fmtrade.net | - | 29 Mar 2024 | 25 Mar 2025 | 29 Mar 2026 |
| 549 | fmtortcycuivcmdcifacurwxsqot.info | Reserved for non-billable transactions where Regis… | 31 Aug 2015 | 31 Aug 2019 | 31 Aug 2020 |
| 550 | fmtlyf.com | Key-Systems GmbH | 17 Apr 2023 | 31 May 2024 | 17 Apr 2024 |
| 551 | fmtunisie.com | Cronon AG | 14 Sep 2021 | 14 Sep 2021 | 14 Sep 2022 |
| 552 | fmtee.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Apr 2022 | 21 Apr 2024 | 20 Apr 2025 |
| 553 | fmt022.com | GoDaddy.com, LLC | 2 Sep 2015 | 3 Sep 2015 | 2 Sep 2016 |
| 554 | fmttraders.com | GoDaddy.com, LLC | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 555 | fmttreinamentofuncional.com | Network Solutions, LLC | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2016 |
| 556 | fmticaret.com | - | 26 Jun 2023 | 20 Jul 2024 | 26 Jun 2025 |
| 557 | fmtuangou.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 2 Oct 2022 | 2 Oct 2022 | 2 Oct 2023 |
| 558 | fmtriunfo.com | - | 1 Sep 2024 | 18 Apr 2025 | 1 Sep 2025 |
| 559 | fmteksolutions.com | GoDaddy.com, LLC | 11 Apr 2015 | 11 Apr 2015 | 11 Apr 2016 |
| 560 | fmtvsite.org | TLD Registrar Solutions Ltd. | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2016 |
| 561 | fmtelecom.net | Network Solutions, LLC | 9 Apr 2015 | 5 Mar 2017 | 9 Apr 2022 |
| 562 | fmtrd.com | One.com A/S | 12 Apr 2015 | 5 Apr 2025 | 12 Apr 2026 |
| 563 | fmtv.top | Namesilo, LLC | 25 Jan 2025 | 25 Jan 2025 | 25 Jan 2026 |
| 564 | fmtchina.org | UdomainName.com LLC | 15 Sep 2023 | 29 Oct 2024 | 15 Sep 2024 |
| 565 | fmtnutrition.com | Wild West Domains, LLC | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2017 |
| 566 | fmthomebiz.com | Wild West Domains, LLC | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2017 |
| 567 | fmtyjj.com | Xin Net Technology Corporation | 8 Nov 2017 | 9 Nov 2017 | 8 Nov 2018 |
| 568 | fmtou.com | Key-Systems GmbH | 29 Oct 2024 | 28 Jan 2025 | 29 Oct 2025 |
| 569 | fmtechservices.com | GoDaddy.com, LLC | 17 Apr 2015 | 22 Apr 2025 | 17 Apr 2026 |
| 570 | fmts-llc.com | FastDomain Inc. | 20 Apr 2015 | 6 Apr 2025 | 20 Apr 2026 |
| 571 | fmtechniek.info | Tucows Domains Inc. | 18 Apr 2013 | 22 Apr 2015 | 18 Apr 2016 |
| 572 | fmtsp.com | - | 12 Aug 2024 | 16 Aug 2024 | 12 Aug 2025 |
| 573 | fmthod-sima.com | - | 10 Jul 2024 | 10 Jul 2024 | 10 Jul 2025 |
| 574 | fmtzk.com | West263 International Limited | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2017 |
| 575 | fmtxwuo.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 576 | fmtvibe.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2016 |
| 577 | fmtopweb.com | GoDaddy.com, LLC | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2016 |
| 578 | fmtadvisory.com | GoDaddy.com, LLC | 28 Apr 2015 | 28 Apr 2025 | 28 Apr 2030 |
| 579 | fmtadvisor.com | GoDaddy.com, LLC | 28 Apr 2015 | 18 Sep 2022 | 28 Apr 2026 |
| 580 | fmthc.info | Crazy Domains FZ-LLC | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 581 | fmtnt.com | HiChina Zhicheng Technology Limited | 1 Mar 2016 | 1 Mar 2016 | 1 Mar 2017 |
| 582 | fmtimbga.net | GMO Internet Inc. | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 583 | fmtapper.com | Regional Network Information Center, JSC dba RU-CE… | 8 Sep 2015 | - | 8 Sep 2017 |
| 584 | fmtshami.com | Launchpad, Inc. | 30 Apr 2015 | 9 Apr 2017 | 30 Apr 2018 |
| 585 | fmt-asosiation.com | Netowl, Inc. | 1 May 2015 | 2 May 2017 | 1 May 2017 |
| 586 | fmtransmisores.com | GoDaddy.com, LLC | 26 Jul 2017 | 10 Jul 2024 | 26 Jul 2025 |
| 587 | fmtzs.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 588 | fmtraveltour.com | CV. Jogjacamp | 10 Sep 2015 | 10 Sep 2015 | 10 Sep 2016 |
| 589 | fmtna.us | PSI-USA, Inc. dba Domain Robot | 3 May 2015 | 17 Jun 2024 | 2 May 2025 |
| 590 | fmtctogo.com | NameCheap, Inc. | 5 May 2015 | 5 Apr 2025 | 5 May 2026 |
| 591 | fmtc2go.com | NameCheap, Inc. | 5 May 2015 | 5 Apr 2025 | 5 May 2026 |
| 592 | fmtx88.com | - | 17 Apr 2023 | 18 Apr 2024 | 17 Apr 2025 |
| 593 | fmtblue.com | GoDaddy.com, LLC | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 594 | fmtconsultores.com | Arsys Internet, S.L. dba NICLINE.COM | 8 May 2015 | 6 Jul 2017 | 8 May 2019 |
| 595 | fmtassociates.com | Wild West Domains, LLC | 8 May 2015 | 2 Apr 2025 | 8 May 2026 |
| 596 | fmthost.com | NameKing.com Inc. | 27 Oct 2023 | 17 Apr 2025 | 27 Oct 2025 |
| 597 | fmtcastleford.com | Eranet International Limited | 4 Mar 2021 | 4 Mar 2021 | 4 Mar 2022 |
| 598 | fmtsteel.net | GoDaddy.com, LLC | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 599 | fmttreatment.com | Epik Inc. | 9 May 2015 | 12 Jun 2022 | 9 May 2025 |
| 600 | fmttherapy.com | Epik Inc. | 9 May 2015 | 12 Jun 2022 | 9 May 2025 |
| 601 | fmtforum.com | Epik Inc. | 9 May 2015 | 12 Jun 2022 | 9 May 2025 |
| 602 | fmtclinics.com | Epik Inc. | 9 May 2015 | 12 Jun 2022 | 9 May 2025 |
| 603 | fmtclinic.com | Epik Inc. | 9 May 2015 | 11 May 2022 | 9 May 2025 |
| 604 | fmtcoord.org | GoDaddy.com, LLC | 11 May 2015 | 11 May 2015 | 11 May 2016 |
| 605 | fmtohomissvljy.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 May 2015 | 13 May 2015 | 13 May 2016 |
| 606 | fmtdp.com | HiChina Zhicheng Technology Limited | 13 May 2015 | 28 Nov 2024 | 13 May 2025 |
| 607 | fmtei.info | GoDaddy.com, LLC | 17 May 2015 | - | 17 May 2016 |
| 608 | fmttest.com | Tucows Domains Inc. | 17 May 2010 | 21 May 2015 | 17 May 2016 |
| 609 | fmtna.com | TurnCommerce, Inc. DBA NameBright.com | 8 Aug 2019 | 2 Aug 2020 | 8 Aug 2025 |
| 610 | fmtly.com | Amazon Registrar, Inc. | 2 Oct 2023 | 28 Aug 2024 | 2 Oct 2025 |
| 611 | fmturadio.com | Dattatec.com SRL | 22 May 2015 | 22 May 2015 | 22 May 2016 |
| 612 | fmtqs.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Aug 2016 | 3 Oct 2017 | 22 Aug 2017 |
| 613 | fmtysb.com | GMO Internet Inc. | 23 May 2022 | 3 Aug 2023 | 23 May 2023 |
| 614 | fmtrinidad.com | Dattatec.com SRL | 26 Sep 2019 | 26 Sep 2019 | 26 Sep 2020 |
| 615 | fmtdistribution.com | Ligne Web Services SARL | 7 Sep 2024 | 7 Sep 2024 | 7 Sep 2025 |
| 616 | fmtechnologysas.info | Tucows Domains Inc. | 23 May 2009 | 23 May 2009 | 23 May 2017 |
| 617 | fmtcontracting.com | GoDaddy.com, LLC | 14 Sep 2015 | 15 Sep 2024 | 14 Sep 2026 |
| 618 | fmtw.net | - | 18 Sep 2023 | 19 Sep 2024 | 18 Sep 2025 |
| 619 | fmtt.net | CloudFlare, Inc. | 27 Feb 2024 | 8 Apr 2025 | 27 Feb 2025 |
| 620 | fmtj.net | Key-Systems GmbH | 2 Aug 2021 | 14 Sep 2022 | 2 Aug 2024 |
| 621 | fmtb.net | eName Technology Co., Ltd. | 30 May 2015 | 25 Apr 2017 | 30 May 2018 |
| 622 | fmtww.us | - | 30 May 2015 | - | 29 May 2016 |
| 623 | fmttrade.com | Beijing Lanhai Jiye Technology Co., Ltd | 8 Apr 2023 | 9 Apr 2025 | 8 Apr 2026 |
| 624 | fmtwpmp34b3m.com | GMO Internet Inc. | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 625 | fmtjx.com | Beijing Lanhai Jiye Technology Co., Ltd | 5 Jun 2015 | 7 Jul 2024 | 5 Jun 2024 |
| 626 | fmtataira.net | Universo Online S/A (UOL) | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 627 | fmtune.com | GoDaddy.com, LLC | 1 Sep 2024 | 1 Sep 2024 | 1 Sep 2025 |
| 628 | fmtmgc.com | - | - | - | - |
| 629 | fmtransmittertest.net | Name.com, Inc. | 7 Jun 2015 | 7 Jun 2017 | 7 Jun 2018 |
| 630 | fmtzdl.com | HiChina Zhicheng Technology Limited | 9 Jun 2015 | 9 Jun 2015 | 9 Jun 2016 |
| 631 | fmtol.com | HiChina Zhicheng Technology Limited | 9 Jun 2015 | 2 Jul 2024 | 9 Jun 2025 |
| 632 | fmtzyz.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 5 May 2022 | 5 May 2022 | 5 May 2023 |
| 633 | fmtyy.com | MAFF Inc. | 12 Nov 2017 | 21 Jan 2025 | 12 Nov 2024 |
| 634 | fmthomerenovations.com | Tucows Domains Inc. | 26 Jun 2017 | 26 Jun 2017 | 26 Jun 2018 |
| 635 | fmtfood.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 5 Jun 2013 | 9 Jun 2015 | 5 Jun 2016 |
| 636 | fmtutela.org | 10dencehispahard, S.L. | 8 Jun 2015 | 22 Aug 2024 | 8 Jun 2024 |
| 637 | fmtbook.org | HiChina Zhicheng Technology Limited | 8 Jun 2015 | 21 Jun 2017 | 8 Jun 2018 |
| 638 | fmtmobility.com | TurnCommerce, Inc. DBA NameBright.com | 17 Sep 2015 | 17 Sep 2015 | 17 Sep 2016 |
| 639 | fmtjttt.com | 101domain, Inc. | 16 Dec 2016 | 26 Mar 2025 | 16 Dec 2017 |
| 640 | fmtgvac.net | GMO Internet Inc. | 17 Sep 2015 | 17 Sep 2015 | 17 Sep 2016 |
| 641 | fmtblades.com | TurnCommerce, Inc. DBA NameBright.com | 17 Sep 2015 | 17 Sep 2015 | 17 Sep 2016 |
| 642 | fmt-forum.info | Regional Network Information Center, JSC dba RU-CE… | 3 Jun 2015 | 9 Jun 2015 | 3 Jun 2016 |
| 643 | fmtskz.com | OnlineNIC, Inc. | 12 Jun 2015 | 15 Jun 2017 | 12 Jun 2017 |
| 644 | fmtransceiver.com | Namesilo, LLC | 28 Oct 2017 | 29 Oct 2017 | 28 Oct 2018 |
| 645 | fmtoo.com | Beijing Lanhai Jiye Technology Co., Ltd | 26 Sep 2022 | 27 Sep 2024 | 26 Sep 2025 |
| 646 | fmtjl.us | - | 14 Jun 2015 | - | 13 Jun 2016 |
| 647 | fmterraplanagem.com | Tucows Domains Inc. | 13 Jun 2014 | 17 Jun 2015 | 13 Jun 2016 |
| 648 | fmtbook.net | HiChina Zhicheng Technology Limited | 15 Jun 2015 | 21 Jun 2017 | 15 Jun 2018 |
| 649 | fmtoqb.com | HiChina Zhicheng Technology Limited | 4 Sep 2020 | 4 Sep 2020 | 4 Sep 2021 |
| 650 | fmtma.com | West263 International Limited | 17 Jun 2015 | 17 Jun 2015 | 17 Jun 2016 |
| 651 | fmtigers.org | GoDaddy.com, LLC | 16 Jun 2015 | 9 Jul 2024 | 16 Jun 2025 |
| 652 | fmtvoltagestabilizer.com | OnlineNIC, Inc. | 19 Jun 2015 | 20 Jun 2017 | 19 Jun 2018 |
| 653 | fmttransformer.com | FindYouAName.com LLC | 17 Nov 2022 | 31 Jan 2024 | 17 Nov 2023 |
| 654 | fmtsolarenergy.com | OnlineNIC, Inc. | 19 Jun 2015 | 20 Jun 2017 | 19 Jun 2018 |
| 655 | fmtonlineups.com | OnlineNIC, Inc. | 19 Jun 2015 | 20 Jun 2017 | 19 Jun 2018 |
| 656 | fmtlf.com | 1&1 Internet AG | 8 Jan 2025 | 8 Jan 2025 | 8 Jan 2026 |
| 657 | fmtledlighting.com | OnlineNIC, Inc. | 19 Jun 2015 | 20 Jun 2017 | 19 Jun 2018 |
| 658 | fmtensai.com | GoDaddy.com, LLC | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2017 |
| 659 | fmtjj.com | Dynadot8 LLC | 1 Apr 2022 | 2 Apr 2023 | 1 Apr 2024 |
| 660 | fmtegypt.com | Tucows Domains Inc. | 17 Sep 2002 | 9 Jul 2024 | 17 Sep 2025 |
| 661 | fmtz888.com | GoDaddy.com, LLC | 17 Nov 2021 | 19 Nov 2021 | 17 Nov 2022 |
| 662 | fmteknikklima.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Sep 2015 | 21 Sep 2015 | 21 Sep 2016 |
| 663 | fmtalentshow.com | Network Solutions, LLC | 7 Oct 2023 | 19 Nov 2024 | 7 Oct 2024 |
| 664 | fmtdownunder.com | eNom, Inc. | 26 Jun 2015 | 26 Jun 2015 | 26 Jun 2016 |
| 665 | fmtz.wang | eName Technology Co., Ltd. | 22 Sep 2015 | 26 Nov 2016 | 22 Sep 2017 |
| 666 | fmtmuhendislik.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 29 Jun 2018 | 29 Jun 2018 | 29 Jun 2019 |
| 667 | fmtjt.com | HiChina Zhicheng Technology Limited | 24 Sep 2015 | 22 Jun 2017 | 24 Sep 2017 |
| 668 | fmtaudio.com | FastDomain Inc. | 30 Nov 2023 | 13 Jan 2025 | 30 Nov 2024 |
| 669 | fmt-manufacturing.com | Tucows Domains Inc. | 11 Nov 2020 | 4 Nov 2024 | 11 Nov 2025 |
| 670 | fmtz.top | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Sep 2015 | 12 Nov 2016 | 24 Sep 2017 |
| 671 | fmtroop108.com | Tucows Domains Inc. | 23 Sep 2003 | 24 Aug 2020 | 23 Sep 2025 |
| 672 | fmtdj.com | - | 22 Feb 2025 | 22 Feb 2025 | 22 Feb 2026 |
| 673 | fmtzkl.com | GoDaddy.com, LLC | 7 Jul 2015 | 7 Jul 2015 | 7 Jul 2016 |
| 674 | fmtstabilizer.com | OnlineNIC, Inc. | 6 Jul 2015 | 8 Jul 2017 | 6 Jul 2018 |
| 675 | fmtservice.com | GoDaddy.com, LLC | 1 Dec 2021 | 2 Dec 2024 | 1 Dec 2025 |
| 676 | fmtrental.com | OnlineNIC, Inc. | 6 Jul 2015 | 8 Jul 2017 | 6 Jul 2018 |
| 677 | fmtpvt.com | Net 4 India Limited | 6 Jul 2015 | 6 Jul 2015 | 6 Jul 2016 |
| 678 | fmtcable.com | OnlineNIC, Inc. | 6 Jul 2015 | 8 Jul 2017 | 6 Jul 2018 |
| 679 | fmtbattery.com | OnlineNIC, Inc. | 6 Jul 2015 | 8 Jul 2017 | 6 Jul 2018 |
| 680 | fmtsupport.com | GoDaddy.com, LLC | 7 Jul 2015 | 20 Sep 2022 | 7 Jul 2026 |
| 681 | fmt-worldwide.com | Beijing Lanhai Jiye Technology Co., Ltd | 25 Sep 2022 | 26 Sep 2024 | 25 Sep 2025 |
| 682 | fmtx.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 24 Apr 2022 | 24 Apr 2022 | 24 Apr 2027 |
| 683 | fmtt.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 21 May 2017 | 26 Sep 2017 |
| 684 | fmts.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 22 Jul 2017 | 26 Sep 2017 |
| 685 | fmtp.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 22 Jul 2017 | 26 Sep 2017 |
| 686 | fmtm.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 22 Jul 2017 | 26 Sep 2017 |
| 687 | fmtl.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 24 Mar 2017 | 26 Sep 2017 |
| 688 | fmtj.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 4 Nov 2015 | 26 Sep 2017 |
| 689 | fmtg.top | Chengdu West Dimension Digital Technology Co., Ltd… | 25 Sep 2015 | 21 Feb 2016 | 25 Sep 2017 |
| 690 | fmtc.top | DNSPod, Inc. | 29 Dec 2021 | 29 Dec 2021 | 29 Dec 2022 |
| 691 | fmtgs.com | Web Commerce Communications Limited dba WebNic.cc | 15 Apr 2023 | 25 Jun 2024 | 15 Apr 2024 |
| 692 | fmt123.com | Xin Net Technology Corporation | 29 Mar 2024 | 2 Apr 2025 | 29 Mar 2026 |
| 693 | fmtes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Jul 2015 | 10 Jul 2015 | 10 Jul 2016 |
| 694 | fmtwm.com | DOMAIN NAME NETWORK PTY LTD | 25 Oct 2024 | 25 Oct 2024 | 25 Oct 2025 |
| 695 | fmtrend.com | NameCheap, Inc. | 17 Dec 2024 | 17 Dec 2024 | 17 Dec 2025 |
| 696 | fmtwc.com | GoDaddy.com, LLC | 12 Jul 2015 | 12 Jul 2015 | 12 Jul 2017 |
| 697 | fmty.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 30 Dec 2015 | 26 Sep 2017 |
| 698 | fmtw.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 24 Jul 2017 | 26 Sep 2017 |
| 699 | fmtr.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 13 May 2017 | 26 Sep 2017 |
| 700 | fmtq.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 5 Jun 2017 | 26 Sep 2017 |
| 701 | fmtn.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 5 Jun 2017 | 26 Sep 2017 |
| 702 | fmtk.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 30 Dec 2015 | 26 Sep 2017 |
| 703 | fmth.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 30 Dec 2015 | 26 Sep 2017 |
| 704 | fmtf.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 30 Dec 2015 | 26 Sep 2017 |
| 705 | fmtd.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 30 Dec 2015 | 26 Sep 2017 |
| 706 | fmtb.top | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | 30 Dec 2015 | 26 Sep 2017 |
| 707 | fmttt.com | Xin Net Technology Corporation | 6 Mar 2018 | 6 Mar 2018 | 6 Mar 2019 |
| 708 | fmt8888.com | GoDaddy.com, LLC | 30 May 2020 | 10 Jul 2024 | 30 May 2024 |
| 709 | fmthealthcare.com | Crazy Domains FZ-LLC | 16 Nov 2022 | 3 Nov 2023 | 16 Nov 2026 |
| 710 | fmtie.com | Chengdu West Dimension Digital Technology Co., Ltd… | 21 Oct 2019 | 21 Oct 2019 | 21 Oct 2020 |
| 711 | fmtubes.com | DropCatch.com 1414 LLC | 16 Dec 2018 | 16 Dec 2018 | 16 Dec 2019 |
| 712 | fmtprintf.com | Gandi SAS | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 713 | fmtcw.com | Eranet International Limited | 3 Dec 2017 | 19 Jan 2024 | 3 Dec 2023 |
| 714 | fmtvs.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 16 Mar 2025 | 16 Mar 2025 | 16 Mar 2026 |
| 715 | fmteros.com | GoDaddy.com, LLC | 17 Jul 2015 | 17 Jul 2015 | 17 Jul 2016 |
| 716 | fmtc.us | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 10 Feb 2025 | 15 Feb 2025 | 10 Feb 2026 |
| 717 | fmtxlj.com | Web Commerce Communications Limited dba WebNic.cc | 19 Nov 2022 | 29 Jan 2024 | 19 Nov 2023 |
| 718 | fmtreehouse.com | GoDaddy.com, LLC | 21 Jul 2015 | 1 Oct 2024 | 21 Jul 2024 |
| 719 | fmtyn.com | HiChina Zhicheng Technology Limited | 28 Sep 2015 | 28 Jul 2017 | 28 Sep 2017 |
| 720 | fmtkj.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Oct 2022 | 29 Oct 2024 | 9 Oct 2025 |
| 721 | fmtzw.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Dec 2021 | 27 Aug 2024 | 20 Dec 2025 |
| 722 | fmt-ad.com | HiChina Zhicheng Technology Limited | 22 Jul 2015 | 22 Jul 2015 | 22 Jul 2020 |
| 723 | fmtyw.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Dec 2021 | 27 Aug 2024 | 20 Dec 2025 |
| 724 | fmttinc.com | Tucows Domains Inc. | 22 Jul 2015 | 22 Jul 2015 | 22 Jul 2016 |
| 725 | fmteamsite.com | 1&1 Internet AG | 22 Jul 2015 | 21 Jul 2017 | 22 Jul 2018 |
| 726 | fmt-ad.net | HiChina Zhicheng Technology Limited | 22 Jul 2015 | 22 Jul 2015 | 22 Jul 2020 |
| 727 | fmtbikes.com | Internet Domain Services BS Corp | 9 Oct 2017 | 11 Oct 2017 | 9 Oct 2018 |
| 728 | fmt001.com | - | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2017 |
| 729 | fmt-world.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 31 Jan 2022 | 24 Jan 2025 | 31 Jan 2026 |
| 730 | fmtzx.com | Beijing Lanhai Jiye Technology Co., Ltd | 7 Dec 2022 | 6 Mar 2025 | 7 Dec 2025 |
| 731 | fmtclub.com | HiChina Zhicheng Technology Limited | 29 Sep 2015 | 29 Sep 2015 | 29 Sep 2016 |
| 732 | fmt88.com | GMO Internet Inc. | 14 Dec 2021 | 14 Dec 2021 | 14 Dec 2022 |
| 733 | fmteabagpb.com | GMO Internet Inc. | 25 Jul 2015 | 25 Jul 2015 | 25 Jul 2016 |
| 734 | fmtv365.com | HiChina Zhicheng Technology Limited | 11 Jan 2016 | 23 Dec 2018 | 11 Jan 2027 |
| 735 | fmtplnp.us | - | 26 Jul 2015 | - | 25 Jul 2016 |
| 736 | fmtq.net | DNSPod, Inc. | 28 Dec 2022 | 27 Jan 2024 | 28 Dec 2023 |
| 737 | fmtn.net | Beijing Lanhai Jiye Technology Co., Ltd | 28 Feb 2023 | 13 Apr 2025 | 28 Feb 2026 |
| 738 | fmtd.net | Whois Networks Co., Ltd. | 19 Jun 2020 | 20 Jun 2023 | 19 Jun 2024 |
| 739 | fmttc.com | Sksa Technology Co., Ltd | 9 Feb 2025 | 9 Feb 2025 | 9 Feb 2026 |
| 740 | fmtbank.org | - | 1 Oct 2015 | 23 Dec 2023 | 1 Oct 2032 |
| 741 | fmtadvisroy.com | GoDaddy.com, LLC | 30 Sep 2015 | 30 Sep 2015 | 30 Sep 2016 |
| 742 | fmtzs.com | - | 7 May 2025 | 7 May 2025 | 7 May 2026 |
| 743 | fmtr.org | DROPCATCH.COM 753 LLC | 18 Dec 2016 | 18 Dec 2016 | 18 Dec 2017 |
| 744 | fmtfranchise.com | GoDaddy.com, LLC | 30 Jul 2015 | 3 Aug 2023 | 30 Jul 2030 |
| 745 | fmtdzkj.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Oct 2016 | 25 Nov 2017 | 13 Oct 2017 |
| 746 | fmtcshop.com | CSC Corporate Domains, Inc. | 31 Jul 2015 | 27 Jul 2024 | 31 Jul 2025 |
| 747 | fmtest.org | GoDaddy.com, LLC | 30 Jul 2015 | 31 Jul 2017 | 30 Jul 2018 |
| 748 | fmtaxiservice.com | - | - | - | - |
| 749 | fmtrich.com | Cosmotown, Inc. | 5 Sep 2024 | 6 Nov 2024 | 5 Sep 2025 |
| 750 | fmtsales.com | FastDomain Inc. | 4 Aug 2015 | 4 Aug 2016 | 4 Aug 2017 |
| 751 | fmtxt.com | NameCheap, Inc. | 19 Oct 2021 | 11 Jun 2024 | 19 Oct 2025 |
| 752 | fmtestates.com | Mesh Digital Limited | 5 Aug 2015 | 12 Sep 2024 | 5 Aug 2025 |
| 753 | fmtuscorp.com | GoDaddy.com, LLC | 6 Aug 2015 | 6 Aug 2015 | 6 Aug 2016 |
| 754 | fmtjjun.com | GoDaddy.com, LLC | 6 Aug 2015 | 6 Aug 2015 | 6 Aug 2016 |
| 755 | fmtest.net | GoDaddy.com, LLC | 20 Nov 2024 | 22 Nov 2024 | 20 Nov 2027 |
| 756 | fmtlab.com | GoDaddy.com, LLC | 8 Oct 2019 | 8 Oct 2024 | 8 Oct 2025 |
| 757 | fmtransports.net | Network Solutions, LLC | 7 Aug 2015 | 7 Aug 2015 | 7 Aug 2017 |
| 758 | fmttw.com | Realtime Register B.V. | 13 Sep 2022 | 24 Nov 2023 | 13 Sep 2023 |
| 759 | fmtropicana947.com | Internet Domain Services BS Corp | 11 Aug 2015 | 17 Jul 2024 | 11 Aug 2025 |
| 760 | fmtmband.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Aug 2015 | 10 Aug 2015 | 10 Aug 2016 |
| 761 | fmtcs.com | GoDaddy.com, LLC | 19 Sep 2001 | 17 Sep 2024 | 19 Sep 2029 |
| 762 | fmten.com | Tucows Domains Inc. | 8 May 2022 | 18 Jun 2023 | 8 May 2023 |
| 763 | fmtemplate.net | Megazone Corp., dba HOSTING.KR | 2 Mar 2020 | 13 Apr 2025 | 2 Mar 2025 |
| 764 | fmtsglobal.com | DreamHost, LLC | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2016 |
| 765 | fmtranslatorforsale.com | GoDaddy.com, LLC | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2017 |
| 766 | fmte.net | GoDaddy.com, LLC | 3 Feb 2025 | 3 Feb 2025 | 3 Feb 2028 |
| 767 | fmtrustonline.bank | EnCirca, Inc. | 18 Sep 2015 | 26 Aug 2024 | 18 Sep 2025 |
| 768 | fmtwellnessgroup.com | GoDaddy.com, LLC | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2020 |
| 769 | fmttz.com | Xin Net Technology Corporation | 21 Nov 2023 | 22 Nov 2024 | 21 Nov 2025 |
| 770 | fmttrading.com | Google, Inc. | 16 Sep 2022 | 17 Oct 2024 | 16 Sep 2024 |
| 771 | fmthatsloud.com | 1&1 Internet AG | 9 Oct 2015 | 10 Oct 2016 | 9 Oct 2017 |
| 772 | fmtznz.com | Guangdong JinWanBang Technology Investment Co., Lt… | 12 Oct 2015 | 12 Oct 2015 | 12 Oct 2016 |
| 773 | fmtruth.com | GoDaddy.com, LLC | 29 Jul 2024 | 29 Jul 2024 | 29 Jul 2025 |
| 774 | fmthla.us | - | 12 Oct 2015 | - | 11 Oct 2016 |
| 775 | fmtcv.com | GoDaddy.com, LLC | 12 Oct 2015 | 12 Oct 2015 | 12 Oct 2016 |
| 776 | fmtradicion.net | NameKing.com Inc. | 13 Oct 2015 | 22 Sep 2016 | 13 Oct 2017 |
| 777 | fmtl.com | Tucows Domains Inc. | 22 Nov 2001 | 11 Mar 2024 | 22 Nov 2031 |
| 778 | fmtk.com | eName Technology Co., Ltd. | 26 Apr 2010 | 27 Mar 2025 | 26 Apr 2026 |
| 779 | fmtj.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 16 Apr 2014 | 8 Apr 2025 | 16 Apr 2026 |
| 780 | fmth.com | GoDaddy.com, LLC | 21 Feb 2006 | 12 Oct 2024 | 21 Feb 2026 |
| 781 | fmtg.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 5 Dec 2000 | 6 Dec 2024 | 5 Dec 2025 |
| 782 | fmtf.com | GoDaddy.com, LLC | 13 Sep 2006 | 4 Oct 2024 | 13 Sep 2025 |
| 783 | fmtd.com | GoDaddy.com, LLC | 20 Sep 2006 | 4 Aug 2024 | 20 Sep 2032 |
| 784 | fmty.com | Fabulous.com Pty Ltd. | 9 Apr 2011 | 24 Mar 2025 | 9 Apr 2026 |
| 785 | fmtx.com | GoDaddy.com, LLC | 30 Apr 2008 | 15 Apr 2025 | 30 Apr 2026 |
| 786 | fmtw.com | Uniregistrar Corp | 2 Oct 2002 | 9 Sep 2024 | 2 Oct 2025 |
| 787 | fmtt.com | NameCheap, Inc. | 15 Aug 1997 | 20 Feb 2025 | 14 Aug 2025 |
| 788 | fmts.com | Tucows Domains Inc. | 9 Jan 2000 | 11 Mar 2024 | 9 Jan 2032 |
| 789 | fmtr.com | Uniregistrar Corp | 9 Jun 2004 | 26 Aug 2024 | 9 Jun 2026 |
| 790 | fmtq.com | eName Technology Co., Ltd. | 21 Apr 2012 | 29 Mar 2017 | 21 Apr 2018 |
| 791 | fmtp.com | GoDaddy.com, LLC | 12 Apr 2004 | 30 Dec 2024 | 12 Apr 2026 |
| 792 | fmtn.com | GoDaddy.com, LLC | 16 Nov 2001 | 28 Aug 2024 | 16 Nov 2026 |
| 793 | fmtm.com | Network Solutions, LLC | 16 Nov 2001 | 14 Sep 2024 | 16 Nov 2025 |
| 794 | fmtz.com | GoDaddy.com, LLC | 22 Apr 2006 | 17 Apr 2025 | 22 Apr 2026 |
| 795 | fmtu.com | GoDaddy.com, LLC | 10 May 2004 | 20 Apr 2025 | 10 May 2026 |
| 796 | fmtdemo.com | Google, Inc. | 14 Jun 2024 | 14 Jun 2024 | 14 Jun 2025 |
| 797 | fmtop1057.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2016 |
| 798 | fmt777.com | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2017 |
| 799 | fmtart.com | IHS Telekom, Inc. | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 800 | fmt107.com | Hefei Juming Network Technology Co., Ltd | 1 Mar 2021 | 2 Apr 2023 | 1 Mar 2023 |
| 801 | fmtqgroup.com | Instra Corporation Pty Ltd. | 22 Oct 2015 | 22 Oct 2015 | 22 Oct 2017 |
| 802 | fmtonlinemagazine.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 803 | fmtmail10.com | eNom, Inc. | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 804 | fmtjw.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Dec 2021 | 27 Aug 2024 | 20 Dec 2025 |
| 805 | fmtjx.top | Chengdu West Dimension Digital Technology Co., Ltd… | 23 Oct 2015 | - | 23 Oct 2016 |
| 806 | fmtblog.com | Hefei Juming Network Technology Co., Ltd | 2 May 2025 | 2 May 2025 | 2 May 2026 |
| 807 | fmteks.com | Google, Inc. | 9 Aug 2023 | 8 Sep 2024 | 9 Aug 2024 |
| 808 | fmtowing.net | GoDaddy.com, LLC | 19 Apr 2021 | 19 Apr 2021 | 19 Apr 2022 |
| 809 | fmtoolbar.com | - | - | - | - |
| 810 | fmtl.net | West263 International Limited | 29 Nov 2024 | 29 Nov 2024 | 29 Nov 2025 |
| 811 | fmtorckhzn.com | GMO Internet Inc. | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2016 |
| 812 | fmto.xyz | Hostinger, UAB | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2016 |
| 813 | fmtb.org | Dynadot, LLC | 13 Feb 2025 | 25 Feb 2025 | 13 Feb 2026 |
| 814 | fmt-diamond.com | Network Solutions, LLC | 26 Oct 2015 | 24 Oct 2016 | 26 Oct 2017 |
| 815 | fmtska.info | West263 International Limited | 27 Oct 2015 | - | 27 Oct 2016 |
| 816 | fmt-inc.com | Japan Registry Services Co., Ltd. | 27 Oct 2015 | 27 Aug 2024 | 27 Oct 2025 |
| 817 | fmtengineers.com | Network Solutions, LLC | 10 Jan 2024 | 25 Mar 2025 | 10 Jan 2025 |
| 818 | fmtechnologiessolutions.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 819 | fmt-77.com | GMO Internet Inc. | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 820 | fmtz.xyz | Name.com, Inc. | 8 Nov 2023 | 9 Nov 2024 | 8 Nov 2025 |
| 821 | fmtm.xyz | NameCheap, Inc. | 11 Oct 2021 | 11 Oct 2021 | 11 Oct 2022 |
| 822 | fmt92bhu6c.com | GMO Internet Inc. | 30 Oct 2015 | 30 Oct 2015 | 30 Oct 2016 |
| 823 | fmts.date | Xiamen Nawang Technology Co., Ltd | 30 Oct 2015 | - | 29 Oct 2016 |
| 824 | fmtranslatorsforsale.com | GoDaddy.com, LLC | 31 Oct 2015 | 30 Oct 2024 | 31 Oct 2025 |
| 825 | fmtranslators.com | GoDaddy.com, LLC | 30 Oct 2015 | 30 Oct 2015 | 30 Oct 2016 |
| 826 | fmtranslatorauction.com | GoDaddy.com, LLC | 30 Oct 2015 | 30 Oct 2015 | 30 Oct 2016 |
| 827 | fmtexteis.com | PSI-USA, Inc. dba Domain Robot | 17 Nov 2023 | 6 Jan 2025 | 17 Nov 2025 |
| 828 | fmtd021.com | Beijing Lanhai Jiye Technology Co., Ltd | 10 Apr 2018 | 11 Apr 2025 | 10 Apr 2026 |
| 829 | fmty.xyz | Hostinger, UAB | 18 Dec 2024 | 23 Dec 2024 | 18 Dec 2025 |
| 830 | fmtx.xyz | NameCheap, Inc. | 21 Mar 2025 | 21 Mar 2025 | 21 Mar 2026 |
| 831 | fmtwheelseurope.com | GoDaddy.com, LLC | 31 Oct 2015 | 31 Oct 2015 | 31 Oct 2016 |
| 832 | fmtw.xyz | GoDaddy.com, LLC | 4 Jan 2022 | 6 Jan 2022 | 4 Jan 2023 |
| 833 | fmtt.xyz | Dynadot, LLC | 30 Jun 2024 | 6 Aug 2024 | 30 Jun 2025 |
| 834 | fmtransporte.com | GoDaddy.com, LLC | 22 Dec 2020 | 12 Dec 2024 | 22 Dec 2025 |
| 835 | fmtmt.com | HiChina Zhicheng Technology Limited | 15 Oct 2019 | 15 Oct 2019 | 15 Oct 2020 |
| 836 | fmtb.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Apr 2022 | 6 Jul 2022 | 13 Apr 2024 |
| 837 | fmts.xyz | West263 International Limited | 1 Nov 2024 | 16 Dec 2024 | 1 Nov 2025 |
| 838 | fmtreatmentnews.com | MAFF Inc. | 23 Apr 2020 | 27 Apr 2020 | 23 Apr 2021 |
| 839 | fmtr.xyz | - | 20 Sep 2024 | 7 Oct 2024 | 20 Sep 2025 |
| 840 | fmtq.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Nov 2015 | 6 Dec 2017 | 1 Nov 2017 |
| 841 | fmtp.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Apr 2022 | 6 Jul 2022 | 13 Apr 2024 |
| 842 | fmtn.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Nov 2015 | 24 Feb 2016 | 1 Nov 2017 |
| 843 | fmtl.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Nov 2015 | 6 Dec 2017 | 1 Nov 2017 |
| 844 | fmtk.xyz | Reg2C.com Inc. | 6 Jan 2023 | 13 Feb 2024 | 6 Jan 2024 |
| 845 | fmtj.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 26 Jan 2022 | 27 Jan 2022 | 26 Jan 2023 |
| 846 | fmth.xyz | GMO Internet Inc. | 2 Feb 2025 | 7 Feb 2025 | 2 Feb 2026 |
| 847 | fmtf.xyz | NameCheap, Inc. | 30 Mar 2021 | 15 Apr 2023 | 30 Mar 2024 |
| 848 | fmtd.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Apr 2022 | 6 Jul 2022 | 13 Apr 2024 |
| 849 | fmtcj.com | Bizcn.com, Inc. | 15 Jan 2017 | 30 Sep 2017 | 15 Jan 2018 |
| 850 | fmtbw.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Dec 2021 | 27 Aug 2024 | 20 Dec 2025 |
| 851 | fmta.racing | Xiamen Nawang Technology Co., Ltd | 1 Nov 2015 | - | 31 Oct 2016 |
| 852 | fmt6.com | Zhengzhou Century Connect Electronic Technology De… | 22 Aug 2019 | 22 Aug 2019 | 22 Aug 2020 |
| 853 | fmtv.xyz | - | 21 Feb 2025 | 6 Mar 2025 | 21 Feb 2026 |
| 854 | fmtczg.com | Dynadot3 LLC | 3 Nov 2024 | 25 Nov 2024 | 3 Nov 2025 |
| 855 | fmtz.win | Chengdu West Dimension Digital Technology Co., Ltd… | 3 Nov 2015 | 2 Dec 2016 | 2 Nov 2017 |
| 856 | fmtjr.com | EIMS (Shenzhen) Culture & Technology Co., Ltd | 15 Mar 2017 | 26 Dec 2017 | 15 Mar 2018 |
| 857 | fmtx.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 12 Oct 2016 | 18 Oct 2017 |
| 858 | fmtw.wang | eName Technology Co., Ltd. | 19 Oct 2015 | 1 Jun 2017 | 19 Oct 2017 |
| 859 | fmtt.wang | eName Technology Co., Ltd. | 18 Oct 2015 | 17 Nov 2016 | 18 Oct 2017 |
| 860 | fmtj.wang | eName Technology Co., Ltd. | 19 Oct 2015 | 4 May 2017 | 19 Oct 2017 |
| 861 | fmth.wang | eName Technology Co., Ltd. | 19 Oct 2015 | 23 Oct 2015 | 19 Oct 2017 |
| 862 | fmtz.org | GoDaddy.com, LLC | 20 Dec 2016 | 1 Jan 2018 | 20 Dec 2018 |
| 863 | fmtxw.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Dec 2021 | 27 Aug 2024 | 20 Dec 2025 |
| 864 | fmtww.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Dec 2021 | 27 Aug 2024 | 20 Dec 2025 |
| 865 | fmtsw.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 8 Jan 2025 | 8 Jan 2025 | 8 Jan 2026 |
| 866 | fmtrw.com | 35 Technology Co., Ltd. | 27 Feb 2023 | 7 May 2024 | 27 Feb 2024 |
| 867 | fmtronix.com | Vitalwerks Internet Solutions, LLC DBA No-IP | 4 Nov 2015 | 5 Oct 2024 | 4 Nov 2025 |
| 868 | fmtronics.com | Vitalwerks Internet Solutions, LLC DBA No-IP | 4 Nov 2015 | 5 Oct 2024 | 4 Nov 2025 |
| 869 | fmtqw.com | HiChina Zhicheng Technology Limited | 4 Nov 2015 | 29 Jul 2017 | 4 Nov 2017 |
| 870 | fmtpw.com | HiChina Zhicheng Technology Limited | 4 Nov 2015 | 29 Jul 2017 | 4 Nov 2017 |
| 871 | fmtnw.com | HiChina Zhicheng Technology Limited | 16 Dec 2019 | 16 Dec 2019 | 16 Dec 2020 |
| 872 | fmtmw.com | Dynadot, LLC | 26 Jul 2022 | 9 Aug 2024 | 26 Jul 2025 |
| 873 | fmtkw.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 15 Jun 2021 | 16 Jun 2024 | 15 Jun 2022 |
| 874 | fmthw.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Dec 2021 | 27 Aug 2024 | 20 Dec 2025 |
| 875 | fmtgf.com | Web Commerce Communications Limited dba WebNic.cc | 9 Jun 2018 | 9 Jun 2018 | 9 Jun 2019 |
| 876 | fmtdw.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Dec 2021 | 27 Aug 2024 | 20 Dec 2025 |
| 877 | fmtcenter.com | GoDaddy.com, LLC | 5 Nov 2015 | 5 Nov 2015 | 5 Nov 2017 |
| 878 | fmtzc.com | HiChina Zhicheng Technology Limited | 6 Nov 2015 | 26 Jul 2017 | 6 Nov 2017 |
| 879 | fmtwl.com | HiChina Zhicheng Technology Limited | 16 Nov 2018 | 25 Feb 2019 | 16 Nov 2019 |
| 880 | fmtsy.com | HiChina Zhicheng Technology Limited | 6 Nov 2015 | 30 Jun 2017 | 6 Nov 2017 |
| 881 | fmtjd.com | HiChina Zhicheng Technology Limited | 6 Nov 2015 | 22 Jun 2017 | 6 Nov 2017 |
| 882 | fmtyl.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Mar 2023 | 25 Mar 2025 | 20 Mar 2026 |
| 883 | fmtxx.com | HiChina Zhicheng Technology Limited | 8 Nov 2015 | 26 Jul 2017 | 8 Nov 2017 |
| 884 | fmtxd.com | HiChina Zhicheng Technology Limited | 7 Nov 2015 | 15 May 2017 | 7 Nov 2017 |
| 885 | fmtpx.com | Hangzhou AiMing Network Co., LTD | 7 Nov 2015 | 7 Nov 2015 | 7 Nov 2016 |
| 886 | fmtmm.com | HiChina Zhicheng Technology Limited | 7 Nov 2015 | 7 Nov 2016 | 7 Nov 2017 |
| 887 | fmtinvestments.com | NameKing.com Inc. | 24 Oct 2024 | 28 Feb 2025 | 24 Oct 2025 |
| 888 | fmtdz.com | HiChina Zhicheng Technology Limited | 8 Nov 2015 | 29 Oct 2016 | 8 Nov 2017 |
| 889 | fmtdk.com | HiChina Zhicheng Technology Limited | 7 Nov 2015 | 30 Jun 2017 | 7 Nov 2017 |
| 890 | fmtch.com | GoDaddy.com, LLC | 9 Aug 2022 | 19 Sep 2023 | 9 Aug 2023 |
| 891 | fmtcf.com | HiChina Zhicheng Technology Limited | 7 Nov 2015 | 30 Jun 2017 | 7 Nov 2017 |
| 892 | fmtbb.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Apr 2021 | 15 Apr 2021 | 15 Apr 2022 |
| 893 | fmtzz.com | OnlineNIC, Inc. | 13 Apr 2018 | 13 Apr 2018 | 13 Apr 2019 |
| 894 | fmtzj.com | HiChina Zhicheng Technology Limited | 8 Nov 2015 | 30 Jun 2017 | 8 Nov 2017 |
| 895 | fmtucson.com | GoDaddy.com, LLC | 8 Nov 2015 | 9 Nov 2023 | 8 Nov 2025 |
| 896 | fmtjy.com | Xin Net Technology Corporation | 16 Jul 2024 | 16 Jul 2024 | 16 Jul 2025 |
| 897 | fmtjm.com | HiChina Zhicheng Technology Limited | 8 Nov 2015 | 26 Jul 2017 | 8 Nov 2017 |
| 898 | fmth.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 899 | fmtgj.com | HiChina Zhicheng Technology Limited | 8 Nov 2015 | 23 Jun 2017 | 8 Nov 2017 |
| 900 | fmtfm.com | HiChina Zhicheng Technology Limited | 26 Jan 2017 | 8 Aug 2017 | 26 Jan 2018 |
| 901 | fmtff.com | DropCatch.com 357 LLC | 10 Apr 2018 | 10 Apr 2018 | 10 Apr 2019 |
| 902 | fmtdc.com | PSI-USA, Inc. dba Domain Robot | 1 Jun 2023 | 1 Aug 2024 | 1 Jun 2024 |
| 903 | fmtyx.com | Beijing Lanhai Jiye Technology Co., Ltd | 30 Mar 2023 | 31 Mar 2025 | 30 Mar 2026 |
| 904 | fmtsm.com | HiChina Zhicheng Technology Limited | 9 Nov 2015 | 12 Jul 2017 | 9 Nov 2017 |
| 905 | fmtsj.com | HiChina Zhicheng Technology Limited | 9 Nov 2015 | 4 Aug 2017 | 9 Nov 2017 |
| 906 | fmtrr.com | GoDaddy.com, LLC | 16 Nov 2020 | 16 Nov 2020 | 16 Nov 2021 |
| 907 | fmtpp.com | Uniregistrar Corp | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 908 | fmtnn.com | Uniregistrar Corp | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 909 | fmtll.com | Chengdu West Dimension Digital Technology Co., Ltd… | 9 Feb 2017 | 9 Feb 2017 | 9 Feb 2018 |
| 910 | fmtjk.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Mar 2023 | 7 Mar 2025 | 20 Mar 2026 |
| 911 | fmthh.com | DropCatch.com 505 LLC | 26 Jan 2017 | 27 Jan 2017 | 26 Jan 2018 |
| 912 | fmthb.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 Jul 2022 | 16 Mar 2025 | 11 Jul 2025 |
| 913 | fmtgg.com | HiChina Zhicheng Technology Limited | 26 Jan 2017 | 3 Sep 2017 | 26 Jan 2018 |
| 914 | fmteb.com | Eranet International Limited | 14 Apr 2021 | 14 Apr 2021 | 14 Apr 2022 |
| 915 | fmtdd.com | West263 International Limited | 20 May 2022 | 24 Jul 2023 | 20 May 2023 |
| 916 | fmtcb.com | HiChina Zhicheng Technology Limited | 23 Jan 2017 | 1 Oct 2017 | 23 Jan 2018 |
| 917 | fmtg.net | register.com, Inc. | 31 Aug 2012 | 31 Jul 2024 | 31 Aug 2025 |
| 918 | fmtf.net | DropCatch.com 578 LLC | 7 Dec 2017 | 7 Dec 2017 | 7 Dec 2018 |
| 919 | fmtc.net | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 12 Feb 1997 | 13 Jan 2025 | 13 Feb 2026 |
| 920 | fmtm.net | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 25 Mar 2024 | 26 Mar 2025 | 25 Mar 2026 |
| 921 | fmtk.net | Gabia, Inc. | 5 Mar 2013 | 4 Oct 2024 | 5 Mar 2028 |
| 922 | fmth.net | Xin Net Technology Corporation | 23 Jan 2021 | 2 Feb 2022 | 23 Jan 2023 |
| 923 | fmts.net | FindYouADomain.com LLC | 10 Sep 2022 | 12 Oct 2024 | 10 Sep 2025 |
| 924 | fmtr.net | - | 9 Jun 2024 | 28 Feb 2025 | 9 Jun 2025 |
| 925 | fmtp.net | Web Commerce Communications Limited dba WebNic.cc | 22 Mar 2004 | 20 Mar 2021 | 22 Mar 2026 |
| 926 | fmtz.net | DOMAIN NAME NETWORK PTY LTD | 9 Sep 2024 | 9 Sep 2024 | 9 Sep 2025 |
| 927 | fmty.net | HiChina Zhicheng Technology Limited | 11 May 2020 | 26 Apr 2025 | 11 May 2026 |
| 928 | fmtx.net | Mesh Digital Limited | 24 Sep 2009 | 17 Sep 2024 | 24 Sep 2025 |
| 929 | fmtzq.com | eName Technology Co., Ltd. | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 930 | fmtrz.com | HiChina Zhicheng Technology Limited | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2016 |
| 931 | fmtranslatorengineer.com | GoDaddy.com, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 932 | fmtrailer.com | GoDaddy.com, LLC | 10 Jan 2023 | 11 Jan 2025 | 10 Jan 2026 |
| 933 | fmtqc.com | eName Technology Co., Ltd. | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 934 | fmtlondon.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 935 | fmtkk.com | HiChina Zhicheng Technology Limited | 10 Nov 2015 | 15 May 2017 | 10 Nov 2017 |
| 936 | fmtjc.com | Chengdu West Dimension Digital Technology Co., Ltd… | 6 Jun 2019 | 6 Jun 2019 | 6 Jun 2020 |
| 937 | fmtcm.com | NameKing.com Inc. | 20 Jun 2020 | 20 Jun 2020 | 20 Jun 2021 |
| 938 | fmtz.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Nov 2015 | - | 10 Nov 2016 |
| 939 | fmtw.win | West263 International Limited | 23 Jan 2017 | 3 Nov 2017 | 22 Jan 2019 |
| 940 | fmtsprl.biz | OVH sas | 12 Nov 2015 | 12 Nov 2015 | 11 Nov 2016 |
| 941 | fmtttt.com | eName Technology Co., Ltd. | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2016 |
| 942 | fmtjf.com | HiChina Zhicheng Technology Limited | 12 Nov 2015 | 20 Dec 2016 | 12 Nov 2017 |
| 943 | fmtdy.com | - | 14 Mar 2023 | 16 May 2024 | 14 Mar 2024 |
| 944 | fmtt.org | DreamHost, LLC | 16 Sep 2024 | 21 Sep 2024 | 16 Sep 2025 |
| 945 | fmtsprl.org | OVH sas | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 946 | fmtsprl.net | OVH sas | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 947 | fmtsprl.info | OVH sas | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 948 | fmty.win | West263 International Limited | 1 Mar 2017 | 19 Aug 2017 | 28 Feb 2018 |
| 949 | fmtx.win | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 10 Feb 2017 | 2 Aug 2017 | 9 Feb 2019 |
| 950 | fmtt.win | Chengdu West Dimension Digital Technology Co., Ltd… | 11 Nov 2015 | 14 Dec 2016 | 10 Nov 2017 |
| 951 | fmtt.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 11 Nov 2015 | - | 11 Nov 2016 |
| 952 | fmtsprl.com | OVH sas | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 953 | fmts.win | West263 International Limited | 6 Mar 2017 | 29 Oct 2017 | 5 Mar 2018 |
| 954 | fmtr.win | West263 International Limited | 6 Mar 2017 | 29 Oct 2017 | 5 Mar 2018 |
| 955 | fmtq.win | West263 International Limited | 6 Mar 2017 | 21 Jun 2017 | 5 Mar 2018 |
| 956 | fmtp.win | West263 International Limited | 6 Mar 2017 | 21 Jun 2017 | 5 Mar 2018 |
| 957 | fmtn.win | West263 International Limited | 6 Mar 2017 | 29 Oct 2017 | 5 Mar 2018 |
| 958 | fmtm.win | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 16 Feb 2017 | 9 Jun 2017 | 15 Feb 2018 |
| 959 | fmtk.win | West263 International Limited | 6 Mar 2017 | 6 Jan 2018 | 5 Mar 2018 |
| 960 | fmtjz.com | GoDaddy.com, LLC | 9 Nov 2020 | 9 Nov 2020 | 9 Nov 2021 |
| 961 | fmtj.win | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 26 Jun 2018 | - | 26 Jun 2019 |
| 962 | fmtiktok.com | GoDaddy.com, LLC | 22 Apr 2024 | 22 Apr 2025 | 22 Apr 2026 |
| 963 | fmth.win | West263 International Limited | 6 Mar 2017 | 29 Oct 2017 | 5 Mar 2018 |
| 964 | fmtg.win | Chengdu West Dimension Digital Technology Co., Ltd… | 11 Nov 2015 | - | 10 Nov 2016 |
| 965 | fmtfc.com | HiChina Zhicheng Technology Limited | 12 Nov 2015 | 22 Jun 2017 | 12 Nov 2017 |
| 966 | fmtf.win | West263 International Limited | 6 Mar 2017 | 29 Oct 2017 | 5 Mar 2018 |
| 967 | fmtd.win | West263 International Limited | 6 Mar 2017 | 25 Apr 2017 | 5 Mar 2018 |
| 968 | fmtb.win | West263 International Limited | 6 Mar 2017 | 9 Apr 2017 | 5 Mar 2018 |
| 969 | fmt2.com | Click Registrar, Inc. d/b/a publicdomainregistry.c… | 21 Dec 2021 | 21 Dec 2021 | 21 Dec 2022 |
| 970 | fmtzy.com | HiChina Zhicheng Technology Limited | 13 Nov 2015 | 5 Aug 2017 | 13 Nov 2017 |
| 971 | fmtwg.com | HiChina Zhicheng Technology Limited | 13 Nov 2015 | 23 Jun 2017 | 13 Nov 2017 |
| 972 | fmtmf.com | HiChina Zhicheng Technology Limited | 13 Nov 2015 | 5 Aug 2017 | 13 Nov 2017 |
| 973 | fmtw.org | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Nov 2015 | 27 Nov 2016 | 14 Nov 2017 |
| 974 | fmtq.org | eName Technology Co., Ltd. | 14 Nov 2015 | 4 Jan 2017 | 14 Nov 2017 |
| 975 | fmtg.org | GoDaddy.com, LLC | 19 Oct 2017 | 19 Oct 2017 | 19 Oct 2018 |
| 976 | fmtd.org | Dynadot, LLC | 23 Mar 2025 | 23 Mar 2025 | 23 Mar 2026 |
| 977 | fmtl.win | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Nov 2015 | 11 Mar 2017 | 13 Nov 2017 |
| 978 | fmtjb.com | HiChina Zhicheng Technology Limited | 14 Nov 2015 | 28 May 2017 | 14 Nov 2017 |
| 979 | fmtdn.com | Hangzhou AiMing Network Co., LTD | 15 Nov 2015 | 15 Nov 2015 | 15 Nov 2016 |
| 980 | fmtzf.com | HiChina Zhicheng Technology Limited | 16 Nov 2015 | 28 May 2017 | 16 Nov 2017 |
| 981 | fmtyd.com | GMO Internet Inc. | 25 Sep 2019 | 25 Sep 2019 | 25 Sep 2020 |
| 982 | fmtty.com | HiChina Zhicheng Technology Limited | 17 Nov 2015 | 17 Apr 2017 | 17 Nov 2017 |
| 983 | fmtts.com | NameCheap, Inc. | 26 Oct 2023 | 26 Sep 2024 | 26 Oct 2025 |
| 984 | fmttk.com | HiChina Zhicheng Technology Limited | 3 Dec 2018 | 3 Dec 2018 | 3 Dec 2019 |
| 985 | fmttj.com | HiChina Zhicheng Technology Limited | 17 Nov 2015 | 17 Apr 2017 | 17 Nov 2017 |
| 986 | fmtth.com | Hefei Juming Network Technology Co., Ltd | 9 Jun 2022 | 10 Jun 2023 | 9 Jun 2024 |
| 987 | fmttg.com | HiChina Zhicheng Technology Limited | 17 Nov 2015 | 17 Apr 2017 | 17 Nov 2017 |
| 988 | fmttf.com | HiChina Zhicheng Technology Limited | 17 Nov 2015 | 17 Apr 2017 | 17 Nov 2017 |
| 989 | fmttd.com | HiChina Zhicheng Technology Limited | 17 Nov 2015 | 17 Apr 2017 | 17 Nov 2017 |
| 990 | fmttb.com | Beijing Lanhai Jiye Technology Co., Ltd | 8 May 2021 | 11 May 2021 | 8 May 2022 |
| 991 | fmtqb.com | Hangzhou AiMing Network Co., LTD | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 992 | fmtoronto.com | NameCheap, Inc. | 20 Mar 2023 | 21 Mar 2025 | 20 Mar 2026 |
| 993 | fmtjh.com | HiChina Zhicheng Technology Limited | 16 Nov 2015 | 26 Jul 2017 | 16 Nov 2017 |
| 994 | fmtw.biz | GMO Internet Inc. | 17 Nov 2015 | - | 16 Nov 2016 |
| 995 | fmtu.org | HiChina Zhicheng Technology Limited | 7 Jan 2017 | 10 Jan 2018 | 7 Jan 2019 |
| 996 | fmtmvvmwaz.biz | GMO Internet Inc. | 18 Nov 2015 | - | 17 Nov 2016 |
| 997 | fmtqp.win | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Nov 2015 | - | 17 Nov 2016 |
| 998 | fmtmh.com | HiChina Zhicheng Technology Limited | 17 Nov 2015 | 6 Apr 2017 | 17 Nov 2017 |
| 999 | fmtft.com | HiChina Zhicheng Technology Limited | 3 Feb 2017 | 16 Sep 2017 | 3 Feb 2018 |
| 1000 | fmtds.com | Cloud Yuqu LLC | 12 Mar 2025 | 12 Mar 2025 | 12 Mar 2026 |
Displaying 1,000 out of 6,884 domains starting with the keyword "FMT". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=fmt
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |