With support for 
Keyword: FIREFIGHT
Reverse Whois » KEYWORD [firefight ] { 6,512 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | firefight.kz | Hostserver GmbH | 22 Sep 2013 | 21 Oct 2013 | - |
| 2 | firefight.club | Porkbun, LLC | 4 Jan 2024 | 16 Feb 2025 | 4 Jan 2025 |
| 3 | firefight.band | GoDaddy.com, LLC | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 4 | firefight.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 30 Mar 2026 | 1 May 2026 | 30 Mar 2027 |
| 5 | firefight.com | DNC Holdings, Inc. | 5 Dec 1996 | 24 Nov 2025 | 4 Dec 2026 |
| 6 | firefight.guru | GoDaddy.com, LLC | 11 Feb 2014 | 27 Mar 2016 | 11 Feb 2017 |
| 7 | firefight.london | Mesh Digital Limited | 27 Aug 2014 | 20 Nov 2025 | 27 Aug 2026 |
| 8 | firefight.biz | DNC Holdings, Inc. | 14 Nov 2001 | 25 Oct 2025 | 13 Nov 2026 |
| 9 | firefight.us | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 28 Apr 2026 | - | 28 Apr 2027 |
| 10 | firefight.show | 1API GmbH | 8 Oct 2016 | 21 Nov 2017 | 8 Oct 2017 |
| 11 | firefight.info | DNC Holdings, Inc. | 14 Nov 2001 | 25 Oct 2025 | 14 Nov 2026 |
| 12 | firefight.net | Namesilo, LLC | 29 Apr 2023 | 30 Apr 2026 | 29 Apr 2027 |
| 13 | firefight.org | Azdomainz LLC | 10 Apr 2003 | 31 Mar 2026 | 10 Apr 2027 |
| 14 | firefight.org.uk | - | 5 Jun 2007 | 8 Jun 2023 | 5 Jun 2033 |
| 15 | firefight.co.uk | - | 9 Sep 1999 | 6 Sep 2017 | 9 Sep 2019 |
| 16 | firefight.online | GMO Internet Inc. | 22 Apr 2025 | 23 Apr 2026 | 22 Apr 2027 |
| 17 | firefight.ca | - | 30 Aug 2008 | 28 Sep 2017 | 30 Aug 2018 |
| 18 | firefight.co | Dynadot, LLC | 20 Jul 2017 | 22 Jul 2025 | 19 Jul 2026 |
| 19 | firefight.services | NameCheap, Inc. | 25 Jan 2020 | 25 Jan 2020 | 25 Jan 2021 |
| 20 | firefight.world | GoDaddy.com, LLC | 29 Apr 2022 | 10 Jun 2023 | 29 Apr 2023 |
| 21 | firefight.app | Porkbun, LLC | 8 Sep 2022 | 7 Sep 2025 | 8 Sep 2026 |
| 22 | firefight.pro | URL Solutions, Inc. | 17 Aug 2023 | 25 Sep 2024 | 17 Aug 2024 |
| 23 | firefight.store | Tucows Domains Inc. | 11 May 2026 | 11 May 2026 | 11 May 2027 |
| 24 | firefight.press | Regional Network Information Center, JSC dba RU-CE… | 14 Nov 2018 | 7 Dec 2021 | 14 Nov 2023 |
| 25 | firefight.aero | Key-Systems GmbH | 3 Nov 2022 | 29 Nov 2025 | 3 Nov 2026 |
| 26 | firefight.cloud | Megazone Corp., dba HOSTING.KR | 25 Mar 2023 | 6 May 2024 | 25 Mar 2024 |
| 27 | firefight.dev | GoDaddy.com, LLC | 2 Sep 2020 | 17 Oct 2025 | 2 Sep 2026 |
| 28 | firefight.ie | - | 18 Sep 2008 | 19 Oct 2025 | 19 Sep 2026 |
| 29 | firefight.io | GoDaddy.com, LLC | 22 Sep 2025 | 2 Dec 2025 | 22 Sep 2026 |
| 30 | firefight.live | NameCheap, Inc. | 11 Aug 2021 | 26 Aug 2023 | 11 Aug 2024 |
| 31 | firefight.bot | NameCheap, Inc. | 1 Nov 2023 | 28 Oct 2024 | 1 Nov 2025 |
| 32 | firefight.ing | GoDaddy.com, LLC | 3 Dec 2023 | 29 Nov 2025 | 3 Dec 2026 |
| 33 | firefight.ru | - | 31 Oct 2017 | - | 31 Oct 2026 |
| 34 | firefight.de | - | - | 15 Sep 2022 | - |
| 35 | firefight.com.au | - | - | 11 Mar 2026 | - |
| 36 | firefight.dk | - | 26 Jun 2024 | - | 25 Jun 2026 |
| 37 | firefight.now | Dynadot, LLC | 8 Jan 2025 | 8 Jan 2025 | 8 Jan 2026 |
| 38 | firefight.tech | NameCheap, Inc. | 10 Apr 2025 | 26 May 2026 | 10 Apr 2027 |
| 39 | firefight.cn | - | 27 Mar 2026 | - | 27 Mar 2027 |
| 40 | firefight.fun | Tucows Domains Inc. | 11 May 2026 | 11 May 2026 | 11 May 2027 |
| 41 | firefight.games | Tucows Domains Inc. | 11 May 2026 | 11 May 2026 | - |
| 42 | firefight.space | Tucows Domains Inc. | 11 May 2026 | 11 May 2026 | 11 May 2027 |
| 43 | firefighter.com | GoDaddy.com, LLC | 20 Sep 1995 | 2 Jan 2026 | 19 Sep 2026 |
| 44 | firefighters.org | Network Solutions, LLC | 30 May 1996 | 3 Jun 2024 | 29 May 2034 |
| 45 | firefighternation.com | Nom-iq Ltd. dba COM LAUDE | 21 Feb 2007 | 24 Jan 2026 | 21 Feb 2027 |
| 46 | firefightersfirstcu.org | Network Solutions, LLC | 8 May 2012 | 14 May 2024 | 8 May 2034 |
| 47 | firefighterbuckle.com | GoDaddy.com, LLC | 21 Oct 2014 | 22 Oct 2024 | 21 Oct 2027 |
| 48 | firefighterpov.net | Tucows Domains Inc. | 16 Oct 2012 | 20 Oct 2014 | 16 Oct 2015 |
| 49 | firefightsales.com | GoDaddy.com, LLC | 22 Oct 2014 | 13 Jun 2016 | 18 Jul 2018 |
| 50 | firefighter.pro | Epik Inc. | 31 Mar 2022 | 15 May 2025 | 31 Mar 2026 |
| 51 | firefightingnews.com | GoDaddy.com, LLC | 20 Feb 2005 | 21 Feb 2026 | 20 Feb 2027 |
| 52 | firefighters-exam.com | GoDaddy.com, LLC | 11 Apr 2004 | 18 Sep 2025 | 18 Sep 2026 |
| 53 | firefighterhealthstudy.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2016 |
| 54 | firefightingincanada.com | Tucows Domains Inc. | 3 Dec 1999 | 4 Nov 2025 | 3 Dec 2026 |
| 55 | firefighterpetpeeves.com | GoDaddy.com, LLC | 29 May 2011 | 30 May 2015 | 29 May 2016 |
| 56 | firefighterschooseadvocare.com | GoDaddy.com, LLC | 29 May 2013 | 30 May 2015 | 29 May 2016 |
| 57 | firefighterhealthstudy.org | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 58 | firefighterrec.com | GoDaddy.com, LLC | 1 Jun 2014 | 2 Jun 2015 | 1 Jun 2016 |
| 59 | firefightersgaming.com | GoDaddy.com, LLC | 2 Jun 2014 | 3 Jun 2015 | 2 Jun 2016 |
| 60 | firefighterllc.com | - | 6 Jan 2026 | 6 Jan 2026 | 6 Jan 2027 |
| 61 | firefighterchimneysweeps.com | GoDaddy.com, LLC | 19 Feb 2019 | 21 Aug 2024 | 19 Feb 2025 |
| 62 | firefighterchimneysweepllc.com | GoDaddy.com, LLC | 3 Jun 2014 | 4 Jun 2015 | 3 Jun 2016 |
| 63 | firefightnews.com | Wild West Domains, LLC | 14 Jul 2019 | 25 Aug 2024 | 14 Jul 2024 |
| 64 | firefightersoftheworld.org | Tucows Domains Inc. | 21 Oct 2011 | 25 Oct 2014 | 21 Oct 2015 |
| 65 | firefighter523.us | GoDaddy.com, LLC | 6 Jun 2014 | 6 Jun 2014 | 5 Jun 2015 |
| 66 | firefighterfundraiser.com | GoDaddy.com, LLC | 17 Dec 2021 | 18 Dec 2025 | 17 Dec 2026 |
| 67 | firefighterphoto.com | GoDaddy.com, LLC | 5 Jan 2015 | 17 Apr 2015 | 5 Jan 2016 |
| 68 | firefighterkitchenrescue.com | Tucows Domains Inc. | 27 Oct 2014 | 31 Oct 2015 | 27 Oct 2016 |
| 69 | firefighters.us | GoDaddy.com, LLC | 24 Apr 2002 | 1 Jun 2017 | 23 Apr 2018 |
| 70 | firefighterscredit.com | GoDaddy.com, LLC | 26 Apr 2012 | 4 May 2026 | 26 Apr 2027 |
| 71 | firefightersfoundation.com | eNom, Inc. | 3 Dec 1999 | 31 May 2026 | 9 Sep 2026 |
| 72 | firefightersunion.com | GoDaddy.com, LLC | 25 Jan 2010 | 29 Jan 2026 | 25 Jan 2027 |
| 73 | firefightingservices.com | eNom, Inc. | 18 Dec 2007 | 12 May 2026 | 18 Dec 2026 |
| 74 | firefighterhealth.org | GoDaddy.com, LLC | 6 Dec 2020 | 20 Jan 2025 | 6 Dec 2026 |
| 75 | firefightershields.info | GoDaddy.com, LLC | 21 Mar 2017 | 20 May 2017 | 21 Mar 2018 |
| 76 | firefighters.pw | Alpnames Limited | 22 Jun 2015 | 22 Aug 2015 | 22 Jun 2017 |
| 77 | firefightersmuseum.com | GoDaddy.com, LLC | 2 Nov 2005 | 31 Jan 2025 | 2 Nov 2026 |
| 78 | firefightercopter.com | GoDaddy.com, LLC | 21 Aug 2014 | 22 Apr 2015 | 21 Aug 2015 |
| 79 | firefightercopters.com | GoDaddy.com, LLC | 21 Aug 2014 | 22 Apr 2015 | 21 Aug 2015 |
| 80 | firefightingcopter.com | GoDaddy.com, LLC | 21 Aug 2014 | 22 Apr 2015 | 21 Aug 2015 |
| 81 | firefightingcopters.com | GoDaddy.com, LLC | 21 Aug 2014 | 22 Apr 2015 | 21 Aug 2015 |
| 82 | firefightersforlife.com | NameCheap, Inc. | 24 May 2019 | 24 May 2019 | 24 May 2020 |
| 83 | firefightermayday.com | One.com A/S | 28 Oct 2014 | 9 Dec 2025 | 28 Oct 2026 |
| 84 | firefighterturnoutbags.com | GoDaddy.com, LLC | 31 Jul 2013 | 1 Aug 2025 | 31 Jul 2026 |
| 85 | firefightinggrants.com | Google, Inc. | 28 Jan 2018 | 13 Jan 2026 | 28 Jan 2027 |
| 86 | firefightershields.org | GoDaddy.com, LLC | 21 Mar 2017 | 21 May 2017 | 21 Mar 2018 |
| 87 | firefightert-shirts.com | GoDaddy.com, LLC | 1 Mar 2015 | 21 May 2015 | 1 Mar 2016 |
| 88 | firefighterstv.com | GoDaddy.com, LLC | 16 Dec 2006 | 17 Dec 2025 | 16 Dec 2027 |
| 89 | firefightertimes.com | GoDaddy.com, LLC | 14 Sep 2001 | 15 Sep 2025 | 14 Sep 2027 |
| 90 | firefighters.es | - | - | - | - |
| 91 | firefightingfoam-malaysia.com | 1&1 Internet AG | 29 Oct 2014 | 30 Oct 2025 | 29 Oct 2026 |
| 92 | firefightermagazine.com | NameCheap, Inc. | 14 Oct 2024 | 14 Oct 2025 | 14 Oct 2026 |
| 93 | firefighterrobots.com | GoDaddy.com, LLC | 29 Oct 2025 | 29 Oct 2025 | 29 Oct 2026 |
| 94 | firefightingrobots.com | Network Solutions, LLC | 2 Nov 2021 | 3 Sep 2024 | 2 Nov 2027 |
| 95 | firefighter-fit.com | DNSPod, Inc. | 8 Oct 2020 | 8 Oct 2020 | 8 Oct 2021 |
| 96 | firefightersforlife.net | eNom, Inc. | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 97 | firefighterforlife.net | eNom, Inc. | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 98 | firefighterforum.com | GoDaddy.com, LLC | 19 Feb 2005 | 20 Feb 2026 | 19 Feb 2027 |
| 99 | firefighterinterviewquestions.org | GoDaddy.com, LLC | 18 Oct 2011 | 13 May 2015 | 18 Oct 2015 |
| 100 | firefightergiftsngadgets.info | CommuniGal Communication Ltd. | 29 Nov 2023 | 29 Dec 2024 | 29 Nov 2024 |
| 101 | firefighterparamedic.com | GoDaddy.com, LLC | 9 Oct 2003 | 15 Jan 2026 | 9 Oct 2027 |
| 102 | firefighterstrusted.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 103 | firefighterforlife.org | GoDaddy.com, LLC | 22 Apr 2025 | 22 Apr 2026 | 22 Apr 2027 |
| 104 | firefighter-injury.com | GoDaddy.com, LLC | 20 Feb 2003 | 12 Feb 2026 | 1 Jan 2026 |
| 105 | firefighterinjury.com | GoDaddy.com, LLC | 20 Feb 2003 | 12 Feb 2026 | 1 Jan 2026 |
| 106 | firefighterjob.com | GoDaddy.com, LLC | 24 Mar 2002 | 4 Mar 2026 | 24 Mar 2027 |
| 107 | firefighter-news.com | GoDaddy.com, LLC | 13 Feb 2009 | 14 Feb 2024 | 13 Feb 2029 |
| 108 | firefighter-products.com | GoDaddy.com, LLC | 4 Feb 2009 | 4 Feb 2024 | 4 Feb 2027 |
| 109 | firefightergear.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Aug 2025 | 5 Oct 2025 | 5 Aug 2026 |
| 110 | firefighterz.com | GoDaddy.com, LLC | 22 Feb 2011 | 29 Dec 2025 | 22 Feb 2027 |
| 111 | firefightingforum.com | GoDaddy.com, LLC | 12 Dec 2006 | 19 Apr 2015 | 12 Dec 2015 |
| 112 | firefighterinterview.org | GoDaddy.com, LLC | 24 Jul 2011 | 29 Jan 2015 | 24 Jul 2015 |
| 113 | firefightclan.com | 1&1 Internet AG | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 114 | firefighterswithparkinsons.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Aug 2008 | 22 May 2017 | 22 Aug 2017 |
| 115 | firefighterauctions.com | GoDaddy.com, LLC | 31 Aug 2005 | 1 Sep 2014 | 31 Aug 2015 |
| 116 | firefighterbuzz.com | eNom, Inc. | 8 Jan 2014 | 12 May 2026 | 8 Jan 2027 |
| 117 | firefightersupply.com | GoDaddy.com, LLC | 15 Nov 2001 | 18 Nov 2025 | 15 Nov 2026 |
| 118 | firefight1.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Jun 2005 | 22 Sep 2025 | 3 Jun 2026 |
| 119 | firefightersmoving.com | Annulet LLC | 8 Apr 2016 | 24 Mar 2026 | 8 Apr 2027 |
| 120 | firefighterlights.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Nov 2004 | 24 Dec 2024 | 12 Nov 2024 |
| 121 | firefightershop.com | eNom, Inc. | 22 Nov 2002 | 31 May 2026 | 22 Nov 2026 |
| 122 | firefighterrings.com | Uniregistrar Corp | 13 Jun 2015 | 15 Jun 2025 | 13 Jun 2026 |
| 123 | firefightersenemy.com | Nom-iq Ltd. dba COM LAUDE | 22 Dec 2009 | 29 Nov 2025 | 22 Dec 2026 |
| 124 | firefightertv.com | TurnCommerce, Inc. DBA NameBright.com | 18 Mar 2017 | 5 Nov 2025 | 18 Mar 2027 |
| 125 | firefightingstore.com | Fabulous.com Pty Ltd. | 14 Feb 2008 | 18 May 2015 | 14 Feb 2016 |
| 126 | firefighters.tv | Name110, Inc. | 8 Aug 2012 | 5 Dec 2016 | 8 Aug 2017 |
| 127 | firefighter.jobs | Name Share, Inc. | 4 Feb 2010 | 21 Mar 2016 | 4 Feb 2017 |
| 128 | firefightertoolbox.com | GoDaddy.com, LLC | 13 Mar 2008 | 25 Jun 2025 | 24 Jun 2026 |
| 129 | firefighterswives.net | Chengdu West Dimension Digital Technology Co., Ltd… | 12 Oct 2016 | 12 Oct 2016 | 12 Oct 2017 |
| 130 | firefighterrescue.com | GoDaddy.com, LLC | 26 Apr 2010 | 28 Apr 2026 | 26 Apr 2027 |
| 131 | firefighterscu.com | GoDaddy.com, LLC | 12 Jul 1999 | 9 Dec 2025 | 1 Jan 2029 |
| 132 | firefightervideo.com | Dynadot, LLC | 25 Mar 2009 | 1 Apr 2013 | 25 Mar 2016 |
| 133 | firefightproducts.com | GoDaddy.com, LLC | 6 Dec 2011 | 5 Apr 2026 | 6 Dec 2026 |
| 134 | firefightermemes.com | Hongkong Domain Name Information Management Co., L… | 7 Nov 2021 | 11 Nov 2022 | 7 Nov 2022 |
| 135 | firefightersworldwide.com | GoDaddy.com, LLC | 7 Aug 2010 | 13 Mar 2026 | 7 Aug 2026 |
| 136 | firefighterspot.com | GoDaddy.com, LLC | 14 Aug 2007 | 17 Feb 2025 | 17 Feb 2027 |
| 137 | firefighting-equipment.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Nov 2003 | 12 Dec 2025 | 11 Nov 2026 |
| 138 | firefightingebakerc.info | Wild West Domains, LLC | 2 Nov 2014 | 2 Nov 2014 | 2 Nov 2015 |
| 139 | firefightercorner.com | Wild West Domains, LLC | 12 Jun 2013 | 12 Jun 2015 | 12 Jun 2016 |
| 140 | firefightersforfitzgerald.com | GoDaddy.com, LLC | 11 Jun 2014 | 12 Jun 2015 | 11 Jun 2016 |
| 141 | firefighterscookoff.com | GoDaddy.com, LLC | 12 Jun 2012 | 13 Jun 2015 | 12 Jun 2016 |
| 142 | firefighterwife.com | NameCheap, Inc. | 31 Oct 2008 | 1 Oct 2025 | 31 Oct 2026 |
| 143 | firefighterbabes.net | GoDaddy.com, LLC | 21 Dec 2007 | 17 Apr 2015 | 21 Dec 2015 |
| 144 | firefightersidegig.com | Go Canada Domains, LLC | 16 Aug 2009 | 20 Apr 2015 | 16 Aug 2015 |
| 145 | firefightersforchrist.org | CloudFlare, Inc. | 15 Jun 1997 | 20 Nov 2025 | 14 Jun 2029 |
| 146 | firefighterawardsgifts.com | GoDaddy.com, LLC | 26 Nov 2008 | 27 Nov 2025 | 26 Nov 2026 |
| 147 | firefightermath.org | - | 6 Apr 2006 | 8 Apr 2026 | 6 Apr 2027 |
| 148 | firefighterscalendar.com | Network Solutions, LLC | 8 Jul 1998 | 28 Jun 2024 | 7 Jul 2029 |
| 149 | firefighterstrust.org | GoDaddy.com, LLC | 2 Nov 2014 | 2 Nov 2017 | 2 Nov 2018 |
| 150 | firefightersontheair.com | Active 24 AS | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 151 | firefightingnew.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 152 | firefighterscalender.com | Fabulous.com Pty Ltd. | 10 Oct 2002 | 31 Oct 2017 | 10 Oct 2018 |
| 153 | firefighterdog.com | - | 16 Jul 2022 | 16 Jul 2022 | 16 Jul 2023 |
| 154 | firefighterz.us | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2014 | 3 Nov 2015 |
| 155 | firefightersfriend.com | GoDaddy.com, LLC | 22 Jun 2024 | 3 Sep 2025 | 22 Jun 2025 |
| 156 | firefighterstraining.com | TurnCommerce, Inc. DBA NameBright.com | 30 Mar 2022 | 9 Jun 2025 | 30 Mar 2025 |
| 157 | firefighterdiaperbag.com | GoDaddy.com, LLC | 6 Nov 2014 | 7 Nov 2021 | 6 Nov 2022 |
| 158 | firefighter-rancher.com | GMO Internet Inc. | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 159 | firefighter-landlord.com | GMO Internet Inc. | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 160 | firefighter-hairdresser.com | GMO Internet Inc. | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 161 | firefighter-attendant.com | GMO Internet Inc. | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 162 | firefighter-carrier.info | GMO Internet Inc. | 22 Aug 2014 | - | 22 Aug 2015 |
| 163 | firefighter-court.info | GMO Internet Inc. | 22 Aug 2014 | - | 22 Aug 2015 |
| 164 | firefighter-lawyer.info | GMO Internet Inc. | 22 Aug 2014 | - | 22 Aug 2015 |
| 165 | firefighter-manager.info | GMO Internet Inc. | 22 Aug 2014 | - | 22 Aug 2015 |
| 166 | firefighter-worker.biz | GMO Internet Inc. | 7 Nov 2014 | - | 6 Nov 2015 |
| 167 | firefighter-translator.biz | GMO Internet Inc. | 7 Nov 2014 | - | 6 Nov 2015 |
| 168 | firefighter-representative.biz | GMO Internet Inc. | 7 Nov 2014 | - | 6 Nov 2015 |
| 169 | firefighter-reporter.biz | GMO Internet Inc. | 7 Nov 2014 | - | 6 Nov 2015 |
| 170 | firefighter-realtor.biz | GMO Internet Inc. | 7 Nov 2014 | - | 6 Nov 2015 |
| 171 | firefighter-baby-sitter.biz | GMO Internet Inc. | 7 Nov 2014 | - | 6 Nov 2015 |
| 172 | firefighter-agent.com | GMO Internet Inc. | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 173 | firefighter-barber.biz | GMO Internet Inc. | 22 Aug 2014 | - | 21 Aug 2015 |
| 174 | firefighter-driver.com | GMO Internet Inc. | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 175 | firefighter-groomer.biz | GMO Internet Inc. | 22 Aug 2014 | - | 21 Aug 2015 |
| 176 | firefighter-person.com | GMO Internet Inc. | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 177 | firefightingpumps.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 178 | firefighter-mover.info | GMO Internet Inc. | 7 Nov 2014 | - | 7 Nov 2015 |
| 179 | firefighter-messenger.info | GMO Internet Inc. | 7 Nov 2014 | - | 7 Nov 2015 |
| 180 | firefighter-home.info | GMO Internet Inc. | 7 Nov 2014 | - | 7 Nov 2015 |
| 181 | firefighter-guard.info | GMO Internet Inc. | 7 Nov 2014 | - | 7 Nov 2015 |
| 182 | firefightershoes.com | GoDaddy.com, LLC | 12 Aug 2014 | 13 Aug 2016 | 12 Aug 2018 |
| 183 | firefighterteststudy.com | Domain.com, LLC | 13 Aug 2014 | 29 Jul 2017 | 13 Aug 2018 |
| 184 | firefightarms.com | GoDaddy.com, LLC | 26 Aug 2014 | 7 Nov 2025 | 26 Aug 2025 |
| 185 | firefightercreditunions.com | GoDaddy.com, LLC | 25 Aug 2014 | 26 Aug 2025 | 25 Aug 2026 |
| 186 | firefightercreditunions.org | GoDaddy.com, LLC | 25 Aug 2014 | 26 Aug 2017 | 25 Aug 2018 |
| 187 | firefightermobile.com | CloudFlare, Inc. | 27 Aug 2014 | 18 May 2026 | 15 Jun 2027 |
| 188 | firefightermobileapp.com | GoDaddy.com, LLC | 27 Aug 2014 | 16 Jun 2016 | 15 Jun 2017 |
| 189 | firefighterscreditunions.com | GoDaddy.com, LLC | 25 Aug 2014 | 26 Aug 2025 | 25 Aug 2026 |
| 190 | firefighterscreditunions.org | GoDaddy.com, LLC | 25 Aug 2014 | 26 Aug 2017 | 25 Aug 2018 |
| 191 | firefightingisgood.com | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 192 | firefightinc.com | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2016 |
| 193 | firefighterbrotherhood.biz | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 13 Aug 2015 |
| 194 | firefighterrehabwipes.com | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2016 |
| 195 | firefightingrehabwipes.com | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2016 |
| 196 | firefighterbachelorauction.com | GoDaddy.com, LLC | 27 Aug 2014 | 8 Nov 2025 | 27 Aug 2025 |
| 197 | firefightingfisherman.com | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2016 |
| 198 | firefightersforgood.org | GoDaddy.com, LLC | 9 Nov 2014 | 17 Oct 2025 | 9 Nov 2027 |
| 199 | firefightingehothotel.com | Wild West Domains, LLC | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 200 | firefighterfunny.com | eNom, Inc. | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 201 | firefighterspaintingandmore.com | Tucows Domains Inc. | 10 Nov 2013 | 14 Nov 2014 | 10 Nov 2015 |
| 202 | firefighterclasses.com | DropCatch.com 1102 LLC | 14 Jul 2020 | 13 Aug 2025 | 14 Jul 2026 |
| 203 | firefighterpost.com | Nobel Networks | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 204 | firefighterowned.com | Go Montenegro Domains, LLC | 31 Aug 2014 | 1 Sep 2024 | 31 Aug 2026 |
| 205 | firefighterstud.com | GoDaddy.com, LLC | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 206 | firefighterspecialteams.org | Tucows Domains Inc. | 14 Sep 2014 | 18 Sep 2017 | 14 Sep 2018 |
| 207 | firefightersbenevolent.com | GoDaddy.com, LLC | 1 Sep 2014 | 2 Sep 2025 | 1 Sep 2026 |
| 208 | firefightersbenevolent.info | GoDaddy.com, LLC | 1 Sep 2014 | 16 Oct 2025 | 1 Sep 2026 |
| 209 | firefightersbenevolent.net | GoDaddy.com, LLC | 1 Sep 2014 | 2 Sep 2025 | 1 Sep 2026 |
| 210 | firefightersbenevolent.org | GoDaddy.com, LLC | 1 Sep 2014 | 16 Oct 2025 | 1 Sep 2026 |
| 211 | firefighterslimos.com | GoDaddy.com, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 212 | firefighterslimousines.com | GoDaddy.com, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 213 | firefighteronthemove.com | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 214 | firefighterapproved.com | GoDaddy.com, LLC | 4 Sep 2014 | 5 Sep 2025 | 4 Sep 2026 |
| 215 | firefightersarehot.com | - | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2017 |
| 216 | firefighterleather.net | - | 28 Sep 2009 | 28 Sep 2009 | 28 Sep 2017 |
| 217 | firefightress.com | Wix.com Ltd. | 14 Dec 2025 | 21 Dec 2025 | 14 Dec 2026 |
| 218 | firefightersfair.com | TurnCommerce, Inc. DBA NameBright.com | 4 Feb 2022 | 22 Aug 2022 | 4 Feb 2027 |
| 219 | firefighterleather.com | Tucows Domains Inc. | 19 Sep 2019 | 5 Sep 2025 | 19 Sep 2026 |
| 220 | firefightersjewelry.com | DropCatch.com 393 LLC | 20 Sep 2014 | 21 Sep 2017 | 20 Sep 2018 |
| 221 | firefighterslegalinsurance.com | Tucows Domains Inc. | 14 Nov 2011 | 18 Nov 2014 | 14 Nov 2015 |
| 222 | firefighterlegalinsurance.com | Tucows Domains Inc. | 14 Nov 2011 | 18 Nov 2014 | 14 Nov 2015 |
| 223 | firefighter-apps.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2016 |
| 224 | firefightersunionpublicrelations.com | GoDaddy.com, LLC | 3 Oct 2014 | 4 Oct 2016 | 3 Oct 2017 |
| 225 | firefightersunionmediarelations.com | GoDaddy.com, LLC | 3 Oct 2014 | 4 Oct 2016 | 3 Oct 2017 |
| 226 | firefightersunionmediatraining.com | GoDaddy.com, LLC | 3 Oct 2014 | 4 Oct 2016 | 3 Oct 2017 |
| 227 | firefightersunionpr.com | GoDaddy.com, LLC | 3 Oct 2014 | 4 Oct 2016 | 3 Oct 2017 |
| 228 | firefighterjackets.com | TurnCommerce, Inc. DBA NameBright.com | 20 Mar 2022 | 1 Jun 2024 | 20 Mar 2024 |
| 229 | firefightermed.com | FastDomain Inc. | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 230 | firefightertshirtsonline.com | GoDaddy.com, LLC | 10 Sep 2014 | 11 Sep 2016 | 10 Sep 2017 |
| 231 | firefighterbrands.com | DropCatch.com 1449 LLC | 29 Apr 2018 | 29 Apr 2018 | 29 Apr 2019 |
| 232 | firefighterblend.com | eNom, Inc. | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 233 | firefighter-software.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2016 |
| 234 | firefighterchristmaslights.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2025 | 2 Oct 2026 |
| 235 | firefightersuppressionsvcs.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2016 |
| 236 | firefighting-app.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2016 |
| 237 | firefighting-software.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2016 |
| 238 | firefighting-apps.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2016 |
| 239 | firefightingapp.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2016 |
| 240 | firefightingbasics.com | NameCheap, Inc. | 30 Nov 2021 | 30 Nov 2025 | 30 Nov 2026 |
| 241 | firefight110.com | register.com, Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 242 | firefightingrobot.com | - | 11 Sep 2014 | 18 Apr 2026 | 11 Sep 2027 |
| 243 | firefightersareheros.com | DNC Holdings, Inc. | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 244 | firefightlikeagirl.com | DNC Holdings, Inc. | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 245 | firefightersforken.net | GMO Internet Inc. | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 246 | firefightingeindimike.com | Wild West Domains, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 247 | firefighterholidaylights.com | GoDaddy.com, LLC | 21 Jan 2020 | 22 Jan 2025 | 21 Jan 2030 |
| 248 | firefighterssingles.com | GoDaddy.com, LLC | 5 Oct 2014 | 6 Oct 2016 | 5 Oct 2017 |
| 249 | firefighterwithapen.com | - | 23 Dec 2024 | 24 Dec 2025 | 23 Dec 2026 |
| 250 | firefightingcolleges.com | eNom, Inc. | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 251 | firefighterflashgame.com | Namesilo, LLC | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 252 | firefighter-fisherman.com | GMO Internet Inc. | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 253 | firefighter-librarian.com | GMO Internet Inc. | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 254 | firefighter-lifeguard.biz | GMO Internet Inc. | 6 Oct 2014 | - | 5 Oct 2015 |
| 255 | firefightersuppressionservices.com | Marcaria.com International, Inc. | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 256 | firefighterforaday.net | GoDaddy.com, LLC | 20 Nov 2014 | 15 Apr 2026 | 4 Mar 2026 |
| 257 | firefightingbackpack.com | Gransy s.r.o. d/b/a subreg.cz | 24 Sep 2014 | 2 Sep 2025 | 24 Sep 2026 |
| 258 | firefighternetworks.net | GoDaddy.com, LLC | 25 Sep 2014 | 26 Sep 2016 | 25 Sep 2017 |
| 259 | firefighternetworks.info | GoDaddy.com, LLC | 25 Sep 2014 | 26 Sep 2016 | 25 Sep 2017 |
| 260 | firefighternetworks.org | GoDaddy.com, LLC | 25 Sep 2014 | 26 Sep 2016 | 25 Sep 2017 |
| 261 | firefighterministries.org | NameCheap, Inc. | 1 Aug 2022 | 16 Aug 2023 | 1 Aug 2024 |
| 262 | firefighter24.com | World4You Internet Services GmbH | 16 Feb 2017 | 7 Apr 2026 | 16 Feb 2027 |
| 263 | firefightersanta.com | GoDaddy.com, LLC | 14 Dec 2020 | 14 Dec 2020 | 14 Dec 2021 |
| 264 | firefighterpracticecar.com | GoDaddy.com, LLC | 29 Sep 2014 | 20 Sep 2016 | 29 Sep 2019 |
| 265 | firefightersanta.org | - | 3 Dec 2024 | 10 Dec 2025 | 3 Dec 2026 |
| 266 | firefighting-backpack.com | Gransy s.r.o. d/b/a subreg.cz | 29 Sep 2014 | 2 Sep 2025 | 29 Sep 2026 |
| 267 | firefighterinjurylawyers.us | GoDaddy.com, LLC | 10 Oct 2014 | 15 Oct 2017 | 9 Oct 2018 |
| 268 | firefighterstation.com | GoDaddy.com, LLC | 13 Mar 2024 | 14 Mar 2026 | 13 Mar 2027 |
| 269 | firefighter1show.com | GoDaddy.com, LLC | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 270 | firefightinginnovations.com | Beijing Lanhai Jiye Technology Co., Ltd | 3 Apr 2021 | 5 May 2024 | 3 Apr 2024 |
| 271 | firefightertrainingspot.com | Launchpad, Inc. | 23 Nov 2014 | 23 Nov 2014 | 23 Nov 2015 |
| 272 | firefighterdecals.com | GoDaddy.com, LLC | 23 Nov 2014 | 19 Mar 2026 | 23 Nov 2026 |
| 273 | firefightertrade.com | TurnCommerce, Inc. DBA NameBright.com | 10 Jun 2014 | 4 Jun 2021 | 10 Jun 2026 |
| 274 | firefighterkungfu.com | GoDaddy.com, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 275 | firefighterpr.com | eNom, Inc. | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 276 | firefightersforkids.info | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 277 | firefighterspr.com | eNom, Inc. | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 278 | firefightertrainingofficer.com | GoDaddy.com, LLC | 24 Nov 2014 | 25 Nov 2024 | 24 Nov 2026 |
| 279 | firefighterindia.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 280 | firefighterleatherproducts.com | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 281 | firefighterleathershields.com | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 282 | firefightersforkids.biz | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 13 Oct 2015 |
| 283 | firefightersforkids.mobi | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 284 | firefightersforkids.org | Tucows Domains Inc. | 18 Sep 2016 | 25 Jan 2026 | 18 Sep 2026 |
| 285 | firefightersauction.com | Domain.com, LLC | 16 Oct 2014 | 1 Oct 2016 | 16 Oct 2017 |
| 286 | firefightersinsurance.com | Annulet LLC | 26 Nov 2014 | 11 Nov 2025 | 26 Nov 2026 |
| 287 | firefighterjoannemhayeswhite.com | GoDaddy.com, LLC | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 288 | firefighterjoannemhayes-white.com | GoDaddy.com, LLC | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 289 | firefighterjoannehayeswhite.com | GoDaddy.com, LLC | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 290 | firefighterjoannehayes-white.com | GoDaddy.com, LLC | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 291 | firefightingmemorabilia.net | eNom, Inc. | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 292 | firefighterspecial.com | TLD Registrar Solutions Ltd. | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2015 |
| 293 | firefightersmiracle.com | GoDaddy.com, LLC | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 294 | firefighterrelocation.com | GoDaddy.com, LLC | 2 Dec 2014 | 3 Dec 2025 | 2 Dec 2026 |
| 295 | firefightingroom.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 296 | firefightingandrescue.com | 1&1 Internet AG | 2 Dec 2014 | 3 Dec 2014 | 2 Dec 2015 |
| 297 | firefightingarea.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 298 | firefighter-adperson.biz | GMO Internet Inc. | 3 Dec 2014 | - | 2 Dec 2015 |
| 299 | firefighteraptitudetests.com | GoDaddy.com, LLC | 6 Dec 2014 | 6 Dec 2025 | 6 Dec 2027 |
| 300 | firefighteraptitudetest.com | GoDaddy.com, LLC | 6 Dec 2014 | 6 Dec 2025 | 6 Dec 2027 |
| 301 | firefighterdiscounts.com | TurnCommerce, Inc. DBA NameBright.com | 6 Dec 2014 | 15 Jan 2025 | 6 Dec 2024 |
| 302 | firefighterdiet.com | GoDaddy.com, LLC | 7 Oct 2015 | 18 Nov 2025 | 7 Oct 2025 |
| 303 | firefightersretirementsolutions.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2025 | 8 Dec 2026 |
| 304 | firefightersretirement.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2025 | 8 Dec 2026 |
| 305 | firefighterretirementplan.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2025 | 8 Dec 2026 |
| 306 | firefighterpensions.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2025 | 8 Dec 2026 |
| 307 | firefightersrock.com | TierraNet Inc. d/b/a DomainDiscover | 10 Dec 2014 | 7 Dec 2016 | 9 Dec 2017 |
| 308 | firefighters313.com | Domain.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 309 | firefighterireland.com | GoDaddy.com, LLC | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2016 |
| 310 | firefighterfuel.com | GoDaddy.com, LLC | 17 Aug 2022 | 18 Aug 2024 | 17 Aug 2026 |
| 311 | firefighterfitnessproject.com | GoDaddy.com, LLC | 11 Dec 2014 | 25 Feb 2017 | 11 Mar 2018 |
| 312 | firefighterfitnessprogram.com | GoDaddy.com, LLC | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2016 |
| 313 | firefightersvideos.com | Tucows Domains Inc. | 12 Dec 2014 | 16 Dec 2015 | 12 Dec 2016 |
| 314 | firefightereducation.info | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 315 | firefightercds.com | Tucows Domains Inc. | 15 Dec 2014 | 19 Dec 2015 | 15 Dec 2016 |
| 316 | firefightercatalog.com | Fabulous.com Pty Ltd. | 23 Nov 2005 | 4 Dec 2017 | 23 Nov 2018 |
| 317 | firefighterbuyahome.com | GoDaddy.com, LLC | 15 Dec 2014 | 16 Dec 2025 | 15 Dec 2026 |
| 318 | firefighterfoundation.com | Webfusion Ltd. | 16 Dec 2014 | 22 Dec 2025 | 16 Dec 2026 |
| 319 | firefighterdailyoffers.com | GoDaddy.com, LLC | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2016 |
| 320 | firefighterdailyoffer.com | GoDaddy.com, LLC | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 321 | firefighterdailydeal.com | GoDaddy.com, LLC | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 322 | firefightinginfctlsystem.com | Xin Net Technology Corporation | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 323 | firefightercancerconsultants.com | GoDaddy.com, LLC | 19 Dec 2014 | 12 Aug 2024 | 19 Dec 2031 |
| 324 | firefightercalc.com | GoDaddy.com, LLC | 20 Dec 2014 | 20 Dec 2014 | 20 Dec 2015 |
| 325 | firefighterpreneur.com | GoDaddy.com, LLC | 31 May 2016 | 31 May 2026 | 31 May 2027 |
| 326 | firefighterdrop.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 327 | firefightgame.com | Google, Inc. | 29 Sep 2018 | 29 Sep 2018 | 29 Sep 2019 |
| 328 | firefighterslegacy.com | GoDaddy.com, LLC | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2015 |
| 329 | firefighterhistory.info | 1&1 Internet AG | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2015 |
| 330 | firefightermentor.com | Tucows Domains Inc. | 8 Oct 2024 | 25 Sep 2025 | 8 Oct 2026 |
| 331 | firefightersofwalton.org | Everyones Internet, Ltd. dba SoftLayer | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 332 | firefightingcourses.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2016 |
| 333 | firefightersrun4yourlife.com | GoDaddy.com, LLC | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2016 |
| 334 | firefighterfreefall.com | GoDaddy.com, LLC | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 335 | firefighterproductions.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 336 | firefighterproduction.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 337 | firefighters-calendar.com | Cosmotown, Inc. | 25 Aug 2014 | 21 Sep 2025 | 25 Aug 2026 |
| 338 | firefightercard.com | TurnCommerce, Inc. DBA NameBright.com | 25 Mar 2017 | 5 May 2026 | 25 Mar 2026 |
| 339 | firefighterproductions.org | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 340 | firefighterproductions.net | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 341 | firefighterproductions.info | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 342 | firefighter.foundation | 1&1 Internet AG | 3 Jul 2014 | 17 Aug 2025 | 3 Jul 2026 |
| 343 | firefighter.tips | Wild West Domains, LLC | 23 Jul 2014 | 6 Sep 2025 | 23 Jul 2026 |
| 344 | firefighteraxe.xyz | Network Solutions, LLC | 23 Jul 2014 | 24 Jul 2014 | 23 Jul 2015 |
| 345 | firefighter.career | GTLDPREMIUM | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2024 |
| 346 | firefighter.boutique | 101domain, Inc. | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 347 | firefighting.ninja | GoDaddy.com, LLC | 2 Sep 2014 | 17 Oct 2017 | 2 Sep 2018 |
| 348 | firefighter.life | CommuniGal Communication Ltd. | 24 Feb 2026 | - | 24 Feb 2027 |
| 349 | firefighterlawyers.nyc | GoDaddy.com, LLC | 3 Oct 2014 | 20 Oct 2025 | 2 Oct 2027 |
| 350 | firefighterlawyer.nyc | GoDaddy.com, LLC | 3 Oct 2014 | 20 Oct 2025 | 2 Oct 2027 |
| 351 | firefighter.nyc | Fabulous.com Pty Ltd. | 8 Oct 2014 | 20 Oct 2025 | 7 Oct 2026 |
| 352 | firefighter.deals | eNom, Inc. | 8 Oct 2014 | 29 Sep 2017 | 8 Oct 2018 |
| 353 | firefightersballcf.social | eNom, Inc. | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 354 | firefighter.supply | Google, Inc. | 25 Jan 2023 | 11 Mar 2026 | 25 Jan 2027 |
| 355 | firefightersdaily.com | Cosmotown, Inc. | 25 Mar 2023 | 5 May 2024 | 25 Mar 2024 |
| 356 | firefighter5k.net | Namesilo, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 357 | firefightershields.nyc | GoDaddy.com, LLC | 12 Nov 2014 | 12 Nov 2014 | 11 Nov 2015 |
| 358 | firefighter.pictures | GoDaddy.com, LLC | 21 Nov 2014 | 22 Nov 2014 | 21 Nov 2015 |
| 359 | firefighters.london | Tucows Domains Inc. | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 360 | firefighter.website | NameCheap, Inc. | 17 Dec 2014 | 18 Dec 2014 | 17 Dec 2015 |
| 361 | firefighter-weakness.blue | GMO Internet Inc. | 29 Dec 2014 | - | 29 Dec 2015 |
| 362 | firefighter.software | NameCheap, Inc. | 4 Jan 2015 | 6 Dec 2025 | - |
| 363 | firefighter-japan.blue | GMO Internet Inc. | 30 Dec 2014 | - | 30 Dec 2015 |
| 364 | firefighter-except-closely.blue | GMO Internet Inc. | 30 Dec 2014 | - | 30 Dec 2015 |
| 365 | firefightershelpingfirefighters.gives | Go Montenegro Domains, LLC | 14 Jan 2015 | 10 Jan 2017 | 14 Jan 2018 |
| 366 | firefighter.melbourne | Crazy Domains FZ-LLC | 24 Jan 2015 | 25 Jan 2015 | 24 Jan 2017 |
| 367 | firefighting.guru | GoDaddy.com, LLC | 3 May 2015 | 3 May 2015 | 3 May 2016 |
| 368 | firefighter.help | Uniregistrar Corp | 31 Jan 2015 | 17 Mar 2017 | 31 Jan 2018 |
| 369 | firefighter.fitness | GoDaddy.com, LLC | 3 Feb 2015 | 20 Mar 2026 | 3 Feb 2027 |
| 370 | firefighter.diet | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 371 | firefighter.community | CloudFlare, Inc. | 30 Jan 2015 | 19 May 2026 | 30 Jan 2028 |
| 372 | firefighter.work | GoDaddy.com, LLC | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 373 | firefighting.equipment | OVH sas | 9 Jan 2024 | 6 Jan 2025 | 9 Jan 2026 |
| 374 | firefighters.supply | eNom, Inc. | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 375 | firefighter.today | CommuniGal Communication Ltd. | 28 Aug 2024 | - | 28 Aug 2025 |
| 376 | firefighter.science | Nameshield SAS | 2 Mar 2015 | - | 1 Mar 2016 |
| 377 | firefighter.university | Gandi SAS | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 378 | firefighting.science | Alpnames Limited | 13 Mar 2015 | 13 Mar 2015 | 12 Mar 2016 |
| 379 | firefighting.company | Regional Network Information Center, JSC dba RU-CE… | 19 Mar 2014 | 19 Mar 2015 | 19 Mar 2016 |
| 380 | firefighterclimb.nyc | GoDaddy.com, LLC | 23 Mar 2015 | 3 May 2023 | 22 Mar 2023 |
| 381 | firefighter.systems | Tucows Domains Inc. | 19 Mar 2014 | 18 Feb 2026 | - |
| 382 | firefighter.support | Tucows Domains Inc. | 2 Apr 2022 | 20 Mar 2026 | - |
| 383 | firefighter.solutions | Google, Inc. | 25 Jan 2023 | 11 Mar 2026 | 25 Jan 2027 |
| 384 | firefighter.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 385 | firefightingchildren.com | GoDaddy.com, LLC | 13 Aug 2015 | 24 Sep 2024 | 13 Aug 2024 |
| 386 | firefighter.gifts | GoDaddy.com, LLC | 14 Apr 2015 | 14 Apr 2026 | 14 Apr 2027 |
| 387 | firefighting.community | GoDaddy.com, LLC | 24 Apr 2015 | 5 Jun 2024 | 24 Apr 2024 |
| 388 | firefighterwine.club | GoDaddy.com, LLC | 23 Apr 2015 | 23 Apr 2026 | 22 Apr 2027 |
| 389 | firefightercard.net | 1&1 Internet AG | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 390 | firefightercard.info | 1&1 Internet AG | 4 Jan 2015 | - | 4 Jan 2016 |
| 391 | firefightingart.com | Annulet LLC | 27 Mar 2016 | 9 May 2026 | 27 Mar 2026 |
| 392 | firefightercooling.com | GoDaddy.com, LLC | 7 Jan 2015 | 8 Jan 2026 | 7 Jan 2027 |
| 393 | firefighter-telemarketer.com | GMO Internet Inc. | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 394 | firefighterins.com | GoDaddy.com, LLC | 8 Jan 2015 | 6 Jan 2025 | 8 Jan 2027 |
| 395 | firefighter-salesperson.biz | GMO Internet Inc. | 8 Jan 2015 | 9 Jan 2015 | 7 Jan 2016 |
| 396 | firefightersforthepeople.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2017 |
| 397 | firefighterdepartment.com | GoDaddy.com, LLC | 2 Feb 2019 | 2 Feb 2019 | 2 Feb 2020 |
| 398 | firefightinguav.com | GoDaddy.com, LLC | 7 Jul 2016 | 8 Jul 2025 | 7 Jul 2028 |
| 399 | firefightingskills.com | Misk.com, Inc. | 11 Jan 2014 | 12 Dec 2016 | 11 Jan 2018 |
| 400 | firefighter-classes.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 15 Oct 2020 | 15 Oct 2020 | 15 Oct 2021 |
| 401 | firefighting-gasmask.com | Megazone Corp., dba HOSTING.KR | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 402 | firefighter-artistic-photography.com | Domain.com, LLC | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 403 | firefighterdiscount.com | GoDaddy.com, LLC | 17 Jan 2025 | 17 Jan 2026 | 17 Jan 2027 |
| 404 | firefighter.link | eNom, Inc. | 19 May 2015 | 25 Apr 2026 | 19 May 2027 |
| 405 | firefighters.website | Alpnames Limited | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 406 | firefighterplace.xyz | eNom, Inc. | 7 Jul 2015 | 7 Jul 2015 | 7 Jul 2016 |
| 407 | firefightersidejobs.com | GoDaddy.com, LLC | 13 Dec 2020 | 14 Dec 2024 | 13 Dec 2026 |
| 408 | firefighters.xyz | - | 12 Dec 2021 | 4 Sep 2025 | 12 Dec 2029 |
| 409 | firefighterplayground.com | GoDaddy.com, LLC | 16 Aug 2015 | 16 Aug 2015 | 16 Aug 2017 |
| 410 | firefighter.news | GoDaddy.com, LLC | 15 Jul 2015 | 29 Aug 2025 | 15 Jul 2026 |
| 411 | firefighter.fund | Chengdu West Dimension Digital Technology Co., Ltd… | 22 Sep 2018 | 23 Sep 2018 | 22 Sep 2019 |
| 412 | firefightersmap.com | united-domains AG | 17 Jan 2015 | 18 Jan 2015 | 17 Jan 2016 |
| 413 | firefightersingles.com | GoDaddy.com, LLC | 28 Jan 2018 | 29 Jan 2026 | 28 Jan 2027 |
| 414 | firefightermap.com | united-domains AG | 17 Jan 2015 | 18 Jan 2015 | 17 Jan 2016 |
| 415 | firefightersfair.org | GoDaddy.com, LLC | 14 Jan 2003 | 15 Jan 2026 | 14 Jan 2027 |
| 416 | firefighterleasing.com | GoDaddy.com, LLC | 18 Jan 2015 | 18 Jan 2015 | 18 Jan 2017 |
| 417 | firefightings.com | CloudFlare, Inc. | 19 Jan 2015 | 2 Dec 2025 | 19 Jan 2027 |
| 418 | firefightingmen.com | Sssasss, Incorporated | 16 Jun 2020 | 16 Jun 2020 | 16 Jun 2021 |
| 419 | firefighterrule.com | GoDaddy.com, LLC | 19 Jan 2015 | 20 Jan 2026 | 19 Jan 2027 |
| 420 | firefightermoney.com | Google, Inc. | 5 Jun 2023 | 21 May 2025 | 5 Jun 2026 |
| 421 | firefighterhomeinspections.info | 1&1 Internet AG | 17 Aug 2015 | 17 Aug 2016 | 17 Aug 2017 |
| 422 | firefighteracademygraduationbanners.com | GoDaddy.com, LLC | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 423 | firefightershotsauce.com | GoDaddy.com, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 424 | firefighterhotsauce.com | NameKing.com Inc. | 27 May 2024 | 29 Apr 2026 | 27 May 2027 |
| 425 | firefightercpr.net | GoDaddy.com, LLC | 24 Oct 2020 | 24 Oct 2020 | 24 Oct 2021 |
| 426 | firefightinglit.com | eNom, Inc. | 21 Jan 2015 | 31 May 2026 | 21 Jan 2027 |
| 427 | firefighterfamilylaw.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 428 | firefighterdivorce.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 429 | firefightertees.org | GoDaddy.com, LLC | 21 Jan 2015 | 16 Dec 2015 | 21 Jan 2018 |
| 430 | firefightertees.net | GoDaddy.com, LLC | 21 Jan 2015 | 21 Jan 2015 | 21 Jan 2016 |
| 431 | firefightertees.info | GoDaddy.com, LLC | 21 Jan 2015 | - | 21 Jan 2016 |
| 432 | firefighttrucks.com | Key-Systems GmbH | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2016 |
| 433 | firefighterdogrescue.com | GoDaddy.com, LLC | 24 Jan 2015 | 25 Jan 2025 | 24 Jan 2030 |
| 434 | firefightervox.com | GoDaddy.com, LLC | 25 Jan 2015 | 25 Jan 2015 | 25 Jan 2016 |
| 435 | firefightnewsnow.com | eNom, Inc. | 26 Jan 2015 | 26 Jan 2015 | 26 Jan 2016 |
| 436 | firefightersareawesome.com | GoDaddy.com, LLC | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 437 | firefighterhelper.com | DreamHost, LLC | 26 Jan 2015 | 26 Jan 2015 | 26 Jan 2016 |
| 438 | firefighterlist.org | GoDaddy.com, LLC | 25 Jan 2015 | 26 Jan 2017 | 25 Jan 2018 |
| 439 | firefightersfortrump2016.com | GoDaddy.com, LLC | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 440 | firefightersisterhood.com | GoDaddy.com, LLC | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2017 |
| 441 | firefighterstraps.com | Tucows Domains Inc. | 4 Jul 2020 | 24 Jan 2023 | 4 Jul 2029 |
| 442 | firefighterspension.com | GoDaddy.com, LLC | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2016 |
| 443 | firefighterfd.com | FastDomain Inc. | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2016 |
| 444 | firefightersellinghomes.com | GoDaddy.com, LLC | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2020 |
| 445 | firefighterstherapy.com | register.com, Inc. | 1 Feb 2015 | 2 May 2024 | 1 Feb 2027 |
| 446 | firefighterscase.com | GoDaddy.com, LLC | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2016 |
| 447 | firefightermalibu.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2016 |
| 448 | firefightersclubcard.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 449 | firefightec.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 450 | firefightergirl.com | eNom, Inc. | 8 Apr 2026 | 2 Jun 2026 | 8 Apr 2028 |
| 451 | firefighter-secretary.com | GMO Internet Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 452 | firefighterfit.net | GoDaddy.com, LLC | 15 Nov 2024 | 15 Nov 2024 | 15 Nov 2026 |
| 453 | firefightersfortrump.org | Network Solutions, LLC | 18 Jan 2019 | 24 Nov 2024 | 18 Jan 2027 |
| 454 | firefightersfortrump.net | GoDaddy.com, LLC | 26 Apr 2019 | 26 Apr 2019 | 26 Apr 2021 |
| 455 | firefightersfortrump.com | Network Solutions, LLC | 18 Jan 2019 | 19 Nov 2024 | 18 Jan 2027 |
| 456 | firefightersfordonaldtrump.org | Network Solutions, LLC | 20 Aug 2015 | 7 Jun 2017 | 20 Aug 2018 |
| 457 | firefightersfordonaldtrump.net | Network Solutions, LLC | 20 Aug 2015 | 7 Jun 2017 | 20 Aug 2018 |
| 458 | firefightersfordonaldtrump.com | Network Solutions, LLC | 20 Aug 2015 | 7 Jun 2017 | 20 Aug 2018 |
| 459 | firefighterairsystem.org | GoDaddy.com, LLC | 21 Aug 2015 | 20 Oct 2015 | 21 Aug 2020 |
| 460 | firefighterairsystem.net | GoDaddy.com, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2020 |
| 461 | firefighterairsystem.info | GoDaddy.com, LLC | 21 Aug 2015 | 2 Oct 2023 | 21 Aug 2023 |
| 462 | firefighterairsystem.com | GateKeeperDomains.net LLC | 7 Nov 2023 | 21 Dec 2024 | 7 Nov 2024 |
| 463 | firefighterairreplenishmentsystem.org | GoDaddy.com, LLC | 21 Aug 2015 | 20 Oct 2015 | 21 Aug 2020 |
| 464 | firefighterairreplenishmentsystem.net | GoDaddy.com, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2020 |
| 465 | firefighterairreplenishmentsystem.info | GoDaddy.com, LLC | 21 Aug 2015 | 2 Oct 2023 | 21 Aug 2023 |
| 466 | firefighterairreplenishmentsystem.com | GoDaddy.com, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2020 |
| 467 | firefighterweddingbands.com | GoDaddy.com, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 468 | firefighterweddingband.com | GoDaddy.com, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 469 | firefightermemorialcross.com | GoDaddy.com, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 470 | firefightergravemarker.com | GoDaddy.com, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 471 | firefightergutcheck.com | - | - | - | - |
| 472 | firefighteredge.com | NameCheap, Inc. | 20 Oct 2020 | 20 Sep 2025 | 20 Oct 2026 |
| 473 | firefightmovie.com | CSC Corporate Domains, Inc. | 11 Feb 2015 | 12 Jan 2026 | 11 Feb 2027 |
| 474 | firefighterfriends.org | GoDaddy.com, LLC | 10 Feb 2015 | 5 Feb 2017 | 10 Feb 2018 |
| 475 | firefightingirish.com | eNom, Inc. | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 476 | firefighterlifeinsurance.com | GoDaddy.com, LLC | 12 Feb 2015 | 13 Feb 2026 | 12 Feb 2027 |
| 477 | firefighterdisabilityinsurance.com | GoDaddy.com, LLC | 12 Feb 2015 | 13 Feb 2026 | 12 Feb 2027 |
| 478 | firefighter-link.com | Network Solutions, LLC | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 479 | firefighteronestore.com | Tucows Domains Inc. | 11 Feb 2010 | 15 Feb 2015 | 11 Feb 2016 |
| 480 | firefightersconnect.com | Tucows Domains Inc. | 12 Feb 2012 | 16 Feb 2015 | 12 Feb 2016 |
| 481 | firefightertreeservice.com | GoDaddy.com, LLC | 29 May 2026 | 29 May 2026 | 29 May 2027 |
| 482 | firefighterwork.com | GoDaddy.com, LLC | 13 Jun 2020 | 24 Aug 2024 | 13 Jun 2024 |
| 483 | firefightertrainingfinder.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 484 | firefighterrecruiters.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 485 | firefighterappreciation365.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 486 | firefightersfootball.com | GoDaddy.com, LLC | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 487 | firefighter-1.com | 1&1 Internet AG | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 488 | firefighterappreciation365.net | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 489 | firefighterappreciation365.info | GoDaddy.com, LLC | 18 Feb 2015 | - | 18 Feb 2016 |
| 490 | firefighterssjc.com | Network Solutions, LLC | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 491 | firefighterretirement.com | TurnCommerce, Inc. DBA NameBright.com | 19 Feb 2015 | 12 Feb 2025 | 19 Feb 2027 |
| 492 | firefighterappreciation365.org | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 493 | firefighter-training.com | CloudFlare, Inc. | 4 Jan 2023 | 16 Dec 2025 | 4 Jan 2027 |
| 494 | firefightergutters.com | GoDaddy.com, LLC | 21 Feb 2015 | 21 Feb 2015 | 21 Feb 2018 |
| 495 | firefighterequipmentpr.com | NameCheap, Inc. | 19 Apr 2022 | 31 May 2023 | 19 Apr 2023 |
| 496 | firefightercharity.org | GoDaddy.com, LLC | 22 Aug 2016 | 23 Aug 2017 | 22 Aug 2018 |
| 497 | firefightersforhealing.com | Tucows Domains Inc. | 22 Feb 2015 | 7 Feb 2026 | 22 Feb 2027 |
| 498 | firefighterjakesleather.com | GoDaddy.com, LLC | 22 Feb 2015 | 22 Feb 2015 | 22 Feb 2016 |
| 499 | firefightersinsafetyeducation.com | GoDaddy.com, LLC | 23 Feb 2015 | 24 Feb 2026 | 23 Feb 2027 |
| 500 | firefighterdad.com | GoDaddy.com, LLC | 20 Apr 2021 | 25 Apr 2025 | 20 Apr 2027 |
| 501 | firefighterirons.com | Google, Inc. | 24 Feb 2015 | 9 Feb 2026 | 24 Feb 2027 |
| 502 | firefightersinsafetyeducation.org | GoDaddy.com, LLC | 23 Feb 2015 | 9 Apr 2026 | 23 Feb 2027 |
| 503 | firefightersrus.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 504 | firefighter365.com | Nom-iq Ltd. dba COM LAUDE | 26 Feb 2015 | 31 Jan 2026 | 26 Feb 2027 |
| 505 | firefighteryou.com | Network Solutions, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 506 | firefighterthrowdown.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 507 | firefightersfirstcreditunion.com | GoDaddy.com, LLC | 18 Feb 2019 | 1 Apr 2025 | 18 Feb 2025 |
| 508 | firefighterjournal.com | Gandi SAS | 1 Mar 2015 | 25 Jan 2026 | 1 Mar 2027 |
| 509 | firefightingtechniques.com | GoDaddy.com, LLC | 23 Aug 2015 | 24 Aug 2018 | 23 Aug 2019 |
| 510 | firefightingtechnique.com | GoDaddy.com, LLC | 23 Aug 2015 | 24 Aug 2018 | 23 Aug 2019 |
| 511 | firefightercoffeeguy.com | GoDaddy.com, LLC | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 512 | firefighterinterviewrulebook.com | GoDaddy.com, LLC | 3 Mar 2015 | 14 Apr 2026 | 3 Mar 2026 |
| 513 | firefighter-clothing.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Mar 2015 | 4 Mar 2025 | 4 Mar 2026 |
| 514 | firefighter-awards.com | GoDaddy.com, LLC | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 515 | firefightingsurferads.com | - | - | - | - |
| 516 | firefighterinterviewacademy.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 517 | firefighting.xyz | Namesilo, LLC | 25 Nov 2025 | 4 Feb 2026 | 25 Nov 2026 |
| 518 | firefighterrv.com | GoDaddy.com, LLC | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2016 |
| 519 | firefightetrealestaeguy.com | GoDaddy.com, LLC | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2016 |
| 520 | firefighterinterviewacademy.info | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 521 | firefighterinterviewacademy.net | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 522 | firefighterinterviewacademy.org | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 523 | firefighterdown.us | GoDaddy.com, LLC | 10 Mar 2015 | 10 Mar 2015 | 9 Mar 2016 |
| 524 | firefightersmall.com | Tucows Domains Inc. | 10 Mar 2014 | 14 Mar 2015 | 10 Mar 2016 |
| 525 | firefightingdevice.com | - | - | - | - |
| 526 | firefighterinsurance.com | TurnCommerce, Inc. DBA NameBright.com | 31 May 2016 | 5 Nov 2025 | 31 May 2026 |
| 527 | firefighterlovers.com | NameCheap, Inc. | 2 May 2023 | 3 May 2024 | 2 May 2025 |
| 528 | firefightersgoldclub.com | GoDaddy.com, LLC | 21 Mar 2015 | 21 Mar 2015 | 21 Mar 2018 |
| 529 | firefighterdudsforkids.com | GoDaddy.com, LLC | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 530 | firefightercameras.com | GoDaddy.com, LLC | 26 Aug 2015 | 6 Nov 2025 | 5 Nov 2026 |
| 531 | firefighterinterviewquestions.com | FastDomain Inc. | 21 Mar 2015 | 21 Mar 2015 | 21 Mar 2016 |
| 532 | firefightersurvey.com | Google, Inc. | 27 Aug 2021 | 8 Nov 2025 | 27 Aug 2025 |
| 533 | firefightercredentialingsystem.com | DomainPeople, Inc. | 23 Mar 2015 | 11 Feb 2016 | 23 Mar 2016 |
| 534 | firefighterrunbook.com | GoDaddy.com, LLC | 24 Mar 2015 | 24 Mar 2015 | 24 Mar 2017 |
| 535 | firefighterblogs.com | TurnCommerce, Inc. DBA NameBright.com | 25 Jul 2021 | 6 Oct 2024 | 25 Jul 2024 |
| 536 | firefighteraid.com | TurnCommerce, Inc. DBA NameBright.com | 11 May 2017 | 5 Nov 2025 | 11 May 2026 |
| 537 | firefighter-hq.com | Domain.com, LLC | 24 Mar 2015 | 24 Mar 2015 | 24 Mar 2016 |
| 538 | firefighterdj.com | GoDaddy.com, LLC | 25 Mar 2015 | 26 Mar 2026 | 25 Mar 2027 |
| 539 | firefighterservices.org | register.com, Inc. | 24 Mar 2015 | 24 Mar 2015 | 24 Mar 2016 |
| 540 | firefighteraid.net | FastDomain Inc. | 19 Feb 2011 | 25 Mar 2015 | 19 Feb 2016 |
| 541 | firefighterapps.com | GoDaddy.com, LLC | 8 Oct 2019 | 8 Oct 2019 | 8 Oct 2020 |
| 542 | firefightersforchristwsfc.org | Tucows Domains Inc. | 25 Feb 2010 | 1 Mar 2015 | 25 Feb 2016 |
| 543 | firefightersgroup.com | GoDaddy.com, LLC | 27 Mar 2015 | 8 May 2025 | 27 Mar 2025 |
| 544 | firefighterrealtor.com | GoDaddy.com, LLC | 26 Mar 2015 | 27 Mar 2026 | 26 Mar 2027 |
| 545 | firefightersgroup.org | GoDaddy.com, LLC | 27 Mar 2015 | 7 Jun 2025 | 27 Mar 2025 |
| 546 | firefightersgroup.net | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 547 | firefightergourmetfoods.com | Namesilo, LLC | 15 Jun 2016 | 15 Jun 2016 | 15 Jun 2017 |
| 548 | firefighterbunkerbags.com | Domain.com, LLC | 29 Mar 2015 | 14 Mar 2017 | 29 Mar 2018 |
| 549 | firefighterbunkerbag.com | Domain.com, LLC | 29 Mar 2015 | 14 Mar 2017 | 29 Mar 2018 |
| 550 | firefighterbag.com | Key-Systems GmbH | 7 Jan 2018 | 8 Jan 2026 | 7 Jan 2027 |
| 551 | firefightersunitedagainstcancer.org | GMO Internet Inc. | 28 Mar 2015 | - | 28 Mar 2016 |
| 552 | firefighterbags.net | Domain.com, LLC | 29 Mar 2015 | 29 Mar 2015 | 29 Mar 2016 |
| 553 | firefightertough.com | eNom, Inc. | 28 Aug 2015 | 28 Jul 2016 | 28 Aug 2018 |
| 554 | firefighterfunnies.com | GoDaddy.com, LLC | 28 Aug 2015 | 29 Aug 2025 | 28 Aug 2026 |
| 555 | firefightercareerzone.com | 1&1 Internet AG | 29 Aug 2015 | 29 Aug 2016 | 29 Aug 2017 |
| 556 | firefighterstudy.com | Wild West Domains, LLC | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2017 |
| 557 | firefightersbbq.com | Xin Net Technology Corporation | 22 Feb 2021 | 27 May 2021 | 22 Feb 2022 |
| 558 | firefighters-installrepair.com | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 559 | firefighterhealthandfitness.com | GoDaddy.com, LLC | 11 May 2019 | 11 May 2019 | 11 May 2020 |
| 560 | firefighterweddingrings.com | GoDaddy.com, LLC | 4 Apr 2015 | 4 Apr 2015 | 4 Apr 2016 |
| 561 | firefighterweddingring.com | GoDaddy.com, LLC | 4 Apr 2015 | 4 Apr 2015 | 4 Apr 2016 |
| 562 | firefighterhealthandfitness.net | - | 29 Jul 2016 | 29 Jul 2016 | 29 Jul 2017 |
| 563 | firefighterscoach.com | Key-Systems GmbH | 7 Apr 2015 | 6 Apr 2026 | 7 Apr 2027 |
| 564 | firefighterchampionships.com | Key-Systems GmbH | 8 Apr 2015 | 7 Apr 2026 | 8 Apr 2027 |
| 565 | firefighterinvestors.com | Wild West Domains, LLC | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2016 |
| 566 | firefightercalendar.org | GMO Internet Inc. | 1 Jul 2013 | 2 Jul 2017 | 1 Jul 2018 |
| 567 | firefighterequipmentstore.com | GoDaddy.com, LLC | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2017 |
| 568 | firefighterarmory.com | GoDaddy.com, LLC | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2017 |
| 569 | firefightersdrones.net | Gabia, Inc. | 30 Aug 2015 | 26 Jul 2017 | 30 Aug 2018 |
| 570 | firefightersdrones.com | Gabia, Inc. | 30 Aug 2015 | 27 Aug 2023 | 30 Aug 2026 |
| 571 | firefightersdrone.com | Gabia, Inc. | 30 Aug 2015 | 27 Aug 2023 | 30 Aug 2026 |
| 572 | firefights.org | GoDaddy.com, LLC | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2016 |
| 573 | firefights.net | Vautron Rechenzentrum AG | 6 Jan 2018 | 6 Jan 2018 | 6 Jan 2019 |
| 574 | firefights.info | GoDaddy.com, LLC | 2 Sep 2015 | - | 2 Sep 2016 |
| 575 | firefightingwaterdrone.com | GoDaddy.com, LLC | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2018 |
| 576 | firefighterlove.com | NameCheap, Inc. | 14 Aug 2025 | 14 Aug 2025 | 14 Aug 2026 |
| 577 | firefighterequipmentcompany.com | GoDaddy.com, LLC | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2017 |
| 578 | firefighterequipmentco.com | GoDaddy.com, LLC | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2017 |
| 579 | firefighterbrand.com | GoDaddy.com, LLC | 22 Feb 2023 | 4 Apr 2025 | 22 Feb 2025 |
| 580 | firefighteremt.net | Cloud Yuqu LLC | 26 Jun 2019 | 26 Jun 2019 | 26 Jun 2020 |
| 581 | firefighterhub.com | GoDaddy.com, LLC | 6 Sep 2020 | 7 Sep 2025 | 6 Sep 2026 |
| 582 | firefighting-gear.com | GoDaddy.com, LLC | 10 Apr 2015 | 11 Apr 2017 | 10 Apr 2018 |
| 583 | firefighterrealestate.com | GoDaddy.com, LLC | 14 Dec 2018 | 15 Dec 2025 | 14 Dec 2026 |
| 584 | firefightertrainingrequirements.com | FastDomain Inc. | 12 Apr 2015 | 12 Apr 2015 | 12 Apr 2016 |
| 585 | firefightersfinestmovers.com | Name.com, Inc. | 12 Apr 2015 | 12 Apr 2017 | 12 Apr 2018 |
| 586 | firefightersfinest.com | Name.com, Inc. | 12 Apr 2015 | 12 Apr 2017 | 12 Apr 2018 |
| 587 | firefighterbiz.com | GoDaddy.com, LLC | 5 Sep 2015 | 28 Jun 2025 | 5 Sep 2025 |
| 588 | firefighters457.com | GoDaddy.com, LLC | 15 Apr 2015 | 15 Apr 2015 | 15 Apr 2017 |
| 589 | firefighterclassroom.com | Tucows Domains Inc. | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2017 |
| 590 | firefighter-shop.com | 1&1 Internet AG | 16 Apr 2015 | 17 Apr 2017 | 16 Apr 2018 |
| 591 | firefighterbiz.us | GoDaddy.com, LLC | 5 Sep 2015 | 5 Sep 2016 | 4 Sep 2017 |
| 592 | firefightersweekend.com | Namesilo, LLC | 24 Sep 2018 | 4 Feb 2019 | 24 Sep 2019 |
| 593 | firefighterav.com | GoDaddy.com, LLC | 19 Apr 2015 | 19 Apr 2015 | 19 Apr 2016 |
| 594 | firefightingcloud.com | Net-Chinese Co., Ltd. | 19 Jul 2021 | 28 Aug 2024 | 19 Jul 2024 |
| 595 | firefightersmoving.net | DropCatch.com 692 LLC | 29 Mar 2022 | 9 May 2023 | 29 Mar 2023 |
| 596 | firefightertshirtsus.com | eName Technology Co., Ltd. | 25 Apr 2019 | 25 Apr 2019 | 25 Apr 2020 |
| 597 | firefighterrun.com | GoDaddy.com, LLC | 20 Apr 2015 | 20 Apr 2026 | 20 Apr 2027 |
| 598 | firefightercareercenter.com | 1&1 Internet AG | 20 Apr 2015 | 21 Apr 2017 | 20 Apr 2018 |
| 599 | firefightergear.org | GoDaddy.com, LLC | 23 Dec 2022 | 6 Feb 2026 | 23 Dec 2026 |
| 600 | firefighter-supporters-al.org | eNom, Inc. | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 601 | firefightersforwarren2016.com | GoDaddy.com, LLC | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2016 |
| 602 | firefightersforwarren16.com | GoDaddy.com, LLC | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2016 |
| 603 | firefightersforwarren.com | GoDaddy.com, LLC | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2016 |
| 604 | firefightersforhillaryclinton2016.com | GoDaddy.com, LLC | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2016 |
| 605 | firefightersforhillaryclinton16.com | GoDaddy.com, LLC | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2016 |
| 606 | firefightersforhillaryclinton.com | GoDaddy.com, LLC | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2016 |
| 607 | firefightersforelizabethwarren.com | - | - | - | - |
| 608 | firefightertshirtsus.net | 1&1 Internet AG | 26 Apr 2015 | 27 Apr 2016 | 26 Apr 2018 |
| 609 | firefightersdown.com | Network Solutions, LLC | 29 Dec 2023 | 12 Mar 2025 | 29 Dec 2024 |
| 610 | firefighterforgiveness.com | Moniker Online Services LLC | 21 Apr 2015 | 22 Apr 2015 | 21 Apr 2016 |
| 611 | firefighterwine.com | GoDaddy.com, LLC | 23 Apr 2015 | 24 Apr 2026 | 23 Apr 2027 |
| 612 | firefightersdown.org | GoDaddy.com, LLC | 22 Apr 2015 | 24 Apr 2017 | 22 Apr 2018 |
| 613 | firefighterwine.info | GoDaddy.com, LLC | 23 Apr 2015 | 24 Apr 2026 | 23 Apr 2027 |
| 614 | firefighterclix.com | GoDaddy.com, LLC | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 615 | firefighterwine.us | GoDaddy.com, LLC | 23 Apr 2015 | 7 Apr 2017 | 22 Apr 2018 |
| 616 | firefighterwine.org | GoDaddy.com, LLC | 23 Apr 2015 | 24 Apr 2026 | 23 Apr 2027 |
| 617 | firefighterwine.net | GoDaddy.com, LLC | 23 Apr 2015 | 24 Apr 2026 | 23 Apr 2027 |
| 618 | firefighterptsd.org | GoDaddy.com, LLC | 23 Apr 2015 | 24 Apr 2017 | 23 Apr 2019 |
| 619 | firefighterswithmatches.com | Domain.com, LLC | 27 Apr 2015 | 16 Apr 2017 | 27 Apr 2018 |
| 620 | firefighternutritionandwellness.com | GoDaddy.com, LLC | 26 Apr 2015 | 26 Apr 2015 | 26 Apr 2016 |
| 621 | firefighter5k.org | GoDaddy.com, LLC | 4 Nov 2016 | 16 Jul 2024 | 4 Nov 2026 |
| 622 | firefightingrobotics.com | Fabulous.com Pty Ltd. | 20 Apr 2013 | 21 Apr 2026 | 20 Apr 2027 |
| 623 | firefightingbots.com | GoDaddy.com, LLC | 29 Jan 2023 | 30 Jan 2026 | 29 Jan 2027 |
| 624 | firefightersforbush.com | GoDaddy.com, LLC | 10 Apr 2015 | 11 Apr 2026 | 10 Apr 2027 |
| 625 | firefighterhitchcovers.com | - | - | - | - |
| 626 | firefighteruas.com | GoDaddy.com, LLC | 6 Dec 2020 | 7 Dec 2025 | 6 Dec 2026 |
| 627 | firefightersuav.com | GoDaddy.com, LLC | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 628 | firefightersupportersal.org | GoDaddy.com, LLC | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 629 | firefightersinchefhats.com | Network Solutions, LLC | 25 Sep 2023 | 8 Dec 2024 | 25 Sep 2024 |
| 630 | firefighterfunding.com | GoDaddy.com, LLC | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2017 |
| 631 | firefightmods.com | Tucows Domains Inc. | 31 Jul 2017 | 4 Aug 2018 | 31 Jul 2018 |
| 632 | firefighterpreplan.com | Launchpad, Inc. | 1 May 2015 | 16 Apr 2026 | 1 May 2027 |
| 633 | firefighterfunding.net | GoDaddy.com, LLC | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2017 |
| 634 | firefighterhopefoundation.com | GoDaddy.com, LLC | 3 May 2015 | 3 May 2015 | 3 May 2016 |
| 635 | firefighterpf.com | FastDomain Inc. | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 636 | firefighterwishes.com | GoDaddy.com, LLC | 5 May 2015 | 5 May 2015 | 5 May 2017 |
| 637 | firefighter1369.com | Wild West Domains, LLC | 6 May 2015 | 6 May 2015 | 6 May 2017 |
| 638 | firefightertshirtsshop.com | Moniker Online Services LLC | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 639 | firefightercourse.com | Dynadot, LLC | 29 Apr 2022 | 30 Apr 2026 | 29 Apr 2027 |
| 640 | firefightertalk.com | GoDaddy.com, LLC | 12 May 2015 | 12 May 2026 | 12 May 2027 |
| 641 | firefighterchallengeseries.com | GoDaddy.com, LLC | 12 May 2015 | 12 May 2015 | 12 May 2016 |
| 642 | firefighterchallengeseries.info | GoDaddy.com, LLC | 12 May 2015 | - | 12 May 2016 |
| 643 | firefightertalk.us | GoDaddy.com, LLC | 12 May 2015 | 12 May 2017 | 11 May 2018 |
| 644 | firefighterchallengeseries.net | GoDaddy.com, LLC | 12 May 2015 | 12 May 2015 | 12 May 2016 |
| 645 | firefighternursecruise.com | GoDaddy.com, LLC | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 646 | firefighterhealthnetwork.com | GoDaddy.com, LLC | 24 Jun 2018 | 24 Jun 2018 | 24 Jun 2019 |
| 647 | firefighterhealthexchange.com | GoDaddy.com, LLC | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 648 | firefighterhealthandsafety.com | GoDaddy.com, LLC | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 649 | firefighterfinancialmiracle.com | GoDaddy.com, LLC | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 650 | firefighterfinancialfortress.com | GoDaddy.com, LLC | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 651 | firefighterassistanceprogram.com | GoDaddy.com, LLC | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 652 | firefighterfinancialmiracle.info | GoDaddy.com, LLC | 14 May 2015 | 15 May 2015 | 14 May 2016 |
| 653 | firefighterfinancialfortress.info | GoDaddy.com, LLC | 14 May 2015 | - | 14 May 2016 |
| 654 | firefightersummit.com | GoDaddy.com, LLC | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 655 | firefighterproud.com | TurnCommerce, Inc. DBA NameBright.com | 29 Oct 2023 | 23 Oct 2024 | 29 Oct 2026 |
| 656 | firefighterfinancialmiracle.net | GoDaddy.com, LLC | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 657 | firefighterfinancialfortress.org | GoDaddy.com, LLC | 14 May 2015 | 15 May 2015 | 14 May 2016 |
| 658 | firefighterfinancialfortress.net | GoDaddy.com, LLC | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 659 | firefighterproud.info | GoDaddy.com, LLC | 15 May 2015 | 26 Jun 2017 | 15 May 2018 |
| 660 | firefighterproud.us | GoDaddy.com, LLC | 15 May 2015 | 25 Jun 2017 | 14 May 2017 |
| 661 | firefighterproud.org | GoDaddy.com, LLC | 15 May 2015 | 26 Jun 2017 | 15 May 2018 |
| 662 | firefighterproud.net | GoDaddy.com, LLC | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 663 | firefighterrighttoknow.com | GoDaddy.com, LLC | 18 May 2015 | 18 May 2015 | 18 May 2016 |
| 664 | firefightervacations.com | GoDaddy.com, LLC | 19 May 2015 | 19 May 2015 | 19 May 2016 |
| 665 | firefightertag.com | Dynadot, LLC | 25 Oct 2018 | 25 Oct 2018 | 25 Oct 2019 |
| 666 | firefightingsummit.com | GoDaddy.com, LLC | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 667 | firefightingfitness.com | Tucows Domains Inc. | 21 May 2015 | 1 Jul 2023 | 21 May 2023 |
| 668 | firefightersface.com | Domainsofvalue.com LLC | 13 Sep 2015 | 16 Sep 2016 | 13 Sep 2017 |
| 669 | firefighterlife.com | GoDaddy.com, LLC | 11 Aug 2016 | 29 Jun 2023 | 11 Aug 2026 |
| 670 | firefighter1recruitmentcenter.com | Tucows Domains Inc. | 21 May 2014 | 25 May 2015 | 21 May 2016 |
| 671 | firefighting20th.com | eNom, Inc. | 25 May 2015 | 7 Jul 2017 | 25 May 2017 |
| 672 | firefighters4life.com | Mesh Digital Limited | 25 May 2015 | 25 May 2015 | 25 May 2016 |
| 673 | firefightercollab.com | GoDaddy.com, LLC | 26 May 2015 | 26 May 2015 | 26 May 2016 |
| 674 | firefighterbridgeloans.com | GoDaddy.com, LLC | 26 May 2015 | 26 May 2015 | 26 May 2016 |
| 675 | firefighterfasions.com | GoDaddy.com, LLC | 27 May 2015 | 27 May 2015 | 27 May 2017 |
| 676 | firefighterfasions.biz | GoDaddy.com, LLC | 27 May 2015 | 12 Aug 2016 | 26 May 2017 |
| 677 | firefighterfasions.info | GoDaddy.com, LLC | 27 May 2015 | 8 Jul 2017 | 27 May 2018 |
| 678 | firefighterfunding.biz | GoDaddy.com, LLC | 28 May 2015 | 11 Aug 2016 | 27 May 2017 |
| 679 | firefighterfasions.org | GoDaddy.com, LLC | 27 May 2015 | 8 Jul 2017 | 27 May 2018 |
| 680 | firefighterfasions.net | GoDaddy.com, LLC | 27 May 2015 | 27 May 2015 | 27 May 2017 |
| 681 | firefighterfasions.mobi | GoDaddy.com, LLC | 27 May 2015 | 8 Jul 2017 | 27 May 2018 |
| 682 | firefighterfunding.info | GoDaddy.com, LLC | 28 May 2015 | 9 Jul 2017 | 28 May 2018 |
| 683 | firefighterfunding.org | GoDaddy.com, LLC | 28 May 2015 | 9 Jul 2017 | 28 May 2018 |
| 684 | firefighterassessments.com | FastDomain Inc. | 31 May 2015 | 18 May 2017 | 31 May 2018 |
| 685 | firefighterlegion.com | Network Solutions, LLC | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2016 |
| 686 | firefightering.com | Fabulous.com Pty Ltd. | 2 May 2005 | 2 May 2005 | 2 May 2017 |
| 687 | firefightercourses.com | TurnCommerce, Inc. DBA NameBright.com | 7 Nov 2017 | 5 Nov 2025 | 7 Nov 2026 |
| 688 | firefightertshirtsonline.net | Melbourne IT, Ltd | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 689 | firefightergames.org | Namesilo, LLC | 4 Jun 2015 | 19 Jul 2025 | 4 Jun 2026 |
| 690 | firefightingutilities.com | GoDaddy.com, LLC | 6 Jun 2015 | 7 Jun 2015 | 6 Jun 2016 |
| 691 | firefighterhthrowdownusa.com | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 692 | firefighterball.com | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 693 | firefighterssurvivealive.org | Google, Inc. | 9 Jun 2015 | 17 Dec 2025 | 9 Jun 2026 |
| 694 | firefightermemorialcrosses.com | GoDaddy.com, LLC | 12 Jun 2015 | 9 Jun 2016 | 12 Jun 2018 |
| 695 | firefighterbootcamp.info | GoDaddy.com, LLC | 13 Jun 2015 | - | 13 Jun 2016 |
| 696 | firefightertrainingvr.com | NameCheap, Inc. | 13 Jun 2015 | 9 Jan 2018 | 13 Jun 2018 |
| 697 | firefightersingle.com | NameCheap, Inc. | 13 Jun 2015 | 14 May 2025 | 13 Jun 2026 |
| 698 | firefightersforsanders.com | GoDaddy.com, LLC | 14 Jun 2015 | 25 Aug 2024 | 14 Jun 2024 |
| 699 | firefightersforhooters.com | Tucows Domains Inc. | 10 Jun 2010 | 14 Jun 2015 | 10 Jun 2016 |
| 700 | firefightersmemorial.org | 1&1 Internet AG | 18 Sep 2015 | 19 Sep 2016 | 18 Sep 2017 |
| 701 | firefighterpodcast.com | Tucows Domains Inc. | 25 Dec 2025 | 25 Dec 2025 | 25 Dec 2026 |
| 702 | firefighterforums.com | GoDaddy.com, LLC | 18 Sep 2015 | 18 Sep 2015 | 18 Sep 2017 |
| 703 | firefighterbootcamp.org | GoDaddy.com, LLC | 14 Jun 2022 | 11 May 2026 | 14 Jun 2027 |
| 704 | firefighterbootcamp.net | - | - | - | - |
| 705 | firefightersmallbusinessloans.com | GoDaddy.com, LLC | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 706 | firefighterbusinessloans.com | GoDaddy.com, LLC | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 707 | firefightersleathergear.com | PSI-USA, Inc. dba Domain Robot | 20 Sep 2015 | 30 Nov 2016 | 20 Sep 2017 |
| 708 | firefighternation.online | Nom-iq Ltd. dba COM LAUDE | 18 Sep 2015 | 27 Aug 2025 | 18 Sep 2026 |
| 709 | firefightermichelle.com | Hebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.… | 21 Sep 2015 | 21 Sep 2015 | 21 Sep 2016 |
| 710 | firefighter.info | Key-Systems GmbH | 21 Sep 2015 | 29 Nov 2025 | 21 Sep 2026 |
| 711 | firefighter-school.com | - | - | - | - |
| 712 | firefightersforwalker.com | Network Solutions, LLC | 22 Jun 2015 | 7 Jun 2017 | 22 Jun 2018 |
| 713 | firefightersforrubio.com | Network Solutions, LLC | 22 Jun 2015 | 7 Jun 2017 | 22 Jun 2018 |
| 714 | firefightersformarcorubio.com | Network Solutions, LLC | 22 Jun 2015 | 7 Jun 2017 | 22 Jun 2018 |
| 715 | firefightersforjebbush.com | Network Solutions, LLC | 22 Jun 2015 | 7 Jun 2017 | 22 Jun 2018 |
| 716 | firefightersforclinton.com | Network Solutions, LLC | 22 Jun 2015 | 7 Jun 2017 | 22 Jun 2018 |
| 717 | firefightapparel.com | Google, Inc. | 28 Sep 2017 | 28 Sep 2017 | 28 Sep 2018 |
| 718 | firefightercamp.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 719 | firefightersforwalker.org | Network Solutions, LLC | 23 Jun 2015 | 24 Apr 2017 | 23 Jun 2019 |
| 720 | firefightersforwalker.net | Network Solutions, LLC | 23 Jun 2015 | 24 Apr 2017 | 23 Jun 2019 |
| 721 | firefightersforrubio.org | Network Solutions, LLC | 23 Jun 2015 | 24 Apr 2017 | 23 Jun 2019 |
| 722 | firefightersforrubio.net | Network Solutions, LLC | 23 Jun 2015 | 24 Apr 2017 | 23 Jun 2019 |
| 723 | firefightersformarcorubio.org | Network Solutions, LLC | 23 Jun 2015 | 24 Apr 2017 | 23 Jun 2019 |
| 724 | firefightersformarcorubio.net | Network Solutions, LLC | 23 Jun 2015 | 24 Apr 2017 | 23 Jun 2019 |
| 725 | firefightersforjebbush.org | Network Solutions, LLC | 23 Jun 2015 | 24 Apr 2017 | 23 Jun 2019 |
| 726 | firefightersforjebbush.net | Network Solutions, LLC | 23 Jun 2015 | 24 Apr 2017 | 23 Jun 2019 |
| 727 | firefightersforclinton.org | Network Solutions, LLC | 23 Jun 2015 | 24 Apr 2017 | 23 Jun 2019 |
| 728 | firefightersforclinton.net | Network Solutions, LLC | 23 Jun 2015 | 24 Apr 2017 | 23 Jun 2019 |
| 729 | firefighterssavelives.com | GoDaddy.com, LLC | 22 Sep 2015 | 22 Sep 2015 | 22 Sep 2018 |
| 730 | firefighterslawncare.com | GoDaddy.com, LLC | 21 May 2024 | 21 May 2024 | 21 May 2027 |
| 731 | firefightingprojects.com | Wild West Domains, LLC | 26 Jun 2015 | 26 Jun 2015 | 26 Jun 2018 |
| 732 | firefightersmortgage.com | Tucows Domains Inc. | 23 Jun 2003 | 26 Jun 2025 | 23 Jun 2026 |
| 733 | firefightersoapbox.com | GoDaddy.com, LLC | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 734 | firefightersoapbox.net | GoDaddy.com, LLC | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 735 | firefighterfamilymoving.com | Tucows Domains Inc. | 23 Sep 2015 | 27 Sep 2017 | 23 Sep 2017 |
| 736 | firefightersoapbox.us | GoDaddy.com, LLC | 29 Jun 2015 | 10 Jul 2017 | 28 Jun 2017 |
| 737 | firefightingsprayers.com | Annulet LLC | 18 Sep 2022 | 29 Sep 2025 | 18 Sep 2025 |
| 738 | firefightingsprayer.com | Annulet LLC | 18 Sep 2022 | 19 Sep 2025 | 18 Sep 2026 |
| 739 | firefighterpatchclub.com | GoDaddy.com, LLC | 3 Jul 2015 | 4 Jul 2025 | 3 Jul 2026 |
| 740 | firefighterlivesmatter.com | Epik Inc. | 1 Oct 2016 | 12 Nov 2017 | 1 Oct 2017 |
| 741 | firefightersfrightfest.com | GoDaddy.com, LLC | 24 Sep 2015 | 24 Sep 2015 | 24 Sep 2017 |
| 742 | firefighterlivesmatter.net | GoDaddy.com, LLC | 3 Jul 2015 | 3 Jul 2015 | 3 Jul 2016 |
| 743 | firefighterlivesmatter.info | GoDaddy.com, LLC | 3 Jul 2015 | - | 3 Jul 2016 |
| 744 | firefighterricipes.com | Domain.com, LLC | 4 Jul 2015 | 24 Jun 2025 | 4 Jul 2026 |
| 745 | firefighterlivesmatter.org | GoDaddy.com, LLC | 3 Jul 2015 | 3 Jul 2015 | 3 Jul 2016 |
| 746 | firefighterricipes.org | Domain.com, LLC | 4 Jul 2015 | 24 Jun 2025 | 4 Jul 2026 |
| 747 | firefighterricipes.info | Domain.com, LLC | 4 Jul 2015 | 14 Jun 2025 | 4 Jul 2026 |
| 748 | firefightercollege.com | GoDaddy.com, LLC | 24 Nov 2024 | 23 Nov 2025 | 24 Nov 2026 |
| 749 | firefighterfunctionalfitness.com | Launchpad, Inc. | 25 Sep 2015 | 10 Sep 2025 | 25 Sep 2026 |
| 750 | firefighting-community.com | GoDaddy.com, LLC | 9 Jul 2015 | 9 Jul 2015 | 9 Jul 2016 |
| 751 | firefighterresponse.com | GoDaddy.com, LLC | 9 Oct 2020 | 10 Oct 2025 | 9 Oct 2026 |
| 752 | firefightergamer.com | FastDomain Inc. | 10 Jul 2015 | 10 Jul 2015 | 10 Jul 2016 |
| 753 | firefighterfitness.org | Network Solutions, LLC | 25 Feb 2020 | 9 May 2026 | 25 Feb 2026 |
| 754 | firefighterstohire.com | GoDaddy.com, LLC | 26 Sep 2015 | 8 Dec 2024 | 26 Sep 2024 |
| 755 | firefighterscard.com | GoDaddy.com, LLC | 26 Sep 2015 | 26 Sep 2015 | 26 Sep 2017 |
| 756 | firefighterinstitute.com | - | 4 Oct 2016 | 4 Oct 2016 | 4 Oct 2017 |
| 757 | firefighterbackexercises.com | GoDaddy.com, LLC | 14 Jul 2015 | 15 Jul 2025 | 14 Jul 2026 |
| 758 | firefightersoflanecounty.com | Tucows Domains Inc. | 12 Jul 2012 | 16 Jul 2015 | 12 Jul 2016 |
| 759 | firefightersrewards.com | GoDaddy.com, LLC | 16 Jul 2015 | 16 Jul 2015 | 16 Jul 2016 |
| 760 | firefighterjobsflorida.com | GoDaddy.com, LLC | 16 Jul 2015 | 16 Jul 2015 | 16 Jul 2016 |
| 761 | firefightersong.net | NameCheap, Inc. | 15 Jul 2015 | 15 Jun 2025 | 15 Jul 2026 |
| 762 | firefightersshop.com | Annulet LLC | 21 Dec 2022 | 27 Dec 2025 | 21 Dec 2026 |
| 763 | firefighterssavepets.org | GoDaddy.com, LLC | 28 Sep 2015 | 29 Sep 2016 | 28 Sep 2017 |
| 764 | firefighterssavepets.net | GoDaddy.com, LLC | 28 Sep 2015 | 28 Sep 2015 | 28 Sep 2016 |
| 765 | firefighterssavepets.info | GoDaddy.com, LLC | 28 Sep 2015 | 29 Sep 2016 | 28 Sep 2017 |
| 766 | firefightershelp.com | - | 7 Oct 2025 | 7 Apr 2026 | 7 Oct 2026 |
| 767 | firefighterpassalarms.com | GoDaddy.com, LLC | 22 Jul 2015 | 22 Jul 2015 | 22 Jul 2016 |
| 768 | firefightercareer.com | NameKing.com Inc. | 23 Jul 2015 | 24 Jul 2025 | 23 Jul 2026 |
| 769 | firefighterswivesclub.com | DNC Holdings, Inc. | 30 Sep 2015 | 31 Jul 2017 | 30 Sep 2018 |
| 770 | firefightersrule.com | GoDaddy.com, LLC | 18 May 2025 | 18 May 2025 | 18 May 2028 |
| 771 | firefighterfunds.org | GoDaddy.com, LLC | 20 Oct 2017 | 20 Oct 2017 | 20 Oct 2018 |
| 772 | firefightermath.com | GoDaddy.com, LLC | 28 Nov 2020 | 28 Nov 2020 | 28 Nov 2021 |
| 773 | firefighte941.com | GMO Internet Inc. | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 774 | firefightersrock.net | - | - | - | - |
| 775 | firefightersppe.com | GoDaddy.com, LLC | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 776 | firefightersweden.com | Realtime Register B.V. | 30 Sep 2015 | 12 Dec 2024 | 30 Sep 2024 |
| 777 | firefighterclosecalls.net | GoDaddy.com, LLC | 30 Sep 2015 | 1 Oct 2025 | 30 Sep 2026 |
| 778 | firefightersnationals.com | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 779 | firefightersnational.com | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 780 | firefightersforyouth.com | GoDaddy.com, LLC | 28 Jul 2015 | 9 Oct 2025 | 28 Jul 2025 |
| 781 | firefightersfederal.com | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jan 2026 | 28 Jul 2026 |
| 782 | firefighterdrills.com | 1API GmbH | 7 Jan 2020 | 7 Jan 2020 | 7 Jan 2021 |
| 783 | firefighterdetox.com | Moniker Online Services LLC | 12 Feb 2018 | 12 Feb 2026 | 12 Feb 2027 |
| 784 | firefightersfederal.info | GoDaddy.com, LLC | 28 Jul 2015 | 30 May 2017 | 28 Jul 2018 |
| 785 | firefightersforkyani.com | GoDaddy.com, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 786 | firefighters4kyani.com | GoDaddy.com, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 787 | firefightersnationals.org | GoDaddy.com, LLC | 28 Jul 2015 | 29 Jul 2017 | 28 Jul 2018 |
| 788 | firefightersnational.org | GoDaddy.com, LLC | 28 Jul 2015 | 30 May 2017 | 28 Jul 2018 |
| 789 | firefightersnational.net | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 790 | firefightersforlife.org | GoDaddy.com, LLC | 14 Oct 2016 | 14 Dec 2016 | 14 Oct 2018 |
| 791 | firefightersfederal.org | GoDaddy.com, LLC | 28 Jul 2015 | 30 May 2017 | 28 Jul 2018 |
| 792 | firefightersfederal.net | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 793 | firefighterfitness.net | GoDaddy.com, LLC | 28 Jul 2015 | 29 Jul 2025 | 28 Jul 2026 |
| 794 | firefighterssupportbreastcancer.com | Google, Inc. | 30 Jul 2015 | 5 Dec 2016 | 30 Jul 2017 |
| 795 | firefighterskitchen.com | Domain.com, LLC | 30 Jul 2015 | 30 Jul 2015 | 30 Jul 2016 |
| 796 | firefightercalendar.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Mar 2020 | 22 Apr 2025 | 11 Mar 2025 |
| 797 | firefighterdrivertraining.com | 1&1 Internet AG | 1 Aug 2015 | 11 Aug 2025 | 1 Aug 2026 |
| 798 | firefightersite.com | Go France Domains, LLC | 28 Jan 2018 | 11 Apr 2026 | 28 Jan 2026 |
| 799 | firefightertshirt.org | GoDaddy.com, LLC | 1 Aug 2015 | 9 Jul 2016 | 1 Aug 2019 |
| 800 | firefightingvehicles.com | Tucows Domains Inc. | 2 Aug 2013 | 7 Aug 2018 | 2 Aug 2028 |
| 801 | firefightertcfd.com | - | 4 Aug 2015 | 4 Aug 2015 | 4 Aug 2017 |
| 802 | firefightertrainingplans.com | Domain.com, LLC | 4 Aug 2015 | 4 Aug 2015 | 4 Aug 2016 |
| 803 | firefightersgopink.com | Google, Inc. | 4 Aug 2015 | 4 Aug 2015 | 4 Aug 2016 |
| 804 | firefightertoolstore.com | 1&1 Internet AG | 6 Aug 2015 | 6 Aug 2015 | 6 Aug 2016 |
| 805 | firefighteroriginals.com | GoDaddy.com, LLC | 5 Aug 2015 | 6 Aug 2025 | 5 Aug 2027 |
| 806 | firefighterfitnessdepot.com | GoDaddy.com, LLC | 5 Aug 2015 | 5 Aug 2015 | 5 Aug 2016 |
| 807 | firefightersinterviewcoach.com | GoDaddy.com, LLC | 7 Aug 2015 | 7 Aug 2015 | 7 Aug 2016 |
| 808 | firefight365.info | GoDaddy.com, LLC | 6 Aug 2015 | - | 6 Aug 2016 |
| 809 | firefighterhelmetliners.com | eNom, Inc. | 3 Oct 2015 | 3 Oct 2015 | 3 Oct 2016 |
| 810 | firefighterswithmatches.org | Wild West Domains, LLC | 7 Aug 2015 | 7 Jul 2016 | 7 Aug 2017 |
| 811 | firefighterhomeinspections.com | GoDaddy.com, LLC | 10 Aug 2015 | 23 Aug 2025 | 10 Aug 2026 |
| 812 | firefighterabdomen.xyz | GMO Internet Inc. | 5 Oct 2015 | - | 5 Oct 2016 |
| 813 | firefightersforjoebiden.org | Network Solutions, LLC | 7 Oct 2015 | 19 Nov 2025 | 7 Oct 2025 |
| 814 | firefightersforjoebiden.net | Network Solutions, LLC | 7 Oct 2015 | 19 Nov 2025 | 7 Oct 2025 |
| 815 | firefightersforjoebiden.com | Network Solutions, LLC | 7 Oct 2015 | 19 Nov 2025 | 7 Oct 2025 |
| 816 | firefightersforjoe.org | Network Solutions, LLC | 7 Oct 2015 | 19 Nov 2025 | 7 Oct 2025 |
| 817 | firefightersforjoe.net | Network Solutions, LLC | 7 Oct 2015 | 19 Nov 2025 | 7 Oct 2025 |
| 818 | firefightersforjoe.com | Network Solutions, LLC | 7 Oct 2015 | 19 Nov 2025 | 7 Oct 2025 |
| 819 | firefightersforbiden.net | Network Solutions, LLC | 9 Jan 2019 | 10 Nov 2024 | 9 Jan 2027 |
| 820 | firefighterbrewerycompany.org | GoDaddy.com, LLC | 7 Oct 2015 | 28 Mar 2017 | 7 Oct 2017 |
| 821 | firefighterbrewerycompany.net | GoDaddy.com, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 822 | firefighterbrewerycompany.info | GoDaddy.com, LLC | 7 Oct 2015 | - | 7 Oct 2016 |
| 823 | firefighterbrewerycompany.com | GoDaddy.com, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 824 | firefighter.top | Dynadot, LLC | 27 Feb 2022 | 9 Apr 2023 | 27 Feb 2023 |
| 825 | firefighternomad.com | FastDomain Inc. | 9 Oct 2015 | 9 Oct 2016 | 9 Oct 2017 |
| 826 | firefighterspeaker.com | GoDaddy.com, LLC | 9 Oct 2015 | 9 Oct 2015 | 9 Oct 2016 |
| 827 | firefighterjobsapply.com | - | 9 Oct 2015 | 9 Oct 2015 | 9 Oct 2017 |
| 828 | firefighterfriendly.com | GoDaddy.com, LLC | 9 Oct 2015 | 9 Oct 2015 | 9 Oct 2016 |
| 829 | firefightercmeras.com | register.com, Inc. | 10 Oct 2015 | 10 Oct 2015 | 10 Oct 2016 |
| 830 | firefightersgala.com | GoDaddy.com, LLC | 10 Oct 2015 | 10 Oct 2015 | 10 Oct 2016 |
| 831 | firefighterdateapp.com | GoDaddy.com, LLC | 12 Oct 2015 | 12 Oct 2015 | 12 Oct 2017 |
| 832 | firefightertested.com | GoDaddy.com, LLC | 13 Oct 2015 | 13 Oct 2015 | 13 Oct 2017 |
| 833 | firefighterschristmastrees.com | GoDaddy.com, LLC | 13 Oct 2015 | 19 Sep 2022 | 13 Oct 2026 |
| 834 | firefightingfoamsupply.com | eNom, Inc. | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2016 |
| 835 | firefightingfoampros.com | eNom, Inc. | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2016 |
| 836 | firefighterssupplyoutlet.com | Above.com Pty Ltd. | 2 Jan 2019 | 19 Dec 2025 | 2 Jan 2027 |
| 837 | firefighters.feedback | Reserved for non-billable transactions where Regis… | 15 Oct 2015 | 30 Nov 2025 | 15 Oct 2026 |
| 838 | firefighter.feedback | Reserved for non-billable transactions where Regis… | 15 Oct 2015 | 30 Nov 2025 | 15 Oct 2026 |
| 839 | firefightersutopia.com | GoDaddy.com, LLC | 16 Oct 2015 | 16 Oct 2015 | 16 Oct 2016 |
| 840 | firefighterlimited.xyz | NameCheap, Inc. | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2016 |
| 841 | firefightingpros.com | eNom, Inc. | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2016 |
| 842 | firefightersventing.com | - | - | - | - |
| 843 | firefighterpensionlawyer.org | GoDaddy.com, LLC | 20 Oct 2015 | 4 Dec 2025 | 20 Oct 2026 |
| 844 | firefighterpensionlawyer.net | GoDaddy.com, LLC | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2016 |
| 845 | firefighterpensionlawyer.info | GoDaddy.com, LLC | 20 Oct 2015 | - | 20 Oct 2016 |
| 846 | firefighterpensionlawyer.com | GoDaddy.com, LLC | 20 Oct 2015 | 21 Oct 2025 | 20 Oct 2026 |
| 847 | firefighterdivorcelawyer.org | GoDaddy.com, LLC | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2016 |
| 848 | firefighterdivorcelawyer.net | GoDaddy.com, LLC | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2016 |
| 849 | firefighterdivorcelawyer.info | GoDaddy.com, LLC | 20 Oct 2015 | - | 20 Oct 2016 |
| 850 | firefighterdivorcelawyer.com | GoDaddy.com, LLC | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2016 |
| 851 | firefighterwipe.com | GoDaddy.com, LLC | 22 Oct 2015 | 20 Aug 2025 | 19 Aug 2027 |
| 852 | firefighterdecon.com | GoDaddy.com, LLC | 22 Oct 2015 | 20 Aug 2025 | 19 Aug 2027 |
| 853 | firefightersbeingbetter.com | GoDaddy.com, LLC | 22 Oct 2015 | 22 Oct 2015 | 22 Oct 2016 |
| 854 | firefightersmatter.com | GoDaddy.com, LLC | 24 Oct 2015 | 24 Oct 2025 | 24 Oct 2027 |
| 855 | firefighterslivesmatter.com | GoDaddy.com, LLC | 24 Oct 2015 | 24 Oct 2025 | 24 Oct 2027 |
| 856 | firefightercancer.org | GoDaddy.com, LLC | 23 Oct 2015 | 7 Dec 2025 | 23 Oct 2026 |
| 857 | firefightercancer.com | GoDaddy.com, LLC | 23 Oct 2015 | 24 Oct 2025 | 23 Oct 2026 |
| 858 | firefighterassistant.com | GoDaddy.com, LLC | 24 Oct 2015 | 25 Oct 2025 | 24 Oct 2027 |
| 859 | firefightersgym.com | DropCatch.com 519 LLC | 25 Oct 2015 | 26 Oct 2016 | 25 Oct 2017 |
| 860 | firefightersenergy.com | DNC Holdings, Inc. | 25 Oct 2015 | 25 Oct 2015 | 25 Oct 2016 |
| 861 | firefightersforums.com | Name.com, Inc. | 8 Nov 2022 | 22 Jan 2025 | 8 Nov 2024 |
| 862 | firefightermortgagesreviews.com | GoDaddy.com, LLC | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 863 | firefightermortgagereviews.com | GoDaddy.com, LLC | 17 Jan 2020 | 17 Jan 2026 | 17 Jan 2027 |
| 864 | firefighterfrightfest.com | GoDaddy.com, LLC | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 865 | firefighterco.com | Annulet LLC | 16 Jan 2017 | 1 Jan 2026 | 16 Jan 2027 |
| 866 | firefighterchallengeeurope.net | GoDaddy.com, LLC | 29 Oct 2015 | 29 Oct 2015 | 29 Oct 2016 |
| 867 | firefighterchallengeeurope.com | GoDaddy.com, LLC | 29 Oct 2015 | 29 Oct 2015 | 29 Oct 2016 |
| 868 | firefighterchallenge.us | GoDaddy.com, LLC | 29 Oct 2015 | 29 Oct 2015 | 28 Oct 2016 |
| 869 | firefighterchallenge.net | GoDaddy.com, LLC | 29 Oct 2015 | 29 Oct 2015 | 29 Oct 2016 |
| 870 | firefighterchallenge.info | GoDaddy.com, LLC | 29 Oct 2015 | - | 29 Oct 2016 |
| 871 | firefighterchallenge.guru | GoDaddy.com, LLC | 29 Oct 2015 | 29 Oct 2015 | 29 Oct 2016 |
| 872 | firefighterangel.org | GoDaddy.com, LLC | 30 Oct 2015 | 21 Jul 2024 | 30 Oct 2026 |
| 873 | firefighters.work | GoDaddy.com, LLC | 2 Nov 2015 | 2 Nov 2015 | 2 Nov 2016 |
| 874 | firefighterwebsites.org | eNom, Inc. | 2 Nov 2015 | 2 Nov 2015 | 2 Nov 2016 |
| 875 | firefightersprotectionplan.com | Domain.com, LLC | 2 Nov 2015 | 19 Oct 2025 | 2 Nov 2026 |
| 876 | firefightersupplystore.com | GoDaddy.com, LLC | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 877 | firefighterscomp.com | NameCheap, Inc. | 3 Nov 2015 | 4 Nov 2025 | 3 Nov 2026 |
| 878 | firefighterlocker.com | NameCheap, Inc. | 7 Aug 2025 | 7 Aug 2025 | 7 Aug 2026 |
| 879 | firefighterinterviewtips.com | GoDaddy.com, LLC | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 880 | firefighterinterviewsecrets.com | GoDaddy.com, LLC | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 881 | firefightergoods.com | Google, Inc. | 9 Jul 2018 | 24 Jun 2025 | 9 Jul 2026 |
| 882 | firefightergearsupply.com | GoDaddy.com, LLC | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 883 | firefightercontests.com | GoDaddy.com, LLC | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 884 | firefightercontest.com | GoDaddy.com, LLC | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 885 | firefighter.rocks | Key-Systems GmbH | 25 Aug 2018 | 27 Nov 2025 | 25 Aug 2026 |
| 886 | firefightersofwashington.org | GoDaddy.com, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 887 | firefightersofwashington.com | GoDaddy.com, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 888 | firefighterplus.info | Network Solutions, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 889 | firefighteronvacation.com | Godomaingo.com LLC | 23 Jan 2020 | 24 Jan 2020 | 23 Jan 2021 |
| 890 | firefightercelebration.com | GoDaddy.com, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 891 | firefighter-fitness.com | Wix.com Ltd. | 26 Feb 2021 | 6 Feb 2025 | 26 Feb 2027 |
| 892 | firefightersofwashington.net | GoDaddy.com, LLC | 7 Nov 2015 | 7 Nov 2015 | 7 Nov 2016 |
| 893 | firefighterstopcompetition.com | Google, Inc. | 6 Nov 2015 | 6 Nov 2015 | 6 Nov 2016 |
| 894 | firefighterreview.com | GoDaddy.com, LLC | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 895 | firefightersdown.net | GoDaddy.com, LLC | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2016 |
| 896 | firefightersdown.mobi | GoDaddy.com, LLC | 11 Nov 2015 | 12 Nov 2016 | 11 Nov 2017 |
| 897 | firefightersdown.info | GoDaddy.com, LLC | 11 Nov 2015 | 12 Nov 2016 | 11 Nov 2017 |
| 898 | firefightersdown.biz | GoDaddy.com, LLC | 11 Nov 2015 | 11 Nov 2016 | 10 Nov 2017 |
| 899 | firefighterme.org | GoDaddy.com, LLC | 10 Nov 2015 | 11 Nov 2016 | 10 Nov 2017 |
| 900 | firefighterme.net | GoDaddy.com, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 901 | firefighterme.info | GoDaddy.com, LLC | 10 Nov 2015 | 11 Nov 2016 | 10 Nov 2017 |
| 902 | firefighterme.com | TurnCommerce, Inc. DBA NameBright.com | 28 Jan 2022 | 9 Apr 2024 | 28 Jan 2024 |
| 903 | firefighterdown.net | GoDaddy.com, LLC | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2016 |
| 904 | firefighterdown.mobi | GoDaddy.com, LLC | 11 Nov 2015 | 12 Nov 2016 | 11 Nov 2017 |
| 905 | firefighterdown.info | GoDaddy.com, LLC | 11 Nov 2015 | 12 Nov 2016 | 11 Nov 2017 |
| 906 | firefighterdown.biz | GoDaddy.com, LLC | 11 Nov 2015 | 20 Nov 2017 | 10 Nov 2018 |
| 907 | firefightersdown.work | GoDaddy.com, LLC | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2016 |
| 908 | firefightersdown.us | GoDaddy.com, LLC | 11 Nov 2015 | 11 Nov 2015 | 10 Nov 2020 |
| 909 | firefighterdown.org | GoDaddy.com, LLC | 11 Nov 2015 | 12 Nov 2016 | 11 Nov 2017 |
| 910 | firefightercharities.net | GoDaddy.com, LLC | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 911 | firefightermortgageacademy.com | GoDaddy.com, LLC | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 912 | firefighter.fit | GoDaddy.com, LLC | 11 Nov 2015 | 17 Nov 2025 | 11 Nov 2026 |
| 913 | firefighterconnections.com | GoDaddy.com, LLC | 16 Nov 2015 | 16 Nov 2015 | 16 Nov 2016 |
| 914 | firefighterlawnetwork.com | GoDaddy.com, LLC | 18 Nov 2015 | 19 Nov 2025 | 18 Nov 2026 |
| 915 | firefightershub.com | GoDaddy.com, LLC | 13 Nov 2022 | 25 Dec 2024 | 13 Nov 2024 |
| 916 | firefighterlounge.com | GoDaddy.com, LLC | 19 Nov 2015 | 19 Nov 2015 | 19 Nov 2016 |
| 917 | firefightergiftideas.com | FastDomain Inc. | 19 Nov 2015 | 19 Nov 2016 | 19 Nov 2017 |
| 918 | firefighterparamedic.net | eNom, Inc. | 21 Nov 2015 | 21 Nov 2015 | 21 Nov 2016 |
| 919 | firefighterswater.org | GoDaddy.com, LLC | 22 Nov 2015 | 22 Nov 2015 | 22 Nov 2016 |
| 920 | firefighterswater.net | GoDaddy.com, LLC | 22 Nov 2015 | 22 Nov 2015 | 22 Nov 2016 |
| 921 | firefighterswater.info | GoDaddy.com, LLC | 22 Nov 2015 | - | 22 Nov 2016 |
| 922 | firefighterswater.com | GoDaddy.com, LLC | 22 Nov 2015 | 22 Nov 2015 | 22 Nov 2017 |
| 923 | firefighterforhirefl.com | GoDaddy.com, LLC | 23 Nov 2015 | 23 Nov 2015 | 23 Nov 2016 |
| 924 | firefighterexclusiveprogram.com | GoDaddy.com, LLC | 24 Nov 2015 | 24 Nov 2015 | 24 Nov 2017 |
| 925 | firefightersforchildren.org | GoDaddy.com, LLC | 23 Nov 2015 | 28 Oct 2016 | 23 Nov 2017 |
| 926 | firefighters4heard.com | Network Solutions, LLC | 25 Nov 2015 | 26 Sep 2025 | 25 Nov 2026 |
| 927 | firefighterphil.org | GoDaddy.com, LLC | 25 Nov 2015 | 28 Jul 2024 | 25 Nov 2026 |
| 928 | firefight-games.com | GMO Internet Inc. | 4 Nov 2021 | 5 Nov 2021 | 4 Nov 2022 |
| 929 | firefightersdirectory.com | GoDaddy.com, LLC | 26 Nov 2015 | 27 Nov 2025 | 26 Nov 2027 |
| 930 | firefightercharitiesrewards.com | GoDaddy.com, LLC | 1 Dec 2015 | 1 Dec 2015 | 1 Dec 2016 |
| 931 | firefighterreport.com | TurnCommerce, Inc. DBA NameBright.com | 20 Apr 2022 | 30 Jun 2025 | 20 Apr 2025 |
| 932 | firefighterhomesharing.com | GoDaddy.com, LLC | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2016 |
| 933 | firefighterhomeshare.com | GoDaddy.com, LLC | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2016 |
| 934 | firefighterbnb.com | GoDaddy.com, LLC | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2016 |
| 935 | firefightersareheroes.com | Launchpad, Inc. | 7 Dec 2015 | 12 Dec 2016 | 7 Dec 2017 |
| 936 | firefightsurvivalstance.com | FastDomain Inc. | 7 Dec 2015 | 7 Dec 2015 | 7 Dec 2016 |
| 937 | firefightsurvival.com | FastDomain Inc. | 7 Dec 2015 | 7 Dec 2015 | 7 Dec 2016 |
| 938 | firefighterloop.com | Tucows Domains Inc. | 7 Dec 2015 | 11 Dec 2016 | 7 Dec 2016 |
| 939 | firefightersoffaith.com | GoDaddy.com, LLC | 22 Sep 2020 | 22 Sep 2020 | 22 Sep 2021 |
| 940 | firefightercigars.com | GoDaddy.com, LLC | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2016 |
| 941 | firefighter-ltd.com | Center of Ukrainian Internet Names dba UKRNAMES | 10 Dec 2015 | 10 Dec 2015 | 10 Dec 2016 |
| 942 | firefighterwife.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Dec 2015 | 11 Dec 2015 | 11 Dec 2016 |
| 943 | firefightuas.com | GoDaddy.com, LLC | 12 Dec 2015 | 12 Dec 2015 | 12 Dec 2017 |
| 944 | firefightinguas.com | GoDaddy.com, LLC | 12 Dec 2015 | 12 Dec 2015 | 12 Dec 2017 |
| 945 | firefightersnearme.com | Domainclub.com, LLC | 11 Dec 2015 | 11 Dec 2015 | 11 Dec 2016 |
| 946 | firefightdrone.com | GoDaddy.com, LLC | 12 Dec 2015 | 22 Jan 2026 | 12 Dec 2025 |
| 947 | firefightersaccessories.com | GoDaddy.com, LLC | 19 Feb 2023 | 20 Feb 2026 | 19 Feb 2027 |
| 948 | firefighterfamily.com | NameCheap, Inc. | 14 Aug 2025 | 14 Aug 2025 | 14 Aug 2026 |
| 949 | firefightercloecalls.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Dec 2015 | 15 Dec 2015 | 15 Dec 2016 |
| 950 | firefightinghq.com | FastDomain Inc. | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2016 |
| 951 | firefightersforsanta.org | GoDaddy.com, LLC | 18 Dec 2015 | 17 Feb 2016 | 18 Dec 2017 |
| 952 | firefighterslifestyle.com | - | 8 Mar 2025 | 19 Mar 2026 | 8 Mar 2026 |
| 953 | firefightersforsanta.net | GoDaddy.com, LLC | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2017 |
| 954 | firefightersforsanta.com | GoDaddy.com, LLC | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2017 |
| 955 | firefighters1st.com | GoDaddy.com, LLC | 20 Dec 2015 | 21 Dec 2025 | 20 Dec 2026 |
| 956 | firefighterguns.com | GoDaddy.com, LLC | 20 Dec 2015 | 20 Dec 2015 | 20 Dec 2016 |
| 957 | firefighterswinbig.com | GoDaddy.com, LLC | 22 Dec 2015 | 22 Dec 2015 | 22 Dec 2016 |
| 958 | firefightingandbeers.com | GoDaddy.com, LLC | 24 Dec 2015 | 25 Dec 2025 | 24 Dec 2027 |
| 959 | firefightermortgagescanada.com | GoDaddy.com, LLC | 24 Dec 2015 | 24 Dec 2015 | 24 Dec 2016 |
| 960 | firefightermortgagesca.com | GoDaddy.com, LLC | 24 Dec 2015 | 3 Feb 2025 | 24 Dec 2024 |
| 961 | firefighterkitchen.com | GoDaddy.com, LLC | 26 Dec 2015 | 26 Dec 2025 | 26 Dec 2027 |
| 962 | firefighterchristophersantorascholarship.com | GoDaddy.com, LLC | 29 Dec 2015 | 29 Dec 2015 | 29 Dec 2016 |
| 963 | firefightersurvivorbenefits.com | GoDaddy.com, LLC | 30 Dec 2015 | 30 Dec 2015 | 30 Dec 2017 |
| 964 | firefighterprocessing.org | GoDaddy.com, LLC | 29 Dec 2015 | 12 Feb 2026 | 29 Dec 2027 |
| 965 | firefighterprocessing.com | GoDaddy.com, LLC | 29 Dec 2015 | 30 Dec 2025 | 29 Dec 2026 |
| 966 | firefighterdeathbenefits.com | GoDaddy.com, LLC | 30 Dec 2015 | 30 Dec 2015 | 30 Dec 2017 |
| 967 | firefightersthrive.com | GoDaddy.com, LLC | 31 Dec 2015 | 31 Dec 2015 | 31 Dec 2017 |
| 968 | firefightermatch.com | eNom, Inc. | 15 Sep 2021 | 15 Sep 2021 | 15 Sep 2022 |
| 969 | firefighterdates.net | GoDaddy.com, LLC | 30 Dec 2015 | 30 Dec 2015 | 30 Dec 2016 |
| 970 | firefighterdates.com | GoDaddy.com, LLC | 30 Dec 2015 | 30 Dec 2015 | 30 Dec 2016 |
| 971 | firefighter.supplies | Google, Inc. | 25 Jan 2023 | 11 Mar 2026 | 25 Jan 2027 |
| 972 | firefighterssafety.com | 1&1 Internet AG | 2 Jan 2016 | 17 Mar 2025 | 2 Jan 2025 |
| 973 | firefighterdigest.com | GoDaddy.com, LLC | 24 Jul 2016 | 5 Oct 2025 | 24 Jul 2025 |
| 974 | firefighterrookiehelp.com | FastDomain Inc. | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 975 | firefightersonly.com | Tucows Domains Inc. | 5 Aug 2023 | 4 Aug 2025 | 5 Aug 2026 |
| 976 | firefighters.top | Dynadot, LLC | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 977 | firefightersmerchandise.com | GoDaddy.com, LLC | 11 Apr 2010 | 12 Apr 2026 | 11 Apr 2027 |
| 978 | firefightergifts.com | GoDaddy.com, LLC | 11 Dec 1998 | 11 Dec 2025 | 10 Dec 2026 |
| 979 | firefighterdecalsandmore.com | GoDaddy.com, LLC | 21 Jun 2011 | 22 Jun 2024 | 21 Jun 2029 |
| 980 | firefighterapparelstore.com | GoDaddy.com, LLC | 1 Dec 2012 | 2 Dec 2025 | 1 Dec 2026 |
| 981 | firefighterexpress.com | Google, Inc. | 5 Jan 2016 | 5 Jan 2017 | 5 Jan 2018 |
| 982 | firefightertestingacademy.com | GoDaddy.com, LLC | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2018 |
| 983 | firefightertestacademy.com | GoDaddy.com, LLC | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2018 |
| 984 | firefightertraininghub.com | Name.com, Inc. | 10 Jan 2016 | 18 Jul 2017 | 10 Jan 2018 |
| 985 | firefightertrainingacademy.com | Name.com, Inc. | 10 Jan 2016 | 10 Jan 2016 | 10 Jan 2017 |
| 986 | firefighterunit.com | Key-Systems GmbH | 30 Apr 2020 | 27 Nov 2025 | 30 Apr 2027 |
| 987 | firefightingfacts.com | GoDaddy.com, LLC | 14 Jan 2016 | 14 Jan 2016 | 14 Jan 2018 |
| 988 | firefighterwire.com | GoDaddy.com, LLC | 14 Jan 2016 | 14 Jan 2016 | 14 Jan 2018 |
| 989 | firefighterfacts.com | GoDaddy.com, LLC | 25 Sep 2024 | 25 Sep 2024 | 25 Sep 2027 |
| 990 | firefightetclosecalls.com | GoDaddy.com, LLC | 14 Jan 2016 | 14 Jan 2016 | 14 Jan 2017 |
| 991 | firefighterinflatables.com | GoDaddy.com, LLC | 14 Jan 2016 | 14 Jan 2016 | 14 Jan 2018 |
| 992 | firefighter-seikatu.xyz | GMO Internet Inc. | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 993 | firefighter-seikatu.link | GMO Internet Inc. | 15 Jan 2016 | 25 Feb 2017 | 15 Jan 2017 |
| 994 | firefighter-seikatu.net | GMO Internet Inc. | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 995 | firefighter-seikatu.com | GMO Internet Inc. | 15 Jan 2016 | 31 Dec 2016 | 15 Jan 2018 |
| 996 | firefighter-seikatu.club | GMO Internet Inc. | 10 May 2017 | 22 May 2017 | 10 May 2018 |
| 997 | firefighter-seikatu.click | GMO Internet Inc. | 15 Jan 2016 | 25 Feb 2017 | 15 Jan 2017 |
| 998 | firefighterpetcare.com | register.com, Inc. | 17 Jan 2016 | 17 Jan 2016 | 17 Jan 2018 |
| 999 | firefightingplatform.com | BigRock Solutions Ltd. | 18 Jan 2016 | 19 Apr 2025 | 18 Jan 2031 |
| 1000 | firefightersswag.com | DropCatch.com 1165 LLC | 8 Apr 2018 | 8 Apr 2018 | 8 Apr 2019 |
Displaying 1,000 out of 6,512 domains starting with the keyword "FIREFIGHT". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=firefight
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |