With support for 
Keyword: FASTCLEANINGSERVICE
Reverse Whois » KEYWORD [fastcleaningservice ] { 25 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | fastcleaningservice.com | GoDaddy.com, LLC | 23 Jul 2022 | 6 Aug 2025 | 23 Jul 2026 |
| 2 | fastcleaningservice.co.uk | Acens Technologies, S.L.U. | 26 Feb 2017 | 26 Feb 2017 | 26 Feb 2018 |
| 3 | fastcleaningservice.net | Google, Inc. | 16 Mar 2023 | 1 Mar 2025 | 16 Mar 2026 |
| 4 | fastcleaningservice.nl | - | 4 Oct 2023 | 7 Jul 2025 | - |
| 5 | fastcleaningservice1.com | Wild West Domains, LLC | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 6 | fastcleaningservice24.com | Network Solutions, LLC | 31 Oct 2013 | 29 Oct 2015 | 31 Oct 2016 |
| 7 | fastcleaningservices.com | TurnCommerce, Inc. DBA NameBright.com | 14 Apr 2006 | 1 May 2020 | 14 Apr 2026 |
| 8 | fastcleaningservices.net | GoDaddy.com, LLC | 3 May 2023 | 4 May 2025 | 3 May 2026 |
| 9 | fastcleaningservices.co.uk | - | 16 Aug 2025 | 16 Aug 2025 | 16 Aug 2026 |
| 10 | fastcleaningservicesltd.co.uk | - | 9 Aug 2022 | 15 May 2023 | 9 Aug 2023 |
| 11 | fastcleaningserviceslondon.co.uk | - | 3 Jul 2013 | 19 Jun 2017 | 3 Jul 2019 |
| 12 | fastcleaningserviceny.com | Network Solutions, LLC | 2 Oct 2018 | 2 Oct 2018 | 2 Oct 2019 |
| 13 | fastcleaningservicesnottingham.com | GoDaddy.com, LLC | 31 Jan 2020 | 31 Jan 2020 | 31 Jan 2021 |
| 14 | fastcleaningservicenearme.com | GoDaddy.com, LLC | 19 Aug 2020 | 20 Aug 2024 | 19 Aug 2025 |
| 15 | fastcleaningservicesca.com | GoDaddy.com, LLC | 4 Dec 2020 | 14 Feb 2024 | 4 Dec 2023 |
| 16 | fastcleaningservicesparkcity.com | Google, Inc. | 28 Oct 2022 | 29 Oct 2023 | 28 Oct 2024 |
| 17 | fastcleaningservicellc.com | GoDaddy.com, LLC | 18 Mar 2023 | 19 Mar 2025 | 18 Mar 2026 |
| 18 | fastcleaningservicesus.com | Wix.com Ltd. | 16 Jul 2020 | 25 Sep 2023 | 16 Jul 2023 |
| 19 | fastcleaningservices.org | Network Solutions, LLC | 18 Nov 2020 | 24 Oct 2024 | 18 Nov 2026 |
| 20 | fastcleaningservicesllc.shop | NameCheap, Inc. | 11 Mar 2024 | 8 Apr 2024 | 11 Mar 2025 |
| 21 | fastcleaningservice1corp.site | NameCheap, Inc. | 30 Apr 2024 | 1 May 2025 | 30 Apr 2026 |
| 22 | fastcleaningservicesllc.com | Google, Inc. | 3 May 2024 | 19 Apr 2025 | 3 May 2026 |
| 23 | fastcleaningservices-04.com | Hosting Concepts B.V. dba Openprovider | 20 Sep 2024 | 21 Jul 2025 | 20 Sep 2025 |
| 24 | fastcleaningservices1corp.com | GoDaddy.com, LLC | 10 Dec 2024 | 10 Dec 2024 | 10 Dec 2025 |
| 25 | fastcleaningservicesmd.com | Wix.com Ltd. | 17 Jun 2025 | 17 Jun 2025 | 17 Jun 2027 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=fastcleaningservice
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |