Keyword: FARMBUREAUFINANCIALSERVICES
Reverse Whois » KEYWORD [farmbureaufinancialservices ] { 10 domain names }
Num | Domain Name | Registrar | Created | Updated | Expiry |
---|---|---|---|---|---|
1 | farmbureaufinancialservices.biz | Network Solutions, LLC | 22 Feb 2008 | 29 Dec 2022 | 21 Feb 2028 |
2 | farmbureaufinancialservices.com | Network Solutions, LLC | 7 Dec 2000 | 8 Oct 2021 | 7 Dec 2026 |
3 | farmbureaufinancialservices.info | Network Solutions, LLC | 22 Feb 2008 | 17 Jun 2024 | 22 Feb 2028 |
4 | farmbureaufinancialservices.net | Network Solutions, LLC | 22 Feb 2008 | 24 Dec 2022 | 22 Feb 2028 |
5 | farmbureaufinancialservices.org | Network Solutions, LLC | 22 Feb 2008 | 29 Dec 2022 | 22 Feb 2028 |
6 | farmbureaufinancialservices.us | Network Solutions, LLC | 22 Feb 2008 | 29 Dec 2022 | 21 Feb 2028 |
7 | farmbureaufinancialservicessd.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
8 | farmbureaufinancialservicesc.com | - | - | - | - |
9 | farmbureaufinancialservicessd.net | GoDaddy.com, LLC | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
10 | farmbureaufinancialservicesmatthewhemker.com | Google, Inc. | 23 May 2023 | 4 Jul 2025 | 23 May 2025 |

Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=farmbureaufinancialservices
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
---|---|---|---|---|
200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |