Our database now contains whois records of 633 Million (633,634,414) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [633 Million Domains] $10,000 Details

Keyword: ELIET

Reverse Whois » KEYWORD [eliet ]  { 632 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1eliet.comGoDaddy.com, LLC30 May 200924 Jun 202530 May 2026
2eliet.be-18 Feb 2000--
3eliet.ch----
4eliet.de--18 Jan 2008-
5eliet.eu----
6eliet.netWebfusion Ltd.11 Jan 201712 Jan 202511 Jan 2026
7eliet.co.uk-27 May 200324 Jun 202527 May 2026
8eliet.infoRegister NV dba Register.eu8 Mar 202322 Apr 20258 Mar 2026
9eliet.uk-5 Oct 20212 Aug 20245 Oct 2024
10eliet.usDynadot, LLC7 Jul 20238 Jul 20247 Jul 2024
11eliet.xyz-29 Jun 2025-29 Jun 2026
12eliet.nl-31 Mar 201911 Jun 2025-
13eliet.ru-21 Dec 2012-21 Dec 2025
14eliet.sk-6 Dec 200610 Jul 202520 Nov 2025
15eliet.fr-18 Sep 200630 Nov 202419 Oct 2025
16eliet.storeTucows Domains Inc.6 Dec 20248 Jan 20256 Dec 2025
17eliet.online1&1 Internet AG9 Jul 20259 Jul 20259 Jul 2026
18elietahari.comNetwork Solutions, LLC12 Nov 199919 Jun 202512 Nov 2025
19eliettemusic.comregister.com, Inc.22 Oct 201422 Oct 201422 Oct 2015
20elieth.meGoDaddy.com, LLC23 May 201222 Jul 201423 May 2016
21elietaktouk.com1&1 Internet AG28 Oct 201428 Oct 201428 Oct 2015
22elietayyar.netGoDaddy.com, LLC4 Sep 20144 Sep 20144 Sep 2015
23elietmachines.comKey-Systems GmbH27 May 200326 May 202527 May 2026
24elietahari.infoGoDaddy.com, LLC19 Jun 200920 Jun 201519 Jun 2016
25elietiantanktop.comWild West Domains, LLC28 Feb 20151 Mar 202528 Feb 2026
26elietelili.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Aug 201427 Aug 201427 Aug 2015
27eliete-e-fabio.comName.com, Inc.15 Aug 201415 Aug 201415 Aug 2015
28eliethiopia.comGoDaddy.com, LLC11 Nov 201411 Nov 201411 Nov 2016
29eliettsonpalm.com-6 Oct 20227 Oct 20236 Oct 2024
30elietu.comeName Technology Co., Ltd.27 Sep 201427 Sep 201427 Sep 2015
31elietanabe.comGMO Internet Inc.22 Jun 201823 Jun 201822 Jun 2019
32elietaharia.comTucows Domains Inc.28 Nov 201428 Nov 201428 Nov 2015
33eliete-transtour.comGoDaddy.com, LLC8 Dec 20148 Dec 20148 Dec 2015
34elietiphanie.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…13 Dec 201315 Dec 201413 Dec 2015
35eliete4print.comGoDaddy.com, LLC22 Dec 201422 Dec 201422 Dec 2015
36elietravelagency.comTucows Domains Inc.22 Dec 201126 Dec 201522 Dec 2016
37elietahari.orgGoDaddy.com, LLC30 Sep 202213 May 202530 Sep 2025
38elietahri.comDynadot, LLC6 Jul 20256 Jul 20256 Jul 2026
39elietaktouk.london1&1 Internet AG28 Oct 201428 Oct 201428 Oct 2015
40elietahari.emailGoDaddy.com, LLC12 Nov 20148 Nov 201712 Nov 2018
41elieteinvestments.comregister.com, Inc.12 Aug 201513 Jul 202512 Aug 2026
42eliette037.xyzGandi SAS2 Mar 20152 Mar 20152 Mar 2016
43elietahari.fashionGo China Domains, LLC15 Apr 201515 Apr 201515 Apr 2016
44elieteanimes.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
45eliettem.comNetwork Solutions, LLC18 Jan 201518 Jan 201518 Jan 2016
46elieteforceairsoft.comGoDaddy.com, LLC18 Feb 201518 Feb 201518 Feb 2016
47elietteplata.comGoDaddy.com, LLC26 Feb 201526 Feb 201526 Feb 2016
48eliette.netNetwork Solutions, LLC9 Jun 20175 May 20259 Jun 2026
49elietong.comHiChina Zhicheng Technology Limited2 Jun 20162 Jun 20172 Jun 2018
50elietebolo.comAscio Technologies, Inc. Danmark - Filial af Ascio…14 Apr 201514 Apr 201514 Apr 2016
51elietedesigns.comTucows Domains Inc.16 Apr 201420 Apr 201516 Apr 2016
52eliett.comHostinger, UAB24 Nov 202228 Oct 202424 Nov 2025
53elietbet.comGoDaddy.com, LLC30 Dec 201630 Dec 201630 Dec 2017
54elietannous.comFastDomain Inc.21 Aug 20233 Nov 202421 Aug 2024
55elietenutri.comInternet Domain Services BS Corp12 Apr 202112 Apr 202112 Apr 2022
56eliethvieira.comGoDaddy.com, LLC16 May 201516 May 201516 May 2016
57elieti.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Sep 201517 Sep 201517 Sep 2016
58eliettesport.comGoDaddy.com, LLC13 Jan 201713 Jan 201713 Jan 2018
59elietrader.comPorkbun, LLC4 Sep 20244 Sep 20244 Sep 2025
60eliettesmusicacademy.comTucows Domains Inc.25 Sep 201525 Apr 202525 Sep 2025
61eliettro.comGoDaddy.com, LLC27 Sep 201527 Sep 201527 Sep 2017
62elietaharai.comTucows Domains Inc.14 Jul 201418 Jul 201514 Jul 2016
63elietdaily.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Nov 20153 Nov 20153 Nov 2016
64elietstock.comKey-Systems GmbH4 Nov 20154 Nov 20154 Nov 2016
65eliettesalgado.comTucows Domains Inc.6 Nov 201526 Apr 20256 Nov 2025
66elietbetkenya.comDynadot, LLC30 Sep 202330 Sep 202430 Sep 2025
67elietradic.comregister.com, Inc.20 Nov 201529 Dec 201620 Nov 2017
68elietebetkenya.comGoDaddy.com, LLC29 May 201729 May 201729 May 2018
69elietebet.comTucows Domains Inc.28 Feb 201728 Feb 201728 Feb 2018
70elietouma.comDreamHost, LLC3 Feb 20163 Feb 20163 Feb 2017
71elietayar.infoGoDaddy.com, LLC10 Feb 201616 Aug 201710 Feb 2018
72elieteyssedou.com1&1 Internet AG13 Feb 201614 Feb 201713 Feb 2018
73elietou.mobiWest263 International Limited18 Feb 201616 Feb 201718 Feb 2018
74elieteguilds.comGoDaddy.com, LLC19 Feb 201619 Feb 201619 Feb 2017
75elietech.comenom457, Incorporated13 Oct 202415 Mar 202513 Oct 2025
76eliette-alyse.comGoogle, Inc.25 Feb 20167 May 202425 Feb 2033
77elietou.winChengdu West Dimension Digital Technology Co., Ltd…18 Feb 201616 Feb 201717 Feb 2018
78elietou.onlineChengdu West Dimension Digital Technology Co., Ltd…18 Feb 201621 Feb 201718 Feb 2018
79elietou.clubChengdu West Dimension Digital Technology Co., Ltd…18 Feb 201616 Feb 201717 Feb 2018
80elietv.comGoDaddy.com, LLC7 Mar 20168 Mar 20257 Mar 2026
81elietube.comNameCheap, Inc.17 Aug 201717 Aug 201717 Aug 2018
82eliette.linkOmnis Network, LLC17 Mar 201617 Apr 201717 Mar 2017
83eliette.com-10 Jul 200330 Jun 202510 Jul 2026
84elietayar.netGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
85elietcosmetix.comNamesilo, LLC29 Mar 201629 Mar 201629 Mar 2017
86elietepreirelime.comGoDaddy.com, LLC11 Apr 201611 Apr 201611 Apr 2017
87elietnutritionpros.comGoDaddy.com, LLC22 Apr 201622 Apr 201622 Apr 2017
88elietaylor.comDropCatch.com 606 LLC18 Jul 201818 Jul 201818 Jul 2019
89elietaieb.comDynadot, LLC12 Feb 202213 Feb 202512 Feb 2026
90elietmtlspa.comGoDaddy.com, LLC5 May 20165 May 20165 May 2017
91eliettparchment.comGoDaddy.com, LLC21 May 201622 May 202521 May 2026
92elietahari.vip-18 May 201618 May 201618 May 2017
93elietteguyot.comGandi SAS27 May 201629 Nov 202427 May 2029
94elietpain.comTucows Domains Inc.31 May 201631 May 201631 May 2017
95elietabet.comGoDaddy.com, LLC22 Dec 20191 Mar 202522 Dec 2025
96elietecme.comEUTurbo.com LLC25 Apr 20228 Jun 202325 Apr 2023
97elietahari.xyzPDR Ltd. d/b/a PublicDomainRegistry.com30 Jun 201614 Sep 201630 Jun 2017
98elietahari.clothingGoDaddy.com, LLC25 Feb 201411 Apr 201725 Feb 2018
99elietahari.shoesGoDaddy.com, LLC5 Mar 201416 May 20245 Mar 2024
100elietenegrao.comGoDaddy.com, LLC14 Jul 201625 Aug 202314 Jul 2023
101elietahari.bizGoDaddy.com, LLC24 Jan 200719 Jun 202523 Jan 2029
102elietuva.bizNameCheap, Inc.12 Oct 200216 Sep 202411 Oct 2025
103elietmixes.comGoDaddy.com, LLC15 Jan 201915 Jan 201915 Jan 2020
104eliettematos.comGoDaddy.com, LLC17 Dec 201817 Dec 201817 Dec 2020
105eliettematos.orgGoDaddy.com, LLC2 Aug 201613 Sep 20172 Aug 2018
106elieteurope.comKey-Systems GmbH1 Dec 200621 Jan 20251 Dec 2025
107eliette-dambes.comGoDaddy.com, LLC7 Oct 202429 Jun 20257 Oct 2025
108elietaharijeans.comGoDaddy.com, LLC17 Jun 201113 Jun 202517 Jun 2027
109elietinalevy.comGoDaddy.com, LLC27 Oct 201328 Oct 202427 Oct 2027
110eliete.comTurnCommerce, Inc. DBA NameBright.com4 May 20058 Apr 20254 May 2026
111eliette-von-karajan.comunited-domains AG28 Jul 20086 Aug 202528 Jul 2026
112eliet-europe.comKey-Systems GmbH1 Dec 200621 Jan 20251 Dec 2025
113elietequipment.comGoDaddy.com, LLC23 Jul 200823 Jul 202523 Jul 2026
114elietpapillon.comGoDaddy.com, LLC16 Dec 201117 Dec 202416 Dec 2025
115elietefts.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Apr 201220 Feb 20171 Apr 2018
116elieteengineeringqatar.comGoDaddy.com, LLC2 Jul 20133 Jul 20152 Jul 2017
117elietcanada.comKey-Systems GmbH13 Feb 201412 Feb 202513 Feb 2026
118elietop.comOVH sas29 May 201330 May 202429 May 2025
119elietediabeticsolutions.comGoDaddy.com, LLC31 Aug 20139 Apr 202531 Aug 2025
120elietaharifragances.comGoDaddy.com, LLC25 May 201213 Jun 202525 May 2028
121elietahariemail.comJiangsu Bangning Science and technology Co. Ltd.30 Jul 20222 Oct 202330 Jul 2023
122elietteharper.comGoDaddy.com, LLC20 Mar 20144 Mar 202520 Mar 2026
123elietuva.comNameCheap, Inc.12 Oct 200212 Sep 202412 Oct 2025
124elietrade.comGoDaddy.com, LLC24 Jan 201315 Mar 201624 Jan 2018
125elietemuniz.comGoDaddy.com, LLC18 Apr 200818 Apr 201618 Apr 2017
126eliet-v.comHiChina Zhicheng Technology Limited17 Oct 201317 Oct 201317 Oct 2016
127elietusa.comKey-Systems GmbH28 Sep 200521 Jan 202528 Sep 2025
128elietahariflashsale.comGoDaddy.com, LLC25 May 201213 Jun 202525 May 2028
129elietahariouterwear.comGoDaddy.com, LLC22 Mar 200413 Jun 202522 Mar 2029
130eliethsardinas.comNetwork Solutions, LLC24 Feb 201224 Mar 201524 Feb 2017
131elietian.comGoDaddy.com, LLC11 Apr 201411 Apr 202511 Apr 2026
132eliettegaurin.comOVH sas29 May 201330 May 202429 May 2025
133elietechnologies.comDomain.com, LLC3 Apr 202524 Jun 20253 Apr 2026
134elietremblay.comTucows Domains Inc.10 Nov 202430 Jun 202510 Nov 2025
135elietteink.comGandi SAS8 Jan 20124 Dec 20248 Jan 2026
136eliethebarber.comGoDaddy.com, LLC16 Oct 201229 Oct 202416 Oct 2025
137elietanel.comGoDaddy.com, LLC7 Sep 20048 Sep 20247 Sep 2025
138eliethari.comGoDaddy.com, LLC14 Jun 200713 Jun 202514 Jun 2029
139elietrichet.comHefei Juming Network Technology Co., Ltd3 Jul 20224 Jul 20233 Jul 2024
140elietahariaccessories.comGoDaddy.com, LLC25 May 201213 Jun 202525 May 2028
141eliette-abecassis.comGandi SAS14 Sep 200911 Dec 202414 Sep 2029
142elietou.comBeijing Lanhai Jiye Technology Co., Ltd16 Apr 200721 Jul 202516 Apr 2027
143elietorbey.comTucows Domains Inc.22 Jul 201226 Jul 202022 Jul 2020
144eliethdoyle.comGoDaddy.com, LLC30 Jan 201230 Jan 201230 Jan 2017
145elietri.comGandi SAS11 May 201225 Jun 202411 May 2024
146elietaharistore.comGoDaddy.com, LLC24 Jan 200228 Jun 202524 Jan 2028
147eliet-lanigiro.com1API GmbH24 Apr 200225 Oct 201624 Apr 2018
148elietannoury.comOnline SAS31 Mar 200724 Mar 202531 Mar 2026
149elietaharie.comNamesilo, LLC19 Aug 202119 Aug 202219 Aug 2022
150eliethel.comNameCheap, Inc.20 Aug 200931 Aug 202320 Aug 2025
151elietchipper.comGoDaddy.com, LLC23 Jul 200823 Jul 202523 Jul 2026
152eliet-lehmann.comOVH sas13 Sep 200214 Sep 202413 Sep 2025
153elietaharishoes.comGoDaddy.com, LLC25 May 201213 Jun 202525 May 2028
154elietahariwarehousesale.comGoDaddy.com, LLC25 May 201213 Jun 202525 May 2028
155eliettecepero.comWild West Domains, LLC15 Jul 201416 Jul 201615 Jul 2017
156elietaharisamplesale.comGoDaddy.com, LLC25 May 201213 Jun 202525 May 2028
157elietaharieyewear.comGoDaddy.com, LLC25 May 201213 Jun 202525 May 2028
158elietartan.comDropCatch.com 1198 LLC17 Nov 201817 Nov 201817 Nov 2019
159elieteplumbing.comGoDaddy.com, LLC31 Aug 201631 Aug 201631 Aug 2017
160elietesingles.com-27 Sep 201627 Sep 201627 Sep 2017
161elietorrent.netTucows Domains Inc.24 Jun 201228 Jun 201824 Jun 2018
162eliete.netDynadot, LLC13 Sep 202413 Sep 202413 Sep 2025
163elietahari.netGoDaddy.com, LLC24 Jan 200713 Jun 202524 Jan 2029
164elietroch.netTucows Domains Inc.20 May 201130 Jun 202520 May 2025
165elieteoilandgas.netGoDaddy.com, LLC28 Dec 201121 Dec 201428 Dec 2016
166elietou.netChengdu West Dimension Digital Technology Co., Ltd…22 Nov 201122 Nov 201122 Nov 2026
167eliette-von-karajan.orgunited-domains AG28 Jul 20083 Aug 202528 Jul 2026
168elietahari.xxx-1 Dec 201130 Jan 20121 Dec 2021
169eliette.xyzUniregistrar Corp2 Jun 201623 Sep 20162 Jun 2017
170elietempresarial.com-24 Oct 201624 Oct 201624 Oct 2017
171elieteerobson.comName.com, Inc.8 Nov 20164 Dec 20178 Nov 2017
172elietanous.comNetwork Solutions, LLC23 Nov 201624 Oct 202423 Nov 2025
173eliethefischer.comNetwork Solutions, LLC26 Nov 201628 Nov 201726 Nov 2018
174elietie.infoNameCheap, Inc.27 Nov 201627 Nov 201727 Nov 2018
175elietesilvers.comGoDaddy.com, LLC29 Nov 201629 Nov 201629 Nov 2017
176elietraiteur.com1&1 Internet AG11 Dec 201612 Dec 201811 Dec 2019
177elietdealclub.comGoDaddy.com, LLC12 Dec 201612 Dec 201612 Dec 2017
178eliettestore.comTucows Domains Inc.27 Apr 202127 Apr 202127 Apr 2022
179elietsingles.comDynadot, LLC5 Jun 201914 Feb 20215 Jun 2022
180elietraining.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Jan 201713 Feb 20182 Jan 2018
181elieturk.comGoDaddy.com, LLC12 Jan 201718 Jan 202512 Jan 2028
182elietteabecassis.comGandi SAS13 Jan 20174 Dec 202413 Jan 2028
183elietedaily.comGoDaddy.com, LLC26 May 202126 May 202126 May 2022
184elietorgow.comGoDaddy.com, LLC3 Feb 20171 Oct 20223 Feb 2027
185elietoledano.comOVH sas13 Feb 201715 Feb 201813 Feb 2019
186elietechnologie.com1&1 Internet AG19 Feb 20173 Apr 202519 Feb 2025
187elietbabes.comPorkbun, LLC29 Apr 202328 Apr 202529 Apr 2026
188eliette-maquillage-permanent.comTucows Domains Inc.20 Mar 20171 Dec 201720 Mar 2018
189elietaharioutlet.comGoDaddy.com, LLC30 Sep 202213 May 202530 Sep 2025
190eliete.de--21 Nov 2017-
191eliettedaudet-studio.comOVH sas17 Apr 20176 May 201917 Apr 2020
192eliet-theophile.com1&1 Internet AG25 Apr 201725 Apr 201725 Apr 2018
193eliettheophile.com1&1 Internet AG25 Apr 201725 Apr 201725 Apr 2018
194eliet-landtitle.comTucows Domains Inc.2 May 20176 May 20182 May 2018
195eliettar.infoNameCheap, Inc.21 May 201720 Jul 201721 May 2018
196elietici.comName.com, Inc.22 May 201722 May 201722 May 2018
197elietetaxinj.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Jun 20172 Jun 20172 Jun 2018
198elieth.com1&1 Internet AG29 Nov 202429 Nov 202429 Nov 2025
199elietaharri.comNameCheap, Inc.28 Jun 202428 Jun 202428 Jun 2025
200elietsmotorsport.comeNom, Inc.2 Aug 20172 Aug 20172 Aug 2018
201elietoujoursolide.com1&1 Internet AG14 Sep 201714 Sep 201714 Sep 2018
202eliets.comHosting Concepts B.V. dba Openprovider28 Apr 20217 Jul 202528 Apr 2026
203eliettes.comNetwork Solutions, LLC19 Oct 201719 Oct 201719 Oct 2018
204elietnico.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Oct 201731 Oct 201731 Oct 2018
205elietopct.comOVH sas21 Nov 201722 Nov 202421 Nov 2025
206elietediasdesign.comLaunchpad, Inc.10 Dec 201710 Dec 201710 Dec 2018
207elietollhouse.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…4 Jan 201628 Dec 20164 Jan 2019
208eliethiarussell.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…22 Jun 201515 Jun 201722 Jun 2018
209elietollhouse.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…21 Jun 201314 Jun 201721 Jun 2019
210elietartan.co.uk-29 Aug 201630 Aug 202429 Aug 2024
211eliete-knowledge.comOnlineNIC, Inc.14 Jan 201814 Jan 201814 Jan 2019
212elietteetelise.comOnline SAS21 Jan 201821 Jan 201821 Jan 2019
213eliette-xavier2018.comGandi SAS27 Jan 201828 Jan 201827 Jan 2019
214eliettecarter.comTucows Domains Inc.6 Feb 201810 Feb 20206 Feb 2020
215elietenetworkingsolutions.comGoogle, Inc.10 Feb 201810 Feb 201810 Feb 2019
216elietawil.infoGoDaddy.com, LLC9 Mar 20189 Mar 20189 Mar 2019
217elietontour.comKey-Systems GmbH5 Apr 20184 Apr 20255 Apr 2026
218elietailor.comOnline SAS18 Apr 201822 Apr 202518 Apr 2026
219elietdoudou.comTucows Domains Inc.10 May 201814 May 201910 May 2019
220elietmusestudio.comGoDaddy.com, LLC27 Dec 201727 Dec 201727 Dec 2018
221elietecarris.comGoogle, Inc.3 Jun 20183 Jun 20183 Jun 2019
222elietwdhost.comGoDaddy.com, LLC5 Jun 20185 Jun 20185 Jun 2019
223elieto.comGoogle, Inc.2 Jul 201822 Jul 20252 Jul 2025
224elietprospects.comGoDaddy.com, LLC5 Jul 20185 Jul 20185 Jul 2019
225elieteeferreira.comGoDaddy.com, LLC5 Jul 201816 Jul 20215 Jul 2022
226elietod.racingNameCheap, Inc.6 Jul 20188 Jul 20196 Jul 2019
227elietesantosprojetos.comGoDaddy.com, LLC7 Jul 20187 Jul 20187 Jul 2019
228elietedellaviolla.comGoDaddy.com, LLC9 Jul 201810 Jul 20259 Jul 2026
229elietedentista.siteTucows Domains Inc.9 Aug 2018-9 Aug 2019
230eliettoo.comNameCheap, Inc.14 Aug 201814 Aug 201814 Aug 2019
231elietuchman.comDreamHost, LLC13 Sep 20188 Sep 202413 Sep 2025
232eliettahari.comWild West Domains, LLC21 Sep 201821 Sep 201821 Sep 2019
233elietgroup.comGoDaddy.com, LLC23 Oct 201823 Oct 201823 Oct 2019
234elietegoncalves.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Oct 201827 Oct 201827 Oct 2019
235elietluxury.comGoDaddy.com, LLC3 Nov 20183 Nov 20183 Nov 2020
236elietahchi.comGoDaddy.com, LLC14 Nov 201810 Nov 202314 Nov 2025
237elietediamondoriflame.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Nov 201814 Nov 201814 Nov 2019
238elietworkoutgear.comGoDaddy.com, LLC14 Dec 201814 Dec 201814 Dec 2019
239elietemiranda.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Jan 202015 Jan 202015 Jan 2021
240elietsa.comTucows Domains Inc.1 Feb 20193 Jan 20251 Feb 2026
241elietrotignon.comGandi SAS15 Mar 201916 Mar 202515 Mar 2026
242elietelevelcoaching.infoGoDaddy.com, LLC19 Mar 201919 Mar 201919 Mar 2020
243elietelevelcoaching.comGoDaddy.com, LLC19 Mar 201919 Mar 201919 Mar 2020
244elietelevelcoaching.netGoDaddy.com, LLC19 Mar 201919 Mar 201919 Mar 2020
245elietelevelcoaching.usGoDaddy.com, LLC19 Mar 201919 Mar 201919 Mar 2020
246elietecircleclass.comGoDaddy.com, LLC22 Mar 201922 Mar 201922 Mar 2020
247elietebandeira.comTucows Domains Inc.24 Mar 201924 Mar 201924 Mar 2020
248elietsphotography.comTucows Domains Inc.15 Apr 201919 Apr 202115 Apr 2021
249elieteeamauri.comName.com, Inc.15 Apr 201915 Apr 201915 Apr 2020
250elieteworld.comNameCheap, Inc.22 Apr 201922 Apr 201922 Apr 2020
251eliethpina.comLaunchpad, Inc.24 Oct 20239 Oct 202424 Oct 2025
252elietstage.comGoDaddy.com, LLC29 Apr 201929 Apr 201929 Apr 2020
253elietstages.comGoDaddy.com, LLC30 Apr 201930 Apr 201930 Apr 2020
254eliettenailspa.comWix.com Ltd.4 May 201914 Jul 20234 May 2023
255elietertois.comOnline SAS9 Nov 20209 Nov 20209 Nov 2021
256elietokyo.comMesh Digital Limited31 May 20191 Jun 201931 May 2020
257elietebenetti.comGoDaddy.com, LLC31 May 201931 May 201931 May 2020
258eliet-machine.comNamesilo, LLC24 Aug 202127 Sep 202324 Aug 2023
259elietsquadgame.comGoDaddy.com, LLC14 Jun 201914 Jun 201914 Jun 2020
260elietoby.comGoDaddy.com, LLC21 Jun 201921 Jun 202521 Jun 2027
261elietacevedo.comTucows Domains Inc.12 Jul 201912 Jul 201912 Jul 2020
262eliette-l.comInfomaniak Network SA23 Jul 201927 Jun 202523 Jul 2026
263elietl.comNetwork Solutions, LLC23 Aug 201923 Aug 201923 Aug 2020
264elietdentalrcm.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Sep 20192 Oct 202430 Sep 2025
265eliete-promo.comGoDaddy.com, LLC4 Oct 20194 Oct 20194 Oct 2020
266elietemetalbuildings.comGoDaddy.com, LLC18 Oct 201918 Oct 201918 Oct 2020
267elietheelephant.comTucows Domains Inc.23 Oct 201927 Oct 202023 Oct 2020
268elietio.comGandi SAS30 Oct 201930 Oct 201930 Oct 2020
269elieteathletemodels.comGoDaddy.com, LLC11 Nov 201911 Nov 201911 Nov 2020
270elieteproducttest.comPSI-USA, Inc. dba Domain Robot14 Nov 201914 Nov 201914 Nov 2020
271elietournefier.comRegister.it SPA18 Nov 201921 Dec 202418 Nov 2025
272elietoile.comGoDaddy.com, LLC23 Nov 201923 Nov 202423 Nov 2025
273elietteboutique.comWild West Domains, LLC24 Nov 201924 Nov 201924 Nov 2020
274elietebrito.comeNom, Inc.28 Nov 201928 Nov 201928 Nov 2020
275eliet-beauty.comName.com, Inc.6 Dec 20196 Dec 20196 Dec 2020
276elietebahia.comWix.com Ltd.17 Dec 201917 Mar 202517 Dec 2026
277elieteguimaraesleite.comGoogle, Inc.23 Dec 201923 Dec 201923 Dec 2020
278elietestreamtv.comGoDaddy.com, LLC6 Jan 20206 Jan 20206 Jan 2021
279elietpropertieslasvegas.comGoDaddy.com, LLC10 Jan 202010 Jan 202010 Jan 2021
280elietorrent.comDynadot, LLC15 Jan 202015 Jan 202015 Jan 2021
281eliettestall.comNameCheap, Inc.30 Jul 202331 Jul 202530 Jul 2026
282eliettellc.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Jan 202031 Jan 202031 Jan 2021
283elietekarateglastonbury.comGoDaddy.com, LLC3 Feb 20203 Feb 20203 Feb 2021
284elieteimoveis.comGoogle, Inc.12 Feb 202012 Feb 202012 Feb 2021
285elietakesphotos.comGoDaddy.com, LLC8 Mar 20208 Mar 20208 Mar 2021
286elietekehl.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Mar 202026 Mar 202026 Mar 2021
287elietrentals.netPDR Ltd. d/b/a PublicDomainRegistry.com31 Mar 202031 Mar 202031 Mar 2021
288elieteautobroke.comGoDaddy.com, LLC9 Apr 20209 Apr 20209 Apr 2021
289elietesantanna.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Apr 202027 Apr 202027 Apr 2021
290eliettejaneteas.comTucows Domains Inc.1 May 202016 Apr 20251 May 2026
291elietrehab.comGoDaddy.com, LLC4 May 20204 May 20204 May 2021
292eliettelevyfleisch.comOVH sas7 May 20208 May 20247 May 2025
293elietcommunity.netOVH sas12 May 202013 May 202012 May 2021
294elietteyereni.comPDR Ltd. d/b/a PublicDomainRegistry.com18 May 202018 May 202018 May 2021
295eliettesingleton.comGoDaddy.com, LLC19 May 202020 May 202319 May 2024
296elietteec.comPainted Pony Names, LLC8 Aug 20258 Aug 20258 Aug 2026
297elietahari.coNamesilo, LLC3 Jan 20208 Jan 20243 Jan 2024
298elietebabes.comMedia Elite Holdings Limited25 May 202025 May 202025 May 2021
299elieteoliveira.comAutomattic Inc.3 Jun 202014 May 20253 Jun 2026
300elieterrywatches.comGoDaddy.com, LLC5 Jun 20205 Jun 20205 Jun 2021
301elietwatches.comTucows Domains Inc.6 Jun 202010 Jun 20216 Jun 2021
302elietteboutiqueymas.comGoDaddy.com, LLC25 Jun 202025 Jun 202025 Jun 2021
303elieths.comGoDaddy.com, LLC13 Jul 202013 Jul 202013 Jul 2021
304elietsportsusa.netGoDaddy.com, LLC16 Jul 202016 Jul 202016 Jul 2021
305elietawil.comTucows Domains Inc.26 Jul 202012 Jul 202526 Jul 2026
306elietemenegalle.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Jul 202027 Jul 202027 Jul 2021
307elietealves.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Aug 202029 Sep 202318 Aug 2023
308eliettn.siteLimited Liability Company "Registrar of domain nam…25 Aug 202030 Aug 202025 Aug 2021
309eliettmendoza.comGoDaddy.com, LLC26 Aug 202027 Aug 202426 Aug 2025
310eliette.infoKey-Systems GmbH7 Jan 202021 Feb 20257 Jan 2026
311elietehavaianas.comNom-iq Ltd. dba COM LAUDE16 Sep 20209 Jun 202516 Sep 2025
312elietepmo.comGoDaddy.com, LLC21 Sep 20203 Dec 202421 Sep 2024
313elietfts.comXin Net Technology Corporation1 Apr 20235 Apr 20241 Apr 2025
314elietefantasy.comGoDaddy.com, LLC25 Sep 202025 Sep 202025 Sep 2021
315elietevalim.comeNom, Inc.6 Oct 202018 Dec 20236 Oct 2023
316elietmaghaea.infoNamesilo, LLC11 Oct 202011 Oct 202011 Oct 2021
317elietayyar.guruGoDaddy.com, LLC10 Nov 202010 Nov 202010 Nov 2021
318eliethebear.comGoDaddy.com, LLC20 Nov 202020 Nov 202420 Nov 2026
319eliettecleaninggroup.comGoDaddy.com, LLC22 Nov 202022 Nov 202022 Nov 2022
320elietsa.onlineTucows Domains Inc.25 Nov 202025 Nov 202025 Nov 2021
321elietbap.comOVH sas5 Dec 20205 Dec 20205 Dec 2021
322elietism.comGoDaddy.com, LLC11 Jan 202111 Jan 202111 Jan 2022
323elietteholistic.comNETIM SARL11 Jan 202121 Mar 202111 Jan 2026
324elietcme.comGoDaddy.com, LLC5 Feb 20215 Feb 20215 Feb 2022
325elietesandalias.comHosting Concepts B.V. dba Openprovider14 Mar 202116 Feb 202414 Mar 2024
326elietefeats.comNameCheap, Inc.15 Mar 2021-15 Mar 2022
327eliet9hockey.comGoDaddy.com, LLC19 Mar 202119 Mar 202119 Mar 2022
328elieteacademt.bizAbove.com Pty Ltd.22 Mar 202122 Mar 202122 Mar 2022
329elietemedeiros.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Apr 20213 Apr 20213 Apr 2022
330eliettecleaning.comGoogle, Inc.14 Apr 202114 Apr 202114 Apr 2022
331elietfeats.comGoDaddy.com, LLC23 Apr 202123 Apr 202123 Apr 2022
332elietexpert.clubDynadot, LLC5 May 20215 May 20215 May 2022
333elietianleggings.comXin Net Technology Corporation10 Jun 202112 Feb 202210 Jun 2022
334elietteshousecleaningservicesllc.comGoogle, Inc.15 Jun 202115 Jun 202115 Jun 2022
335eliettesolutions.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Jul 202122 Jul 202122 Jul 2022
336eliet-sa.comName.com, Inc.24 Jul 202126 Jul 202524 Jul 2025
337elietenft.comGoogle, Inc.30 Jul 202130 Jul 202130 Jul 2022
338elietaxis.comFastDomain Inc.16 Aug 202116 Aug 202116 Aug 2022
339elieterodriguessecretariaremota.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Aug 20215 Nov 202325 Aug 2023
340elietth.clubGoDaddy.com, LLC28 Aug 202128 Aug 202128 Aug 2022
341elietoy.comGoDaddy.com, LLC29 Aug 202129 Aug 202129 Aug 2022
342elietepiol.xyzGoDaddy.com, LLC1 Sep 20211 Sep 20211 Sep 2022
343elietecorretoradeimoveis.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Oct 202119 Oct 202119 Oct 2022
344elietransports.comNETIM SARL1 Nov 20211 Jan 20241 Nov 2023
345elietenodes.hostDynadot, LLC21 Nov 202122 Nov 202121 Nov 2022
346elietahar.comCosmotown, Inc.27 Nov 202427 Nov 202427 Nov 2025
347eliethyernesto.comHosting Concepts B.V. dba Openprovider5 Dec 20215 Dec 20215 Dec 2022
348eliette.onlineCrazy Domains FZ-LLC29 Apr 202412 Jun 202529 Apr 2025
349elietesell.comNameCheap, Inc.22 Dec 2021-22 Dec 2022
350elieteshop.comNameCheap, Inc.22 Dec 20213 Mar 202422 Dec 2023
351elietesale.comNameCheap, Inc.22 Dec 2021-22 Dec 2022
352elietestore.comGoDaddy.com, LLC18 Apr 202430 Jun 202518 Apr 2025
353eliettecentenoarquitecturainteriorismo.comAutomattic Inc.26 Dec 20219 Mar 202426 Dec 2023
354elietteandco.comNeubox Internet S.A. de C.V.29 Dec 20219 Mar 202429 Dec 2023
355eliethv.comHostinger, UAB31 Dec 202131 Dec 202131 Dec 2022
356eliettejoyas.comTucows Domains Inc.13 Jan 202217 Jan 202313 Jan 2023
357elietahariverse.comDynadot, LLC19 Jan 202219 Jan 202219 Jan 2023
358elietcie.comGoDaddy.com, LLC4 Feb 20224 Feb 20224 Feb 2023
359eliete.onlineKey-Systems, LLC10 Feb 2022-10 Feb 2023
360eliettehn.comGoogle, Inc.1 Mar 20222 Mar 20241 Mar 2025
361elietesilva.onlineHostinger, UAB19 Mar 202225 Apr 202319 Mar 2023
362eliettourism.comHostinger, UAB3 Jul 202312 Sep 20243 Jul 2024
363elieteandrade.onlineHostinger, UAB23 Mar 202229 Apr 202323 Mar 2023
364eliete.xyzRealtime Register B.V.31 Mar 20221 Apr 202331 Mar 2024
365eliethsalazartranslations.comGoogle, Inc.8 Apr 202224 Mar 20258 Apr 2026
366elietfarm.comName.com, Inc.14 Apr 202227 Jun 202314 Apr 2023
367eliettecoiffure.xyzNameCheap, Inc.17 Apr 202216 May 202217 Apr 2024
368elietarahi.comAbove.com Pty Ltd.19 Apr 202230 Jun 202319 Apr 2023
369elieteskills.comAbove.com Pty Ltd.26 May 20226 Aug 202326 May 2023
370elietefonseca.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Apr 202425 Mar 202522 Apr 2026
371elietemesquita.comGoogle, Inc.1 Jun 20222 Jun 20231 Jun 2024
372eliety.comNameCheap, Inc.14 Jun 202226 Jul 202314 Jun 2023
373eliettealfieri.comDomain.com, LLC19 Jun 202221 May 202519 Jun 2026
374eliethon.comCronon AG23 Jun 202224 Jun 202523 Jun 2026
375elietemaia.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Jun 20225 Aug 202524 Jun 2025
376elieta.comTucows Domains Inc.25 Jun 202227 May 202525 Jun 2026
377elietembroidery.coGoDaddy.com, LLC15 Jul 202226 Aug 202315 Jul 2023
378elieteoliveiracorretoraimoveis.comGoogle, Inc.24 Jul 202220 Jul 202324 Jul 2023
379elietesa.comGoogle, Inc.2 Aug 20222 Aug 20232 Aug 2024
380elietchus.comChengdu West Dimension Digital Technology Co., Ltd…15 Aug 202222 Oct 202315 Aug 2023
381elietlighters.comTucows Domains Inc.21 Aug 20221 Nov 202321 Aug 2023
382elieteandrade.comRealtime Register B.V.25 Aug 20225 Nov 202325 Aug 2023
383elietembroidery.co.uk-26 Aug 202215 May 202326 Aug 2023
384elietelearning.comNameKing.com Inc.10 Sep 202219 Dec 202410 Sep 2025
385elieten.comGoDaddy.com, LLC12 Sep 202228 Aug 202312 Sep 2025
386elieteparaguassu.comWix.com Ltd.13 Sep 202223 Nov 202313 Sep 2023
387elietaharis.comName.com, Inc.16 Sep 202229 Nov 202416 Sep 2024
388elietttravels.storeDattatec.com SRL27 Sep 2022-27 Sep 2023
389elietttravels.onlineDattatec.com SRL27 Sep 2022-27 Sep 2023
390elietttravels.comDattatec.com SRL27 Sep 20221 Oct 202427 Sep 2025
391eliethestudio.bizregister.com, Inc.29 Sep 20224 Sep 202429 Sep 2025
392eliethestudio.comregister.com, Inc.29 Sep 202230 Aug 202429 Sep 2025
393elietaharicollection.comGoDaddy.com, LLC30 Sep 202213 May 202530 Sep 2025
394elietaharidresses.comGoDaddy.com, LLC30 Sep 202213 May 202530 Sep 2025
395elietahari.uk-30 Sep 202213 May 202530 Sep 2025
396eliettestoll.com1&1 Internet AG2 Oct 202211 Oct 20232 Oct 2024
397eliettececiliaratner.comGoogle, Inc.3 Oct 202221 Apr 20243 Oct 2032
398elietteratner.comGoogle, Inc.3 Oct 202221 Apr 20243 Oct 2032
399elieteoptics.xyzGoDaddy.com, LLC11 Oct 202220 Dec 202411 Oct 2026
400elieteoptics.orgGoDaddy.com, LLC11 Oct 202225 Nov 202411 Oct 2026
401elieteoptical.storeGoDaddy.com, LLC12 Oct 202220 Dec 202412 Oct 2026
402elieteoptics.onlineGoDaddy.com, LLC12 Oct 202220 Dec 202412 Oct 2026
403elieteoptics.netGoDaddy.com, LLC11 Oct 202212 Oct 202411 Oct 2026
404elieteoptical.netGoDaddy.com, LLC11 Oct 202212 Oct 202411 Oct 2026
405elieteoptics.comGoDaddy.com, LLC11 Oct 202212 Oct 202411 Oct 2026
406elieteoptic.comGoDaddy.com, LLC11 Oct 202212 Oct 202411 Oct 2026
407elieteoptical.comGoDaddy.com, LLC11 Oct 202212 Oct 202411 Oct 2026
408elietnetflix.comCloud Yuqu LLC18 Oct 202224 Nov 202318 Oct 2023
409eliettebrillo.comTucows Domains Inc.17 Oct 202228 Dec 202317 Oct 2023
410elietou.cn????????????19 Sep 2023-19 Sep 2025
411elietequila.comGoDaddy.com, LLC2 Nov 20223 Nov 20242 Nov 2025
412elietayyar.infoGoDaddy.com, LLC25 Nov 202225 Nov 202325 Nov 2024
413eliet-epower.comRegister NV dba Register.eu29 Nov 202215 Jan 202529 Nov 2027
414elietaheri.comKey-Systems GmbH30 Dec 202213 Mar 202430 Dec 2023
415elietholding.comKey-Systems GmbH6 Jan 202321 Jan 20256 Jan 2026
416elietteco.comNameCheap, Inc.10 Jan 202322 Feb 202410 Jan 2024
417elietebrandini.com.br-10 Nov 20073 Nov 202310 Nov 2025
418eliethvalverdegonzalez.onlineNameCheap, Inc.17 Jan 202329 Mar 202417 Jan 2024
419elietahari.asiaGoDaddy.com, LLC11 Jan 201218 Jun 202511 Jan 2028
420elietahari.liveGoDaddy.com, LLC24 Jan 202224 Jan 202324 Jan 2024
421eliettesinteff.comSquarespace Domains LLC22 Jan 20237 Jan 202522 Jan 2026
422elietesummersales.comCosmotown, Inc.25 Jan 20235 Apr 202425 Jan 2024
423elietetordin.com.br-14 Dec 20055 Jul 202514 Dec 2025
424elietemarquez.com.br-19 Jun 202026 Jun 202519 Jun 2026
425elietaleaffair.topChengdu West Dimension Digital Technology Co., Ltd…17 Aug 202217 Aug 202317 Aug 2024
426eliett.onlineHostinger, UAB3 Feb 202319 Mar 20253 Feb 2025
427elietaharikids.comGoDaddy.com, LLC24 Sep 201725 Sep 202324 Sep 2025
428elietahariboys.comGoDaddy.com, LLC24 Sep 201725 Sep 202324 Sep 2025
429elietex.comLiquidNet Ltd.8 Dec 201611 Dec 20248 Dec 2025
430elietoubiana.comGoogle, Inc.22 Feb 20237 Feb 202522 Feb 2026
431elietd.onlineAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…7 Mar 202315 Apr 20247 Mar 2024
432elietedu.comHefei Juming Network Technology Co., Ltd8 Nov 20188 Nov 20238 Nov 2024
433elietan.comGoDaddy.com, LLC14 Mar 202326 May 202414 Mar 2024
434elietdiamondsjewelry.comLaunchpad, Inc.15 Jun 201927 Aug 202315 Jun 2023
435elietoldyou.comTucows Domains Inc.9 Apr 202013 Apr 20249 Apr 2025
436elietdna.comKey-Systems GmbH22 Mar 20234 May 202422 Mar 2024
437elietebrandao.comWix.com Ltd.29 Jan 202111 Mar 202329 Jan 2023
438elietstudio.comWix.com Ltd.13 Mar 202111 Feb 202513 Mar 2026
439elietcompagnie.comWild West Domains, LLC31 Mar 202322 Feb 202531 Mar 2026
440elietza.comWix.com Ltd.20 Oct 202130 Dec 202320 Oct 2023
441eliette-mazaudier.comWix.com Ltd.22 Dec 202127 May 202422 Dec 2025
442elietmoi.comGoDaddy.com, LLC1 Feb 20229 Apr 20231 Feb 2024
443elietesafety.comGoDaddy.com, LLC16 Feb 202229 Apr 202416 Feb 2024
444elietaharieverse.comGoDaddy.com, LLC21 Feb 202222 Feb 202521 Feb 2026
445elietio.xyzCloudFlare, Inc.25 Jun 20175 Jun 202525 Jun 2026
446elietefashion.comGoDaddy.com, LLC8 Mar 202219 Mar 20238 Mar 2024
447eliettekorte.comNameCheap, Inc.10 Apr 202222 May 202310 Apr 2023
448elietagenciadeviajes.comGoDaddy.com, LLC17 Jun 202229 Aug 202317 Jun 2023
449elietelomsemarient.comEuroDNS S.A.11 Jul 202211 Jul 202210 Jul 2023
450elietecorretora.comRealtime Register B.V.15 Jul 202226 Aug 202315 Jul 2023
451elietteshousecleaningservices.comGoogle, Inc.19 Apr 20234 Apr 202519 Apr 2026
452elietmachines.nl-5 Apr 20051 Apr 2022-
453elietontour.nl-5 Apr 201813 Feb 2020-
454eliets.nl-28 Apr 20214 Jul 2025-
455elietestransits.comWild West Domains, LLC30 Apr 202312 Aug 202430 Apr 2025
456elietib.co.uk-23 Mar 202217 Nov 202223 Mar 2023
457elietahari.storePDR Ltd. d/b/a PublicDomainRegistry.com14 Jun 202015 Jun 202514 Jun 2026
458elietevilela.comWix.com Ltd.9 May 202319 Jun 20249 May 2024
459elietontour.uk-10 Apr 20188 May 202510 Apr 2026
460eliettesoft.comName.com, Inc.30 May 20231 Jun 202530 May 2026
461eliethe-andco.comOVH sas12 Jun 202325 Jun 202412 Jun 2025
462eliethousing.comregister.com, Inc.23 Jun 20235 Aug 202423 Jun 2024
463eliethelpfactoryllc.comDynadot, LLC30 Jun 20239 Sep 202430 Jun 2024
464eliet-choices.comTucows Domains Inc.7 Jul 202317 Aug 20247 Jul 2024
465elietmachines.uk-5 Oct 20212 Aug 20245 Oct 2024
466elieta-tiesas.infoPDR Ltd. d/b/a PublicDomainRegistry.com10 Jul 202320 Sep 202410 Jul 2024
467eliettegraf.comTucows Domains Inc.10 Jul 202314 Jul 202510 Jul 2026
468elietgo.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Jul 202323 Aug 202412 Jul 2024
469eliete.agencyNameCheap, Inc.14 Jul 202314 Jul 202514 Jul 2026
470elieta-lv.infoPDR Ltd. d/b/a PublicDomainRegistry.com16 Jul 202327 Aug 202416 Jul 2024
471elieta-tiesas.netPDR Ltd. d/b/a PublicDomainRegistry.com15 Jul 202326 Aug 202415 Jul 2024
472elietiansales.comBeijing Lanhai Jiye Technology Co., Ltd18 Jul 202319 Aug 202418 Jul 2024
473eliettesecurityservice.comGoDaddy.com, LLC20 Jul 202325 Jul 202520 Jul 2026
474elietiti.com1&1 Internet AG21 Jul 202321 Jul 202321 Jul 2026
475eliettestores.comTucows Domains Inc.23 Jul 20233 Oct 202423 Jul 2024
476elietteservices30.comLigne Web Services SARL30 Jul 202328 Sep 202430 Jul 2024
477elietharias.comGoogle, Inc.29 Jul 202328 Sep 202429 Jul 2024
478elietshop.comName.com, Inc.5 Aug 202318 Sep 20245 Aug 2024
479elietremblay.onlinePDR Ltd. d/b/a PublicDomainRegistry.com9 Aug 202315 Oct 20249 Aug 2024
480elietb.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…11 Aug 202313 Aug 202411 Aug 2025
481elieta-lv.netPDR Ltd. d/b/a PublicDomainRegistry.com29 Aug 202310 Oct 202429 Aug 2024
482elietanios.xyzNameCheap, Inc.7 Sep 202319 Oct 20247 Sep 2024
483elieterodrigues.onlinePDR Ltd. d/b/a PublicDomainRegistry.com16 Sep 202317 Sep 202416 Sep 2025
484elietwolfe.comGoogle, Inc.23 Sep 202323 Oct 202423 Sep 2024
485elietstaffinginc.comCloud Yuqu LLC27 Sep 202310 Nov 202427 Sep 2024
486eliet24.comNetArt Registrar Sp. z o.o.30 Sep 202310 Nov 202430 Sep 2024
487eliettezamara.comGoogle, Inc.6 Oct 202321 Sep 20246 Oct 2025
488elietenlights.comGoDaddy.com, LLC7 Oct 20237 Oct 20237 Oct 2025
489elietaharius.comBeijing Lanhai Jiye Technology Co., Ltd11 Oct 202326 Jul 202511 Oct 2025
490elietsenkoro.onlineHostinger, UAB18 Oct 20231 Dec 202418 Oct 2024
491elietefonseca.onlinePDR Ltd. d/b/a PublicDomainRegistry.com19 Oct 202325 Dec 202419 Oct 2024
492eliethesthetic.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Oct 202331 Dec 202419 Oct 2024
493eliethsaldana.comNameCheap, Inc.19 Oct 202331 Dec 202419 Oct 2024
494eliethewig-andco.comTucows Domains Inc.31 Oct 20234 Nov 202431 Oct 2025
495elietebaby.comTucows Domains Inc.4 Nov 202315 Jan 20254 Nov 2024
496elietteskawaiishop.comTucows Domains Inc.4 Nov 202315 Jan 20254 Nov 2024
497elietedgemediagroup.comNetwork Solutions, LLC14 Nov 202327 Jan 202514 Nov 2024
498elieterabellobuffet.onlineGoDaddy.com, LLC17 Nov 202321 Feb 202517 Nov 2025
499elieterabellobuffet.siteHostinger, UAB17 Nov 202330 Jan 202517 Nov 2024
500elietechimneysweeprepairservices.xyzGoDaddy.com, LLC21 Nov 20231 Feb 202521 Nov 2024
501elietme.comRegister.it SPA22 Nov 202325 Dec 202422 Nov 2024
502elieta-pieslegties-lv.comNICENIC INTERNATIONAL GROUP CO., LIMITED26 Nov 20235 Jan 202526 Nov 2024
503elietme.co.uk-22 Nov 202322 Nov 202322 Nov 2024
504elietaharitk.comDNSPod, Inc.27 Nov 202327 Jan 202527 Nov 2024
505elieta-lv-riga-0512.comNICENIC INTERNATIONAL GROUP CO., LIMITED4 Dec 202313 Feb 20254 Dec 2024
506elietark.comGoDaddy.com, LLC12 Dec 202312 Dec 202312 Dec 2024
507elietsera.comNameCheap, Inc.13 Dec 202324 Feb 202513 Dec 2024
508elietspice.comNamesilo, LLC8 Jan 202410 Mar 20258 Jan 2025
509eliethalvescoaching.onlinePDR Ltd. d/b/a PublicDomainRegistry.com21 Jan 202427 Feb 202521 Jan 2025
510eliethalvescoaching.storePDR Ltd. d/b/a PublicDomainRegistry.com21 Jan 202427 Feb 202521 Jan 2025
511eliethalvescoaching.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Jan 202415 Feb 202521 Jan 2026
512elietesilva1357gmall.comTucows Domains Inc.26 Jan 202426 Jan 202426 Jan 2025
513elieta-lv1.netPDR Ltd. d/b/a PublicDomainRegistry.com26 Jan 20249 Apr 202526 Jan 2025
514elieta-lv26.netPDR Ltd. d/b/a PublicDomainRegistry.com27 Jan 202428 Jan 202527 Jan 2026
515elieta-lv29.netPDR Ltd. d/b/a PublicDomainRegistry.com27 Jan 202410 Apr 202527 Jan 2025
516elieteoptical.orgGoDaddy.com, LLC28 Jan 20242 Sep 202428 Jan 2026
517elietedominance.comGoDaddy.com, LLC12 Feb 202412 Feb 202412 Feb 2025
518elieta-gov-riga.netPDR Ltd. d/b/a PublicDomainRegistry.com19 Feb 20242 Apr 202519 Feb 2025
519elieteseabraadvogada.com.br-11 Jan 202227 Jan 202511 Jan 2025
520elietahariusa.comBeijing Lanhai Jiye Technology Co., Ltd29 Feb 20241 Mar 202528 Feb 2026
521elietoncare.comGoogle, Inc.29 Feb 202413 Feb 202528 Feb 2026
522elietedanet.onlineGoDaddy.com, LLC4 Mar 202415 Apr 20254 Mar 2025
523elietane.comCloudFlare, Inc.4 Mar 202414 May 20254 Mar 2025
524elietuil.comLigne Web Services SARL8 Mar 20248 Mar 20248 Mar 2026
525eliethauling.comGoDaddy.com, LLC15 Mar 20243 Aug 202415 Mar 2025
526eliethomeinspections.comWix.com Ltd.15 Mar 202425 Apr 202515 Mar 2025
527eliette-bourgeois.comOVH sas19 Mar 202424 Mar 202519 Mar 2026
528eliethandyman.co.uk-2 Apr 20242 Apr 20242 Apr 2027
529eliethehallwaycat.comGoDaddy.com, LLC4 Apr 20246 Mar 20254 Apr 2026
530elietkabelis.lt-28 Jul 2020-29 Jul 2026
531eliettensindu.comGoDaddy.com, LLC14 Apr 202414 Apr 202414 Apr 2026
532elietahari.shopWeb Commerce Communications Limited dba WebNic.cc20 Sep 202311 Oct 202320 Sep 2024
533elietaharitk.topDNSPod, Inc.12 Dec 202311 Jan 202512 Dec 2024
534elieteimoveis.com.br-8 Jul 200926 Jun 20258 Jul 2027
535eliette.com.au--21 Apr 2024-
536elietuva.lt-15 May 2012-16 May 2026
537elietahsale.shopNameCheap, Inc.7 Apr 20238 Apr 20247 Apr 2025
538elietmachines.co.uk-5 Oct 202126 Jul 20245 Oct 2024
539elietouchflooring.com1&1 Internet AG22 Apr 20247 May 202422 Apr 2026
540elietaharid.shopNameKing.com Inc.24 Feb 202422 Mar 202424 Feb 2025
541eliette.storeCrazy Domains FZ-LLC29 Apr 202412 Jun 202529 Apr 2025
542elietahari.ru-14 Nov 2006-14 Nov 2025
543elietontour.eu----
544elietvatten.se-26 Dec 202011 Dec 202426 Dec 2025
545elietkid.com-13 May 202429 Jul 202513 May 2027
546eliettemouly.shopNamesilo, LLC15 May 202418 Jun 202515 May 2025
547elietattoo.comPDR Ltd. d/b/a PublicDomainRegistry.com15 May 20249 May 202515 May 2027
548eliette-l.frInfomaniak Network SA23 Jul 20192 Jul 202523 Jul 2026
549elietstones.comGoDaddy.com, LLC26 May 202427 May 202526 May 2026
550elietsi.comNameCheap, Inc.28 May 20249 Aug 202528 May 2025
551elietonecompany.comGoDaddy.com, LLC6 Jun 202418 Jul 20256 Jun 2025
552elietonecompanylimited.comGoDaddy.com, LLC6 Jun 202417 Jul 20256 Jun 2025
553elietfashion.xyzWeb Commerce Communications Limited dba WebNic.cc8 Jun 202418 Jul 20258 Jun 2025
554elietpierre-avocats.comAFRIREGISTER S.A.1 Jul 202430 Jun 20251 Jul 2026
555elietteyoga.comAutomattic Inc.2 Jul 20245 Jul 20252 Jul 2026
556eliethdomingos.comGoogle, Inc.7 Jul 202423 Jun 20257 Jul 2026
557elietaharisaleus.comName.com, Inc.11 Jul 20248 Jul 202511 Jul 2026
558eliettelacroix.shopPDR Ltd. d/b/a PublicDomainRegistry.com17 Jul 202418 Feb 202517 Jul 2025
559elietrans.comHostinger, UAB19 Jul 202419 Jul 202519 Jul 2025
560elietonhomecare.comWix.com Ltd.19 Jul 202420 Jul 202519 Jul 2026
561elietengage.comHostinger, UAB28 Jul 20243 Jul 202528 Jul 2026
562elietaharifashion.shopPDR Ltd. d/b/a PublicDomainRegistry.com30 Jul 202426 Sep 202430 Jul 2025
563elietlending.comGoDaddy.com, LLC7 Aug 20248 Aug 20247 Aug 2026
564elieteventsandgalas.comGoDaddy.com, LLC13 Aug 202413 Aug 202413 Aug 2026
565elietfashion.comHostinger, UAB15 Aug 202415 Oct 202415 Aug 2025
566elietaharionline.shopWeb Commerce Communications Limited dba WebNic.cc19 Aug 20249 Sep 202419 Aug 2025
567elietonecompany.neteNom, Inc.20 Aug 202422 Jul 202520 Aug 2026
568elietemotiva.comeNom, Inc.22 Sep 202422 Sep 202422 Sep 2025
569elietteroque.com1&1 Internet AG26 Sep 202426 Sep 202426 Sep 2025
570eliette4w.comGoogle, Inc.27 Sep 202427 Sep 202427 Sep 2025
571elietech.netNameCheap, Inc.29 Sep 202429 Sep 202429 Sep 2025
572elietaharidenim.comDynadot, LLC30 Sep 202420 Oct 202430 Sep 2025
573elietshiapps-eta.onlineNetwork Solutions, LLC9 Oct 202414 Oct 20249 Oct 2025
574elietshiapps-eta.comNetwork Solutions, LLC9 Oct 20249 Oct 20249 Oct 2025
575elietelogistics.comGoDaddy.com, LLC11 Oct 202411 Oct 202411 Oct 2025
576elieta-project-deploy.siteHostinger, UAB13 Nov 202418 Nov 202413 Nov 2025
577elietayar.guruGoDaddy.com, LLC17 Nov 202422 Nov 202417 Nov 2025
578elietexperience.comRegister NV dba Register.eu19 Nov 202419 Nov 202419 Nov 2025
579elieteramos.comTucows Domains Inc.26 Nov 202426 Nov 202426 Nov 2025
580elieth.store1&1 Internet AG29 Nov 202430 Jan 202529 Nov 2025
581elieth.online1&1 Internet AG29 Nov 202430 Jan 202529 Nov 2025
582elieta-civillieta.comNICENIC INTERNATIONAL GROUP CO., LIMITED13 Dec 202413 Dec 202413 Dec 2025
583elieteinc.comGoDaddy.com, LLC15 Dec 202415 Dec 202415 Dec 2025
584elieta-tiesas-lv.comNICENIC INTERNATIONAL GROUP CO., LIMITED16 Dec 202416 Dec 202416 Dec 2025
585elietefreitasatelier.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Dec 202417 Feb 202518 Dec 2025
586elieteagencypartner.comRegister.it SPA22 Dec 202422 Dec 202422 Dec 2025
587eliette.techAscio Technologies, Inc. Danmark - Filial af Ascio…23 Dec 202430 Jul 202523 Dec 2025
588elietaharie.uk-26 Dec 20242 Jan 202526 Dec 2025
589elietaharisales.comBeijing Lanhai Jiye Technology Co., Ltd31 Dec 202426 Jun 202531 Dec 2025
590elietevaldes.comHostinger, UAB26 Jan 202526 Jan 202526 Jan 2026
591eliet-bighands.comRegister NV dba Register.eu28 Jan 202528 Jan 202528 Jan 2026
592elietebolognani.comRegister.it SPA8 Feb 202514 Feb 20258 Feb 2026
593elietech.storeNameCheap, Inc.13 Feb 20253 Mar 202513 Feb 2026
594elietivacari.com.br-1 Nov 202117 Oct 20241 Nov 2025
595elietenunes.com.br-1 Jul 202212 Jul 20231 Jul 2026
596elietoz.comGoDaddy.com, LLC26 Feb 202526 Feb 202526 Feb 2026
597eliettemama.comGoDaddy.com, LLC4 Mar 20254 Mar 20254 Mar 2026
598eliettech.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Mar 202510 May 202510 Mar 2026
599eliethservicesltd.co.uk-7 Mar 20257 Mar 20257 Mar 2026
600elietal.orgSquarespace Domains LLC10 Mar 202515 Mar 202510 Mar 2028
601elietal.llcPorkbun, LLC10 Mar 202515 Mar 202510 Mar 2027
602elietal.comSquarespace Domains LLC10 Mar 202510 Mar 202510 Mar 2028
603elietal.netSquarespace Domains LLC10 Mar 202510 Mar 202510 Mar 2028
604elietradeubs.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Mar 202514 May 202514 Mar 2026
605elietebarros.comPSI-USA, Inc. dba Domain Robot13 Mar 20252 May 202513 Mar 2026
606elietepaula.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Mar 202516 May 202516 Mar 2026
607elietcorpo.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Mar 202518 May 202518 Mar 2026
608eliettekrakora.comWix.com Ltd.18 Mar 202518 Mar 202518 Mar 2027
609elieteespetos.comGoogle, Inc.19 Mar 20253 Apr 202519 Mar 2026
610elietoncare.orgTucows Domains Inc.20 Mar 20256 Apr 202520 Mar 2027
611elieth-domingos.comGoogle, Inc.29 Mar 202513 Apr 202529 Mar 2026
612elietewellness.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Apr 20254 Jun 20254 Apr 2026
613elietoufic.comPorkbun, LLC5 Apr 20255 Apr 20255 Apr 2026
614eliettehealthfit.comNameCheap, Inc.17 Apr 202521 Apr 202517 Apr 2026
615elietoro.shopWest263 International Limited21 Apr 202519 May 202521 Apr 2026
616elietfkanzaministeries.orgHostinger, UAB27 Apr 20252 May 202527 Apr 2028
617eliethbijoux.comTucows Domains Inc.8 May 20259 May 20258 May 2026
618eliet-toys.comRegister.it SPA15 May 202515 May 202515 May 2026
619elietegomessoares.comHosting Concepts B.V. dba Openprovider15 May 202522 Jul 202515 May 2026
620elietestingthings.onlineGoDaddy.com, LLC29 May 202529 Jul 202529 May 2026
621elietepersonalizado.com.br-3 Jun 20253 Jun 20253 Jun 2030
622elietyhockey.comName.com, Inc.9 Jun 20259 Jun 20259 Jun 2026
623eliettebeautycenter.comSquarespace Domains LLC15 Jun 202515 Jun 202515 Jun 2026
624elietecontabil.com.br-17 Jan 20204 Feb 202117 Jan 2031
625elietahai.comDynadot, LLC1 Jul 20252 Jul 20251 Jul 2026
626elietta.comHostinger, UAB6 Jul 20256 Jul 20256 Jul 2026
627elietaari.comDynadot, LLC6 Jul 20256 Jul 20256 Jul 2026
628eliet3stream.appNameCheap, Inc.16 Jul 2025-16 Jul 2026
629eliettemaid.comNameCheap, Inc.23 Jul 202524 Jul 202523 Jul 2026
630eliethnochic.comName.com, Inc.24 Jul 202524 Jul 202524 Jul 2028
631elietecarvalho.com.br-13 Jun 202416 Jul 202513 Jun 2026
632elietrading.comGoDaddy.com, LLC6 Aug 20256 Aug 20256 Aug 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=eliet

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now