With support for 
Keyword: DERRY
Reverse Whois » KEYWORD [derry ] { 2,777 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | derry.nh.us | - | 5 Feb 2003 | 9 Nov 2012 | 4 Feb 2015 |
| 2 | derry.biz | Blacknight Internet Solutions Ltd. | 23 Jun 2016 | 30 Jun 2025 | 22 Jun 2025 |
| 3 | derry.voting | RegistryGate GmbH | 23 Jul 2014 | - | 23 Jul 2015 |
| 4 | derry.xyz | West263 International Limited | 21 Sep 2021 | 22 Sep 2021 | 21 Sep 2027 |
| 5 | derry.property | Uniregistrar Corp | 31 Jan 2015 | 17 Mar 2017 | 31 Jan 2018 |
| 6 | derry.london | Mesh Digital Limited | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 7 | derry.science | Alpnames Limited | 24 Feb 2015 | 1 May 2015 | 23 Feb 2016 |
| 8 | derry.date | Alpnames Limited | 1 Jul 2015 | - | 30 Jun 2016 |
| 9 | derry.faith | Alpnames Limited | 2 Jul 2015 | - | 1 Jul 2016 |
| 10 | derry.review | Alpnames Limited | 1 Jul 2015 | - | 30 Jun 2016 |
| 11 | derry.love | Porkbun, LLC | 29 Sep 2015 | 22 Aug 2016 | 29 Sep 2017 |
| 12 | derry.club | CommuniGal Communication Ltd. | 26 Feb 2025 | 3 Mar 2025 | 26 Feb 2026 |
| 13 | derry.website | NameCheap, Inc. | 30 Nov 2015 | 30 Nov 2015 | 30 Nov 2016 |
| 14 | derry.link | Alpnames Limited | 4 Mar 2016 | 14 Apr 2017 | 4 Mar 2017 |
| 15 | derry.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 6 Feb 2020 | - | 6 Feb 2027 |
| 16 | derry.click | Alpnames Limited | 7 Mar 2016 | 17 Apr 2017 | 7 Mar 2017 |
| 17 | derry.com | Register.it SPA | 8 Aug 2009 | 4 Sep 2024 | 4 Sep 2028 |
| 18 | derry.build | 1&1 Internet AG | 2 May 2014 | 3 Jul 2025 | 2 May 2026 |
| 19 | derry.lgbt | NameCheap, Inc. | 23 Jun 2016 | 26 May 2017 | 23 Jun 2018 |
| 20 | derry.design | Tucows Domains Inc. | 3 May 2022 | 7 May 2025 | 3 May 2026 |
| 21 | derry.space | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 7 Jun 2016 | 12 Jun 2016 | 7 Jun 2017 |
| 22 | derry.city | Crazy Domains FZ-LLC | 12 Jul 2016 | 12 Jul 2025 | 12 Jul 2026 |
| 23 | derry.party | Alpnames Limited | 17 Feb 2015 | 3 Mar 2016 | 16 Feb 2019 |
| 24 | derry.photography | Tucows Domains Inc. | 22 May 2014 | 2 Jul 2020 | 22 May 2020 |
| 25 | derry.jobs | Name Share, Inc. | 4 Feb 2010 | 21 Mar 2016 | 4 Feb 2017 |
| 26 | derry.webcam | Alpnames Limited | 9 Jun 2014 | 9 Jun 2016 | 8 Jun 2017 |
| 27 | derry.trade | Alpnames Limited | 9 Jun 2014 | 13 Jul 2016 | 8 Jun 2017 |
| 28 | derry.tech | Xiamen ChinaSource Internet Service Co., Ltd. | 21 Dec 2019 | 2 Jan 2025 | 21 Dec 2025 |
| 29 | derry.info | GoDaddy.com, LLC | 2 Oct 2024 | 7 Oct 2024 | 2 Oct 2025 |
| 30 | derry.net | 1&1 Internet AG | 16 Oct 1997 | 5 Dec 2024 | 15 Oct 2026 |
| 31 | derry.org | Register.it SPA | 13 Apr 1998 | 27 May 2025 | 12 Apr 2027 |
| 32 | derry.us | GoDaddy.com, LLC | 17 Jul 2013 | 17 Jul 2017 | 16 Jul 2018 |
| 33 | derry.de | - | - | 25 Feb 2016 | - |
| 34 | derry.dk | - | 14 Dec 2000 | - | 31 Dec 2025 |
| 35 | derry.it | - | 28 Jul 2022 | 29 Aug 2025 | 28 Jul 2025 |
| 36 | derry.co.uk | - | 4 Dec 1996 | 2 Dec 2024 | 4 Dec 2026 |
| 37 | derry.tv | Blacknight Internet Solutions Ltd. | 13 Feb 2003 | 22 Jan 2025 | 13 Feb 2026 |
| 38 | derry.win | Xin Net Technology Corporation | 12 Dec 2016 | 18 Feb 2017 | 11 Dec 2026 |
| 39 | derry.store | GoDaddy.com, LLC | 30 Jan 2025 | 28 Mar 2025 | 30 Jan 2026 |
| 40 | derry.me.uk | - | 20 Jul 2005 | 20 Jun 2017 | 20 Jul 2019 |
| 41 | derry.guide | GoDaddy.com, LLC | 6 Jul 2019 | 7 Jul 2020 | 6 Jul 2021 |
| 42 | derry.life | GoDaddy.com, LLC | 22 Jan 2024 | 5 Mar 2025 | 22 Jan 2025 |
| 43 | derry.homes | Global Domains International, Inc. DBA DomainCostC… | 2 Jul 2020 | 10 Aug 2024 | 2 Jul 2024 |
| 44 | derry.travel | NameCheap, Inc. | 15 Mar 2021 | 15 Mar 2021 | 15 Mar 2022 |
| 45 | derry.digital | NameCheap, Inc. | 4 Jun 2022 | 5 Jun 2023 | 4 Jun 2024 |
| 46 | derry.cn | - | 18 Dec 2011 | - | 18 Dec 2026 |
| 47 | derry.id | - | 1 Sep 2016 | 25 Jul 2022 | 1 Sep 2023 |
| 48 | derry.one | GoDaddy.com, LLC | 8 Dec 2022 | 14 Dec 2024 | 8 Dec 2025 |
| 49 | derry.app | Gandi SAS | 4 Mar 2019 | - | 24 Apr 2026 |
| 50 | derry.apartments | NameCheap, Inc. | 9 Apr 2021 | 24 Apr 2023 | 9 Apr 2024 |
| 51 | derry.be | - | 23 Aug 2004 | - | - |
| 52 | derry.blog | NameCheap, Inc. | 20 May 2025 | 19 Jul 2025 | 20 May 2026 |
| 53 | derry.buzz | GoDaddy.com, LLC | 16 Nov 2018 | 22 Nov 2024 | 16 Nov 2026 |
| 54 | derry.ca | Namespro Solutions Inc. | 7 Dec 2016 | 21 Jan 2025 | 7 Dec 2025 |
| 55 | derry.asia | DNSPod, Inc. | 3 Feb 2023 | 3 Apr 2024 | 3 Feb 2024 |
| 56 | derry.id.au | - | - | 10 Dec 2023 | - |
| 57 | derry.dev | NameCheap, Inc. | 29 Jun 2024 | 20 May 2025 | 29 Jun 2026 |
| 58 | derry.fun | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 22 Jun 2021 | 31 Aug 2023 | 22 Jun 2031 |
| 59 | derry.news | CommuniGal Communication Ltd. | 3 Feb 2025 | 8 Feb 2025 | 3 Feb 2026 |
| 60 | derry.bio | NameCheap, Inc. | 25 Apr 2023 | 7 Jun 2024 | 25 Apr 2024 |
| 61 | derry.center | GoDaddy.com, LLC | 14 Aug 2023 | 20 Aug 2025 | 14 Aug 2027 |
| 62 | derry.tools | Name.com, Inc. | 28 Nov 2023 | 12 Jan 2025 | 28 Nov 2025 |
| 63 | derry.wtf | Name.com, Inc. | 28 Nov 2023 | 12 Jan 2025 | 28 Nov 2025 |
| 64 | derry.photos | NameCheap, Inc. | 18 Jan 2024 | 24 Dec 2024 | 18 Jan 2026 |
| 65 | derry.pizza | Squarespace Domains LLC | 14 Mar 2024 | 3 Jun 2025 | 14 Mar 2026 |
| 66 | derry.uk | - | 2 Jul 2019 | 21 Jul 2025 | 2 Jul 2026 |
| 67 | derry.ru | - | 16 Jan 2018 | - | 16 Jan 2026 |
| 68 | derry.me | CommuniGal Communication Ltd. | 5 Jul 2024 | 17 Aug 2025 | 5 Jul 2025 |
| 69 | derry.world | GoDaddy.com, LLC | 17 Aug 2024 | 22 Aug 2024 | 17 Aug 2025 |
| 70 | derry.tours | GoDaddy.com, LLC | 2 Oct 2024 | 13 Feb 2025 | 2 Oct 2025 |
| 71 | derry.work | GoDaddy.com, LLC | 15 Nov 2024 | 20 Nov 2024 | 15 Nov 2029 |
| 72 | derry.nl | - | 5 Mar 2024 | 4 Jun 2024 | - |
| 73 | derry.express | GoDaddy.com, LLC | 28 May 2025 | 2 Jun 2025 | 28 May 2026 |
| 74 | derryjournal.com | Register.it SPA | 18 Oct 2015 | 3 Jun 2025 | 15 Jul 2026 |
| 75 | derrycity.gov.uk | - | - | - | - |
| 76 | derrydaily.net | Blacknight Internet Solutions Ltd. | 10 Sep 2012 | 22 Aug 2024 | 10 Sep 2025 |
| 77 | derrynow.com | Blacknight Internet Solutions Ltd. | 30 Mar 2011 | 25 Mar 2025 | 30 Mar 2026 |
| 78 | derrycitybuzz.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 79 | derrykiernan.com | GoDaddy.com, LLC | 23 Oct 2014 | 6 Oct 2022 | 23 Oct 2025 |
| 80 | derryfieldoh.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 81 | derrybnb.com | GoDaddy.com, LLC | 26 May 2012 | 27 May 2015 | 26 May 2016 |
| 82 | derryberryair.com | GoDaddy.com, LLC | 9 Feb 2012 | 19 Apr 2015 | 9 Feb 2016 |
| 83 | derryapartment.com | DROPCATCH.COM 834 LLC | 8 Aug 2018 | 8 Aug 2018 | 8 Aug 2019 |
| 84 | derrycitysguidedtours.com | - | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2017 |
| 85 | derrynjames.com | GoDaddy.com, LLC | 31 May 2012 | 1 Jun 2015 | 31 May 2016 |
| 86 | derryfest.com | TurnCommerce, Inc. DBA NameBright.com | 1 Jul 2014 | 25 Jun 2020 | 1 Jul 2026 |
| 87 | derryberryestates.com | GoDaddy.com, LLC | 14 Oct 2019 | 14 Aug 2024 | 14 Oct 2026 |
| 88 | derrypetsitting.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2016 | 29 Oct 2017 |
| 89 | derrypetsitter.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2016 | 29 Oct 2017 |
| 90 | derryherk.com | NameCheap, Inc. | 29 Oct 2014 | 29 Sep 2024 | 29 Oct 2025 |
| 91 | derrydogwalking.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2016 | 29 Oct 2017 |
| 92 | derrydogwalker.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2016 | 29 Oct 2017 |
| 93 | derryalaska.com | GoDaddy.com, LLC | 30 Oct 2014 | 6 Oct 2023 | 30 Oct 2025 |
| 94 | derrywholesaleauto.com | GoDaddy.com, LLC | 6 Jan 2012 | 17 Dec 2024 | 6 Jan 2026 |
| 95 | derryfeed.com | Hongkong Domain Name Information Management Co., L… | 24 Oct 2022 | 2 Dec 2023 | 24 Oct 2023 |
| 96 | derry-firenh.org | - | - | - | - |
| 97 | derrytwp.org | GoDaddy.com, LLC | 12 Sep 2023 | 27 Oct 2024 | 12 Sep 2025 |
| 98 | derrytwp.info | 1&1 Internet AG | 6 Jan 2010 | 20 Feb 2025 | 6 Jan 2026 |
| 99 | derrypres.org | Network Solutions, LLC | 29 Apr 1999 | 24 Jan 2022 | 29 Apr 2027 |
| 100 | derrynew.com | Moniker Online Services LLC | 29 Nov 2005 | 8 Jun 2015 | 29 Mar 2016 |
| 101 | derrytownship.org | Network Solutions, LLC | 5 Aug 1999 | 11 Jun 2024 | 5 Aug 2026 |
| 102 | derrynews.com | Brandsight, Inc. | 31 Jan 1996 | 1 Jan 2025 | 1 Feb 2026 |
| 103 | derry-nh.org | GoDaddy.com, LLC | 5 Mar 2001 | 17 Apr 2025 | 5 Mar 2026 |
| 104 | derryfire.com | GoDaddy.com, LLC | 10 Oct 2003 | 14 Oct 2022 | 10 Oct 2027 |
| 105 | derryberrylaw.com | GoDaddy.com, LLC | 28 Aug 1998 | 28 Aug 2025 | 27 Aug 2026 |
| 106 | derrynh.org | Network Solutions, LLC | 19 Mar 2012 | 18 Jan 2022 | 19 Mar 2027 |
| 107 | derrycats.org | NameCheap, Inc. | 19 Jan 2024 | 5 Mar 2025 | 19 Jan 2026 |
| 108 | derryfieldschool.com | Fabulous.com Pty Ltd. | 18 Oct 2005 | 3 Nov 2017 | 18 Oct 2018 |
| 109 | derryautoservice.com | GoDaddy.com, LLC | 19 Dec 2023 | 19 Dec 2023 | 19 Dec 2026 |
| 110 | derryrsmith.com | Google, Inc. | 19 Aug 2014 | 4 Aug 2025 | 19 Aug 2026 |
| 111 | derrygroup.com | GoDaddy.com, LLC | 24 Jun 2015 | 27 Dec 2024 | 31 Jan 2026 |
| 112 | derrycert.org | Dynadot, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 113 | derryarts.org | GoDaddy.com, LLC | 13 Nov 1997 | 15 Aug 2024 | 12 Nov 2031 |
| 114 | derryandwallis.com | GMO Internet Inc. | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 115 | derrykingdom.com | Tucows Domains Inc. | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 116 | derryhamstables.com | Network Solutions, LLC | 6 Nov 2014 | 24 May 2024 | 6 Nov 2026 |
| 117 | derryfurniture.com | Xin Net Technology Corporation | 12 Aug 2014 | 10 Aug 2021 | 12 Aug 2030 |
| 118 | derrysport.com | GoDaddy.com, LLC | 28 Oct 2017 | 8 Jan 2025 | 28 Oct 2024 |
| 119 | derryberrymassage.com | Google, Inc. | 14 Aug 2014 | 30 Jul 2025 | 14 Aug 2026 |
| 120 | derrydentalimplants.com | GoDaddy.com, LLC | 15 Aug 2014 | 16 Aug 2025 | 15 Aug 2026 |
| 121 | derrydentalimplants.net | GoDaddy.com, LLC | 15 Aug 2014 | 12 Feb 2023 | 15 Aug 2026 |
| 122 | derrydoc.net | Marcaria.com International, Inc. | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 123 | derrylandcompany.com | GoDaddy.com, LLC | 15 Aug 2014 | 16 Aug 2024 | 15 Aug 2026 |
| 124 | derrymurals.com | Nameling.com LLC | 25 Oct 2013 | 26 Oct 2017 | 25 Oct 2018 |
| 125 | derryplantation.com | GoDaddy.com, LLC | 15 Aug 2014 | 16 Aug 2024 | 15 Aug 2026 |
| 126 | derryappraisal.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 127 | derrycommercial.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 128 | derrycondos.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 129 | derryforeclosures.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 130 | derryland.com | TurnCommerce, Inc. DBA NameBright.com | 15 Nov 2020 | 26 Jan 2025 | 15 Nov 2024 |
| 131 | derrymultifamily.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 132 | derrynewconstruction.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 133 | derrynhappraisal.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 134 | derrynhcommercial.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 135 | derrynhforeclosures.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 136 | derrynhland.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 137 | derrynhmultifamily.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 138 | derrynhnewconstruction.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 139 | derrynhwaterfront.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 140 | derrywaterfront.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 141 | derrycontractor.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 142 | derryheen.com | Wild West Domains, LLC | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 143 | derryfarmcottages.com | Easyspace LTD | 26 Feb 2001 | 18 Jan 2024 | 26 Feb 2026 |
| 144 | derrylingunclub.com | 1&1 Internet AG | 13 Sep 2014 | 14 Sep 2016 | 13 Sep 2018 |
| 145 | derrymorefarm.com | eNom, Inc. | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2017 |
| 146 | derryneite.com | Network Solutions, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 147 | derryllwristpus.com | GoDaddy.com, LLC | 8 Jul 2019 | 8 Jul 2024 | 8 Jul 2029 |
| 148 | derryfieldparents.com | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 149 | derrymorepm.com | GoDaddy.com, LLC | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 150 | derrywalls.com | Nordreg AB | 27 Feb 2025 | 21 Jul 2025 | 27 Feb 2026 |
| 151 | derryjudo.com | Interweb Advertising D.B.A. Profile Builder | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 152 | derrynh.us | GoDaddy.com, LLC | 5 Sep 2014 | 5 Sep 2014 | 4 Sep 2015 |
| 153 | derrydrugs.com | Network Solutions, LLC | 19 Sep 2014 | 20 Sep 2014 | 19 Sep 2015 |
| 154 | derrydance.com | Metaregistrar BV Applications | 8 Feb 2025 | 9 Apr 2025 | 8 Feb 2026 |
| 155 | derryprilian.net | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2014 | 18 Sep 2015 |
| 156 | derryprilian.com | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2014 | 18 Sep 2015 |
| 157 | derry-prilian.net | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2014 | 18 Sep 2015 |
| 158 | derryarea.org | Google, Inc. | 6 Sep 2021 | 28 Aug 2025 | 6 Sep 2026 |
| 159 | derryplumber.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 160 | derrysuter.com | Beijing Lanhai Jiye Technology Co., Ltd | 31 Jul 2024 | 26 Jul 2025 | 31 Jul 2026 |
| 161 | derryleckaghcontracts.com | Webfusion Ltd. | 11 Sep 2014 | 4 Sep 2017 | 11 Sep 2018 |
| 162 | derrynewhampshireclassifieds.com | Wild West Domains, LLC | 2 Oct 2014 | 4 Aug 2016 | 2 Oct 2017 |
| 163 | derrypages.com | - | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2016 |
| 164 | derry-prilian.org | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2014 | 18 Sep 2015 |
| 165 | derryprilian.org | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2014 | 18 Sep 2015 |
| 166 | derrycash.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 167 | derrynewhampshire.net | Omnis Network, LLC | 4 Sep 2007 | 29 Sep 2015 | 4 Sep 2016 |
| 168 | derrysdz.com | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 169 | derrymoretax.com | Mesh Digital Limited | 13 Oct 2014 | 28 Sep 2016 | 13 Oct 2017 |
| 170 | derry-tech.com | DomainName Path, Inc. | 4 Apr 2022 | 13 Jun 2023 | 4 Apr 2023 |
| 171 | derryguyed.com | eNom, Inc. | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 172 | derryanimalhospitalhbg.com | GoDaddy.com, LLC | 25 Nov 2014 | 17 Sep 2022 | 25 Nov 2030 |
| 173 | derrydiocese.com | - | 24 Aug 2023 | 17 Jun 2025 | 24 Aug 2026 |
| 174 | derryadama.com | 1&1 Internet AG | 26 Nov 2014 | 27 Nov 2016 | 26 Nov 2017 |
| 175 | derryberryfilm.com | Tucows Domains Inc. | 25 Nov 2013 | 29 Nov 2014 | 25 Nov 2015 |
| 176 | derryayre.com | DNC Holdings, Inc. | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 177 | derrycustomclothing.com | GoDaddy.com, LLC | 30 Nov 2014 | 30 Nov 2014 | 30 Nov 2015 |
| 178 | derry-bnb.com | GMO Internet Inc. | 1 Dec 2014 | 2 Dec 2014 | 1 Dec 2015 |
| 179 | derrymoda.com | Tucows Domains Inc. | 12 Mar 2008 | 16 Mar 2017 | 12 Mar 2017 |
| 180 | derryacupuncture.com | Tucows Domains Inc. | 3 Dec 2014 | 8 Dec 2019 | 3 Dec 2019 |
| 181 | derryfieldalumni.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 182 | derryprintstudios.com | eNom, Inc. | 13 Dec 2014 | 24 Jan 2025 | 13 Dec 2024 |
| 183 | derryberrywindowcleaning.com | GoDaddy.com, LLC | 21 Aug 2018 | 2 Oct 2024 | 21 Aug 2024 |
| 184 | derry-local.com | Name.com, Inc. | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 185 | derrynedwards.com | GoDaddy.com, LLC | 22 May 2017 | 23 May 2025 | 22 May 2027 |
| 186 | derryestateagents.com | Key-Systems GmbH | 12 Aug 2020 | 12 Aug 2020 | 12 Aug 2021 |
| 187 | derrycourts.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 188 | derrylivelist.com | 1&1 Internet AG | 28 Dec 2014 | 29 Dec 2016 | 28 Dec 2017 |
| 189 | derryastros.com | Key-Systems GmbH | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 190 | derrywedding.photography | 101domain, Inc. | 22 Jul 2014 | 22 Jul 2014 | 22 Jul 2015 |
| 191 | derryinsurance.xyz | Network Solutions, LLC | 27 Jul 2014 | 27 Jul 2014 | 27 Jul 2015 |
| 192 | derrymeeting.house | Tucows Domains Inc. | 30 Jul 2014 | 29 Jul 2025 | - |
| 193 | derryjsc.com | Launchpad, Inc. | 11 Aug 2015 | 27 Jul 2017 | 11 Aug 2018 |
| 194 | derrylma.pink | 1API GmbH | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 195 | derryvillage.webcam | Alpnames Limited | 27 Nov 2014 | 27 Nov 2014 | 26 Nov 2015 |
| 196 | derryvillage.trade | Alpnames Limited | 27 Nov 2014 | 27 Nov 2014 | 26 Nov 2015 |
| 197 | derrymore.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 198 | derrytaberna.eus | Key-Systems, LLC | 23 Mar 2015 | 23 Mar 2015 | 23 Mar 2016 |
| 199 | derryvillage.science | Alpnames Limited | 24 Feb 2015 | 1 May 2015 | 23 Feb 2016 |
| 200 | derrybeg.xyz | Gandi SAS | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2016 |
| 201 | derrylinks.com | Internet Domain Services BS Corp | 28 Dec 1999 | 14 May 2016 | 28 Dec 2017 |
| 202 | derrytreskgac.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2015 | 31 Dec 2024 | 8 Jan 2026 |
| 203 | derrymusiccity.com | Tucows Domains Inc. | 6 Jan 2014 | 10 Jan 2015 | 6 Jan 2016 |
| 204 | derryweb.com | DropCatch.com 370 LLC | 11 Jan 2015 | 12 Jan 2017 | 11 Jan 2018 |
| 205 | derrysellshouses.com | Tucows Domains Inc. | 13 Jan 2015 | 17 Jan 2016 | 13 Jan 2017 |
| 206 | derrypropertiesllc.com | Tucows Domains Inc. | 13 Jan 2015 | 17 Jan 2016 | 13 Jan 2017 |
| 207 | derrynaneinshorerescue.com | CloudFlare, Inc. | 13 Jan 2015 | 19 Dec 2024 | 13 Jan 2026 |
| 208 | derrybuyshouses.com | Tucows Domains Inc. | 13 Jan 2015 | 17 Jan 2016 | 13 Jan 2017 |
| 209 | derrywoodhealthcare.com | Register.it SPA | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2017 |
| 210 | derrycityfootball.club | 1API GmbH | 7 May 2014 | 12 Jun 2015 | 6 May 2016 |
| 211 | derryvillage.date | Alpnames Limited | 1 Jul 2015 | - | 30 Jun 2016 |
| 212 | derryvillage.faith | Alpnames Limited | 2 Jul 2015 | - | 1 Jul 2016 |
| 213 | derryhotels.review | Alpnames Limited | 2 Jul 2015 | - | 1 Jul 2016 |
| 214 | derryvillage.review | Alpnames Limited | 1 Jul 2015 | - | 30 Jun 2016 |
| 215 | derryvillagehotels.review | Alpnames Limited | 4 Jul 2015 | - | 3 Jul 2016 |
| 216 | derryvillage.accountant | Alpnames Limited | 7 Aug 2015 | - | 6 Aug 2016 |
| 217 | derryrunner.com | GoDaddy.com, LLC | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 218 | derry07.com | - | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2017 |
| 219 | derrydonegalphoto.com | GoDaddy.com, LLC | 21 Jan 2015 | 21 Jan 2015 | 21 Jan 2016 |
| 220 | derryfieldschool.net | GoDaddy.com, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 221 | derrybooks.com | Wix.com Ltd. | 21 Apr 2020 | 1 Jun 2025 | 21 Apr 2025 |
| 222 | derrycityofmusic.com | Tucows Domains Inc. | 13 Apr 2015 | 17 Apr 2017 | 13 Apr 2017 |
| 223 | derryqueen.com | GoDaddy.com, LLC | 3 May 2023 | 3 May 2023 | 3 May 2024 |
| 224 | derryberryconcretedesigns.net | eNom, Inc. | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 225 | derryscorey.com | Webfusion Ltd. | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2017 |
| 226 | derryrevitalization.com | Internet Domain Services BS Corp | 8 May 2021 | 8 May 2021 | 8 May 2022 |
| 227 | derrylove.info | GoDaddy.com, LLC | 13 Feb 2015 | - | 13 Feb 2016 |
| 228 | derrytimes.com | TurnCommerce, Inc. DBA NameBright.com | 8 Nov 2018 | 18 Jan 2025 | 8 Nov 2024 |
| 229 | derryradio.com | eNom, Inc. | 21 Aug 2015 | 23 Jul 2017 | 21 Aug 2018 |
| 230 | derryalert.com | TurnCommerce, Inc. DBA NameBright.com | 21 Dec 2018 | 20 Dec 2018 | 20 Dec 2019 |
| 231 | derry-income.com | eNom, Inc. | 20 Feb 2015 | 20 Feb 2015 | 20 Feb 2016 |
| 232 | derrynhfleamarket.net | GoDaddy.com, LLC | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 233 | derryurgentdentalcare.com | GoDaddy.com, LLC | 23 Feb 2015 | 24 Feb 2025 | 23 Feb 2027 |
| 234 | derryurgentdental.com | GoDaddy.com, LLC | 23 Feb 2015 | 24 Feb 2025 | 23 Feb 2027 |
| 235 | derryndavies.com | Tucows Domains Inc. | 23 Feb 2015 | 27 Feb 2022 | 23 Feb 2022 |
| 236 | derrylin-plant.com | Tucows Domains Inc. | 20 Feb 2013 | 24 Feb 2015 | 20 Feb 2016 |
| 237 | derrycoxphotography.com | FastDomain Inc. | 23 Feb 2015 | 23 Feb 2017 | 23 Feb 2018 |
| 238 | derrycommunityscreen.com | Key-Systems GmbH | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 239 | derrytele.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 240 | derrysulaiman.com | CV. Rumahweb Indonesia | 4 Sep 2019 | - | 4 Sep 2020 |
| 241 | derryanddaisy.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2017 |
| 242 | derryworker.com | GoDaddy.com, LLC | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 243 | derrycraftvillagecollective.com | Wild West Domains, LLC | 3 Mar 2015 | 3 Mar 2015 | 3 Mar 2016 |
| 244 | derrydrivinglessons.com | Uniregistrar Corp | - | - | - |
| 245 | derrycityandstrabane.com | Mesh Digital Limited | 4 Mar 2015 | 10 Sep 2024 | 4 Mar 2026 |
| 246 | derryandstrabane.com | Mesh Digital Limited | 4 Mar 2015 | 10 Sep 2024 | 4 Mar 2026 |
| 247 | derryinspiringstyles.net | Domain.com, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2017 |
| 248 | derryhistorymuseum.com | Tucows Domains Inc. | 1 Jun 2020 | 13 Jun 2025 | 1 Jun 2026 |
| 249 | derryhistorymuseum.org | Tucows Domains Inc. | 14 Mar 2015 | 13 Mar 2017 | 14 Mar 2018 |
| 250 | derryfleadh.com | Tucows Domains Inc. | 13 Mar 2004 | 17 Mar 2015 | 13 Mar 2016 |
| 251 | derrygmosafety.com | Key-Systems GmbH | 24 Mar 2015 | 29 Apr 2015 | 24 Mar 2016 |
| 252 | derrythomson.com | 1&1 Internet AG | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 253 | derrykohlscards.com | Key-Systems GmbH | 25 Mar 2015 | 29 Apr 2015 | 25 Mar 2016 |
| 254 | derrymorefoods.com | Register.it SPA | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2025 |
| 255 | derryberryheatandair.com | Tucows Domains Inc. | 24 Aug 2010 | 28 Aug 2015 | 24 Aug 2016 |
| 256 | derryshare.com | eNom, Inc. | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 257 | derryvalesnooker.com | Easyspace LTD | 3 May 2000 | 31 Mar 2015 | 3 May 2015 |
| 258 | derryndeceuster.com | GoDaddy.com, LLC | 1 Apr 2015 | 2 Apr 2015 | 1 Apr 2020 |
| 259 | derrycitycouncil.com | DropCatch.com 389 LLC | 5 Apr 2015 | 6 Apr 2017 | 5 Apr 2018 |
| 260 | derrycityandstrabanedc.com | Tucows Domains Inc. | 2 Apr 2014 | 6 Apr 2015 | 2 Apr 2016 |
| 261 | derryninecandles.com | TurnCommerce, Inc. DBA NameBright.com | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2016 |
| 262 | derryprimecards.com | eNom, Inc. | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 263 | derrycityandstrabane.org | Tucows Domains Inc. | 2 Apr 2014 | 6 Apr 2015 | 2 Apr 2016 |
| 264 | derryskiphire.com | NameCheap, Inc. | 19 May 2020 | 31 Jul 2023 | 19 May 2023 |
| 265 | derrycitynews.com | DropCatch.com 531 LLC | 8 Apr 2015 | 9 Apr 2017 | 8 Apr 2018 |
| 266 | derryneurologicalassociates.org | FastDomain Inc. | 7 Apr 2015 | 28 Mar 2025 | 7 Apr 2026 |
| 267 | derryneurologicalassociates.net | FastDomain Inc. | 7 Apr 2015 | 23 Mar 2025 | 7 Apr 2026 |
| 268 | derrystudios.com | 1&1 Internet AG | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 269 | derrydoc.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Apr 2015 | 11 Apr 2015 | 11 Apr 2016 |
| 270 | derry-studios.com | 1&1 Internet AG | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 271 | derryfeis.com | Tucows Domains Inc. | 11 Apr 2006 | 11 Feb 2025 | 11 Apr 2026 |
| 272 | derrydesmond.com | DomainLocal LLC | 30 Jun 2016 | 1 Jul 2017 | 30 Jun 2018 |
| 273 | derrybros.com | eNom, Inc. | 26 Jul 2001 | 18 Jul 2025 | 26 Jul 2026 |
| 274 | derryguidedtours.com | PSI-USA, Inc. dba Domain Robot | 15 Apr 2015 | 16 Apr 2025 | 15 Apr 2026 |
| 275 | derryapp.com | GMO Internet Inc. | 6 Sep 2015 | 22 Aug 2016 | 6 Sep 2017 |
| 276 | derrycommunications.com | GoDaddy.com, LLC | 17 Apr 2015 | 19 Mar 2025 | 17 Apr 2026 |
| 277 | derryelegantaffairs.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2017 |
| 278 | derrybeesfarm.com | Tucows Domains Inc. | 20 Apr 2015 | 1 Jul 2023 | 20 Apr 2023 |
| 279 | derrysun.com | GoDaddy.com, LLC | 21 Sep 2021 | 21 Sep 2021 | 21 Sep 2022 |
| 280 | derryhamilton.com | 1&1 Internet AG | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2016 |
| 281 | derryair.net | Tucows Domains Inc. | 23 Apr 2009 | 27 Apr 2015 | 23 Apr 2016 |
| 282 | derryafricanmarket.com | GoDaddy.com, LLC | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 283 | derryaccountants.com | Hefei Juming Network Technology Co., Ltd | 9 Jul 2022 | 9 Jul 2023 | 9 Jul 2024 |
| 284 | derryctv.com | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Jul 2019 | 26 Jul 2019 | 26 Jul 2020 |
| 285 | derryclare.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 May 2015 | 5 May 2015 | 5 May 2016 |
| 286 | derryquin.com | Webfusion Ltd. | 16 May 2005 | 7 May 2015 | 16 May 2016 |
| 287 | derrystrabanedc.com | Blacknight Internet Solutions Ltd. | 8 May 2015 | 21 Jun 2017 | 8 May 2017 |
| 288 | derrystrabane.com | Blacknight Internet Solutions Ltd. | 8 May 2015 | 18 Apr 2023 | 8 May 2026 |
| 289 | derry-escorts.com | GoDaddy.com, LLC | 15 Jun 2025 | 15 Jun 2025 | 15 Jun 2026 |
| 290 | derrymoodle.com | Key-Systems GmbH | 10 May 2015 | 10 May 2015 | 10 May 2016 |
| 291 | derrynairn.com | GMO Internet Inc. | 14 May 2015 | 29 Mar 2017 | 13 May 2018 |
| 292 | derryfarming.com | Blacknight Internet Solutions Ltd. | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 293 | derryplayhouseroombook.org | Register.it SPA | 13 Sep 2015 | 12 Nov 2015 | 13 Sep 2017 |
| 294 | derryoktriana.com | GoDaddy.com, LLC | 2 Feb 2017 | 2 Feb 2017 | 2 Feb 2018 |
| 295 | derrystreetart.com | GoDaddy.com, LLC | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 296 | derrybird.com | GoDaddy.com, LLC | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 297 | derrylswoodcrafts.com | PSI-USA, Inc. dba Domain Robot | 6 Nov 2020 | 6 Nov 2020 | 6 Nov 2021 |
| 298 | derrylrent.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 299 | derrywovlerine.com | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 300 | derrydesigns.com | Azdomainz LLC | 30 May 2015 | 15 Jul 2025 | 30 May 2026 |
| 301 | derrycitytc.com | Media Elite Holdings Limited | 15 Jul 2022 | 15 Jul 2022 | 15 Jul 2023 |
| 302 | derrywineclub.com | register.com, Inc. | 9 Jun 2015 | 11 Jun 2017 | 9 Jun 2018 |
| 303 | derrynschmidt.com | DiaMatrix C.C. | 12 Jun 2015 | 6 May 2025 | 12 Jun 2026 |
| 304 | derry-londonderry-realestate.com | Tucows Domains Inc. | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2017 |
| 305 | derrygroupltd.com | DropCatch.com 1507 LLC | 8 Dec 2018 | 8 Dec 2018 | 8 Dec 2019 |
| 306 | derrymobilelocksmith.com | GoDaddy.com, LLC | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 307 | derryfluteband.com | easyDNS Technologies, Inc. | 19 Jun 2015 | 3 Apr 2025 | 19 Jun 2034 |
| 308 | derrybusinesscentre.com | Tucows Domains Inc. | 20 Jun 2015 | 6 Jun 2025 | 20 Jun 2026 |
| 309 | derrybrook.com | GoDaddy.com, LLC | 20 Jun 2015 | 20 Jun 2015 | 20 Jun 2016 |
| 310 | derrylslive.com | eNom, Inc. | 20 Sep 2015 | 20 Aug 2016 | 20 Sep 2017 |
| 311 | derrydong.com | Chengdu West Dimension Digital Technology Co., Ltd… | 4 Sep 2019 | 4 Sep 2019 | 4 Sep 2020 |
| 312 | derrysightseeingtours.com | - | 21 Sep 2015 | 21 Sep 2015 | 21 Sep 2017 |
| 313 | derrycitytour.com | - | 21 Sep 2015 | 21 Sep 2015 | 21 Sep 2017 |
| 314 | derry-prilian.com | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2015 | 18 Sep 2016 |
| 315 | derry1s.com | GoDaddy.com, LLC | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 316 | derrystreetbentleigheast.com | Wild West Domains, LLC | 22 Sep 2015 | 22 Sep 2015 | 22 Sep 2016 |
| 317 | derryspub.com | Xin Net Technology Corporation | 14 Dec 2017 | 14 Dec 2017 | 14 Dec 2018 |
| 318 | derrygeneralstore.com | GoDaddy.com, LLC | 7 Apr 2014 | 29 Mar 2025 | 7 Apr 2026 |
| 319 | derryckthorntonjr.com | GoDaddy.com, LLC | 4 Jul 2015 | 4 Jul 2015 | 4 Jul 2016 |
| 320 | derryairporttaxi.com | GoDaddy.com, LLC | 5 Jul 2015 | 7 Jul 2025 | 5 Jul 2026 |
| 321 | derrydrones.com | Tucows Domains Inc. | 6 Jul 2015 | 6 Jul 2015 | 6 Jul 2017 |
| 322 | derrycourt.com | TurnCommerce, Inc. DBA NameBright.com | 27 Sep 2017 | 21 Sep 2020 | 27 Sep 2025 |
| 323 | derryberryfilms.com | Network Solutions, LLC | 11 Jul 2015 | 9 Jul 2017 | 11 Jul 2018 |
| 324 | derrymorehouse.com | NameCheap, Inc. | 14 Feb 2017 | 14 Feb 2017 | 14 Feb 2019 |
| 325 | derrycraftdistillery.com | - | 3 Oct 2016 | 3 Oct 2016 | 3 Oct 2017 |
| 326 | derryheightsanimalhospital.com | FastDomain Inc. | 11 Jun 2012 | 27 May 2025 | 11 Jun 2026 |
| 327 | derrydonegalcrafts.com | Tucows Domains Inc. | 17 Jul 2014 | 21 Jul 2015 | 17 Jul 2016 |
| 328 | derrycoker.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Jan 2023 | 11 Jan 2025 | 11 Jan 2026 |
| 329 | derryayaa.com | GoDaddy.com, LLC | 23 Apr 2021 | 5 Jul 2023 | 23 Apr 2023 |
| 330 | derrymaine.com | TurnCommerce, Inc. DBA NameBright.com | 22 Jul 2015 | 15 Jan 2020 | 22 Jul 2025 |
| 331 | derryconsitruction.com | - | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2017 |
| 332 | derryvibe.com | GoDaddy.com, LLC | 25 Jul 2015 | 17 Jul 2025 | 25 Jul 2026 |
| 333 | derryteambuilding.com | DomainsAtCost Corporation | 29 Sep 2015 | 14 Aug 2016 | 29 Sep 2017 |
| 334 | derrykyle.com | eNom, Inc. | 2 Sep 2011 | 8 Nov 2024 | 2 Sep 2026 |
| 335 | derrysightseeing.com | Tucows Domains Inc. | 6 Mar 2019 | 6 Mar 2019 | 6 Mar 2020 |
| 336 | derryjable.com | Regional Network Information Center, JSC dba RU-CE… | 25 Jul 2011 | 27 Jul 2015 | 25 Jul 2016 |
| 337 | derrycourteqhs.com | eNom, Inc. | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 338 | derrymathews.com | DropCatch.com 467 LLC | 30 Sep 2015 | 1 Oct 2016 | 30 Sep 2017 |
| 339 | derrycityofculture.com | GoDaddy.com, LLC | 30 Sep 2015 | 30 Sep 2015 | 30 Sep 2016 |
| 340 | derryhypnosis.com | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 341 | derryhypnosis.info | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2017 | 28 Jul 2018 |
| 342 | derryhypnosis.net | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 343 | derrypneumatics.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 28 Feb 2022 | 28 Feb 2022 | 28 Feb 2026 |
| 344 | derrydesignermakers.com | 1&1 Internet AG | 30 Jul 2015 | 31 Jul 2016 | 30 Jul 2017 |
| 345 | derrymaine.net | NameCheap, Inc. | 31 Oct 2024 | 31 Oct 2024 | 31 Oct 2025 |
| 346 | derryberryac.net | FastDomain Inc. | 3 Aug 2015 | 5 Jul 2016 | 3 Aug 2017 |
| 347 | derryagainstsuicide.com | Melbourne IT, Ltd | 6 Aug 2015 | 7 Aug 2015 | 6 Aug 2017 |
| 348 | derrystorytelling.com | Register.it SPA | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 349 | derryforbernie.com | Domain.com, LLC | 10 Oct 2015 | 10 Oct 2015 | 10 Oct 2016 |
| 350 | derryez.com | OnlineNIC, Inc. | 12 Oct 2015 | 11 Oct 2016 | 12 Oct 2017 |
| 351 | derryns.com | eNom, Inc. | 17 Oct 2015 | 16 Oct 2015 | 17 Oct 2017 |
| 352 | derrysemarang.xyz | Hostinger, UAB | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 353 | derrymarket.com | Dynadot, LLC | 14 Jan 2025 | 14 Jan 2025 | 14 Jan 2026 |
| 354 | derryhousecleaning.com | eNom, Inc. | 22 Oct 2015 | 6 Oct 2016 | 22 Oct 2017 |
| 355 | derryhillbooks.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Oct 2015 | 22 Oct 2015 | 22 Oct 2016 |
| 356 | derrynbalmer.xyz | Hostinger, UAB | 23 Oct 2015 | 23 Oct 2015 | 23 Oct 2016 |
| 357 | derryrotaryautoservice.com | - | 26 Jul 2025 | 29 Jul 2025 | 26 Jul 2026 |
| 358 | derryltd.com | TurnCommerce, Inc. DBA NameBright.com | 23 Oct 2015 | 2 Dec 2024 | 23 Oct 2024 |
| 359 | derrypropertyvalues.com | GoDaddy.com, LLC | 24 Oct 2015 | 24 Oct 2015 | 24 Oct 2016 |
| 360 | derryross.xyz | Hostinger, UAB | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2016 |
| 361 | derrynh.info | Network Solutions, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 362 | derrythroughthelens.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 5 Nov 2015 | 18 Jul 2025 | 5 Nov 2025 |
| 363 | derryselfstorage.com | GoDaddy.com, LLC | 9 Nov 2015 | 10 Nov 2024 | 9 Nov 2025 |
| 364 | derrypsychotherapy.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Apr 2017 | 25 Jun 2017 | 25 Apr 2018 |
| 365 | derrylive.com | TurnCommerce, Inc. DBA NameBright.com | 1 Feb 2017 | 26 Jan 2021 | 1 Feb 2026 |
| 366 | derryisland.com | eNom, Inc. | 17 Nov 2015 | 19 Apr 2023 | 17 Nov 2025 |
| 367 | derryandserena.info | Everyones Internet, Ltd. dba SoftLayer | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 368 | derryrentals.com | Tucows Domains Inc. | 18 Nov 2010 | 31 Oct 2024 | 18 Nov 2025 |
| 369 | derrycityrentals.com | Tucows Domains Inc. | 18 Nov 2010 | 31 Oct 2024 | 18 Nov 2025 |
| 370 | derryproductions.com | Gandi SAS | 21 Nov 2011 | 29 Nov 2024 | 21 Nov 2025 |
| 371 | derrychrinps.org | GoDaddy.com, LLC | 24 Nov 2015 | 8 Jan 2025 | 24 Nov 2025 |
| 372 | derrytaxis.net | 1&1 Internet AG | 25 Nov 2015 | 26 Nov 2016 | 25 Nov 2017 |
| 373 | derryle.com | GoDaddy.com, LLC | 22 Feb 2018 | 15 Feb 2025 | 22 Feb 2028 |
| 374 | derryluo.com | HiChina Zhicheng Technology Limited | 9 Dec 2015 | 9 Nov 2016 | 9 Dec 2017 |
| 375 | derryresidents.com | GoDaddy.com, LLC | 15 Dec 2015 | 16 Dec 2022 | 15 Dec 2025 |
| 376 | derrymarathon.com | Tucows Domains Inc. | 12 Dec 2008 | 16 Dec 2015 | 12 Dec 2016 |
| 377 | derryrotaryautorepair.com | TierraNet Inc. d/b/a DomainDiscover | 17 Dec 2015 | 10 Oct 2016 | 17 Dec 2017 |
| 378 | derryclarke.com | Register.it SPA | 10 Jun 2019 | 11 Jun 2019 | 10 Jun 2020 |
| 379 | derry-ave.xyz | Crazy Domains FZ-LLC | 22 Dec 2015 | 27 Dec 2015 | 22 Dec 2016 |
| 380 | derrylinboxingclub.com | Tucows Domains Inc. | 21 Dec 2010 | 25 Dec 2015 | 21 Dec 2016 |
| 381 | derrycityairport.com | GoDaddy.com, LLC | 24 Dec 2015 | 24 Dec 2015 | 24 Dec 2016 |
| 382 | derryshane.info | GoDaddy.com, LLC | 27 Dec 2015 | - | 27 Dec 2016 |
| 383 | derryshane.us | GoDaddy.com, LLC | 27 Dec 2015 | 27 Dec 2015 | 26 Dec 2016 |
| 384 | derryshane.org | GoDaddy.com, LLC | 27 Dec 2015 | 27 Dec 2015 | 27 Dec 2016 |
| 385 | derryshane.net | GoDaddy.com, LLC | 27 Dec 2015 | 27 Dec 2015 | 27 Dec 2016 |
| 386 | derryshane.com | Network Solutions, LLC | 27 Dec 2015 | 24 May 2024 | 27 Dec 2026 |
| 387 | derryball.com | Tucows Domains Inc. | 28 Dec 2013 | 1 Jan 2016 | 28 Dec 2016 |
| 388 | derrycu.com | GoDaddy.com, LLC | 1 Aug 2000 | 28 May 2025 | 1 Aug 2029 |
| 389 | derrysconstruction.com | Tucows Domains Inc. | 6 Jan 2016 | 10 Jan 2017 | 6 Jan 2017 |
| 390 | derryevents.com | DropCatch.com 367 LLC | 9 Jan 2016 | 10 Jan 2017 | 9 Jan 2018 |
| 391 | derrynpreeya.com | GoDaddy.com, LLC | 22 Nov 2019 | 22 Nov 2019 | 22 Nov 2020 |
| 392 | derrytool.com | GoDaddy.com, LLC | 11 Jan 2016 | 12 Jan 2016 | 11 Jan 2017 |
| 393 | derrytool.net | GoDaddy.com, LLC | 11 Jan 2016 | 11 Jan 2016 | 11 Jan 2017 |
| 394 | derryimages.com | Register.it SPA | 13 Jan 2016 | 4 Jan 2025 | 13 Jan 2026 |
| 395 | derrymvp.com | Bizcn.com, Inc. | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 396 | derrywoodkitchens.co.uk | - | 26 May 2022 | 18 May 2024 | 26 May 2025 |
| 397 | derrywebtv.com | Freshbreweddomains.com LLC | 18 Jan 2016 | 19 Jan 2016 | 18 Jan 2017 |
| 398 | derryrock.com | Tucows Domains Inc. | 18 Jan 2016 | 22 Jan 2017 | 18 Jan 2017 |
| 399 | derryberrystandley.com | Network Solutions, LLC | 19 Jan 2016 | 30 May 2016 | 19 Jan 2018 |
| 400 | derrycklawrence.com | West263 International Limited | 20 Oct 2020 | 20 Oct 2020 | 20 Oct 2021 |
| 401 | derryfor2023.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 26 Jan 2016 | 2 Jun 2017 | 26 Jan 2018 |
| 402 | derryhandcraftedguitars.com | Network Solutions, LLC | 26 Jan 2016 | 26 Jan 2016 | 26 Jan 2018 |
| 403 | derrygeneralcontractingservices.com | eNom, Inc. | 28 Jan 2016 | 28 Jan 2016 | 28 Jan 2017 |
| 404 | derrybuyshouses.net | Wild West Domains, LLC | 31 Jan 2016 | 31 Jan 2016 | 31 Jan 2017 |
| 405 | derrycity.net | GoDaddy.com, LLC | 23 Apr 2018 | 22 Apr 2025 | 23 Apr 2026 |
| 406 | derryfor2023.info | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 5 Feb 2016 | - | 5 Feb 2017 |
| 407 | derrynanehotel.net | Tucows Domains Inc. | 3 Feb 2006 | 7 Feb 2016 | 3 Feb 2017 |
| 408 | derrynanehotel.com | GoDaddy.com, LLC | 27 Apr 2021 | 23 Apr 2025 | 27 Apr 2026 |
| 409 | derrynaneholidayhomes.com | Tucows Domains Inc. | 3 Feb 2006 | 7 Feb 2016 | 3 Feb 2017 |
| 410 | derryimaging.com | Tucows Domains Inc. | 3 Aug 2004 | 22 May 2023 | 3 Aug 2026 |
| 411 | derryfieldrepertorytheatre.org | register.com, Inc. | 8 Feb 2016 | 25 Mar 2025 | 8 Feb 2026 |
| 412 | derryfield.org | Network Solutions, LLC | 16 Feb 2001 | 23 Dec 2023 | 16 Feb 2027 |
| 413 | derrys.com | Tucows Domains Inc. | 27 Nov 1997 | 27 Oct 2023 | 26 Nov 2025 |
| 414 | derrybrownfield.com | EnomAU, Inc. | 6 May 2018 | 7 Mar 2025 | 6 May 2026 |
| 415 | derrystreetchurch.com | register.com, Inc. | 22 Feb 2016 | 15 Feb 2017 | 22 Feb 2018 |
| 416 | derryrogers.com | DropCatch.com 458 LLC | 22 Feb 2016 | 23 Feb 2017 | 22 Feb 2018 |
| 417 | derry-living.com | Xin Net Technology Corporation | 22 Feb 2016 | 12 Apr 2024 | 22 Feb 2028 |
| 418 | derrysepticservice.com | Wild West Domains, LLC | 23 Feb 2016 | 6 Apr 2025 | 23 Feb 2026 |
| 419 | derryrestaurantpizza.xyz | NameCheap, Inc. | 23 Feb 2016 | 23 Feb 2016 | 23 Feb 2017 |
| 420 | derrygaragedoor.com | eNom, Inc. | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
| 421 | derrykurniarahayu.com | CV. Jogjacamp | 28 Feb 2016 | 4 Mar 2017 | 28 Feb 2018 |
| 422 | derrylicious.com | PSI-USA, Inc. dba Domain Robot | 25 Aug 2023 | 24 Aug 2024 | 25 Aug 2024 |
| 423 | derryver.com | Tucows Domains Inc. | 27 Feb 2013 | 2 Mar 2016 | 27 Feb 2017 |
| 424 | derryofarms.com | Namesilo, LLC | 4 Mar 2016 | 4 Mar 2025 | 4 Mar 2026 |
| 425 | derryo.com | Namesilo, LLC | 3 Mar 2016 | 22 Jul 2025 | 3 Mar 2026 |
| 426 | derry-o.com | Namesilo, LLC | 4 Mar 2016 | 4 Mar 2025 | 4 Mar 2026 |
| 427 | derrysttherapeuticmassage.com | GoDaddy.com, LLC | 5 Mar 2016 | 6 Mar 2024 | 5 Mar 2026 |
| 428 | derrybettsdesign.com | GoDaddy.com, LLC | 6 Mar 2016 | 6 Mar 2025 | 6 Mar 2026 |
| 429 | derryrollo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jun 2017 | 1 Aug 2017 | 1 Jun 2018 |
| 430 | derryfieldcountryclub.com | GoDaddy.com, LLC | 8 Mar 2016 | 8 Mar 2016 | 8 Mar 2017 |
| 431 | derryfieldcc.com | GoDaddy.com, LLC | 8 Mar 2016 | 8 Mar 2016 | 8 Mar 2017 |
| 432 | derrymotors.com | Sharkweek Domains LLC | 26 May 2019 | 27 May 2019 | 26 May 2020 |
| 433 | derryanderrough.com | NetEarth One Inc. d/b/a NetEarth | 8 Mar 2016 | 8 May 2016 | 8 Mar 2019 |
| 434 | derrychaanltd.com | eNom, Inc. | 11 Mar 2016 | 4 Mar 2025 | 11 Mar 2026 |
| 435 | derryheatingoil.com | eNom, Inc. | 12 Mar 2016 | 12 Mar 2016 | 12 Mar 2017 |
| 436 | derrybathroomsuites.com | eNom, Inc. | 12 Mar 2016 | 11 Feb 2017 | 12 Mar 2018 |
| 437 | derrygimlagh.com | Register.it SPA | 14 Mar 2016 | 14 Mar 2017 | 14 Mar 2018 |
| 438 | derryberryhvacgallatintn.com | Tucows Domains Inc. | 15 Mar 2016 | 14 Feb 2017 | 15 Mar 2018 |
| 439 | derryjames.com | Register.it SPA | 17 Mar 2016 | 17 Mar 2017 | 17 Mar 2018 |
| 440 | derrylh.com | Wild West Domains, LLC | 17 Jul 2021 | 17 Jul 2021 | 17 Jul 2022 |
| 441 | derry99.com | HiChina Zhicheng Technology Limited | 19 Mar 2016 | 19 May 2017 | 19 Mar 2018 |
| 442 | derryberry.com | Tucows Domains Inc. | 19 Feb 1997 | 22 Jan 2025 | 20 Feb 2026 |
| 443 | derryck.com | GoDaddy.com, LLC | 28 Feb 2002 | 28 Feb 2024 | 28 Feb 2026 |
| 444 | derryn.com | Crazy Domains FZ-LLC | 16 Sep 2005 | 4 Sep 2024 | 16 Sep 2025 |
| 445 | derrypnc.org | FastDomain Inc. | 20 Mar 2016 | 4 Jun 2017 | 20 Mar 2018 |
| 446 | derryjobs.com | TurnCommerce, Inc. DBA NameBright.com | 20 Mar 2016 | 31 Aug 2022 | 20 Mar 2026 |
| 447 | derryscross.com | register.com, Inc. | 23 Mar 2016 | 23 Mar 2016 | 23 Mar 2017 |
| 448 | derrypratama.com | Hostinger, UAB | 27 Mar 2016 | 27 Mar 2016 | 27 Mar 2017 |
| 449 | derryforagesoybeans.com | 1&1 Internet AG | 3 Apr 2016 | 3 Apr 2025 | 3 Apr 2026 |
| 450 | derrynhpolice.com | Network Solutions, LLC | 17 Apr 2001 | 16 Feb 2025 | 17 Apr 2030 |
| 451 | derryhostel.com | - | 18 Mar 2024 | 19 Mar 2025 | 18 Mar 2026 |
| 452 | derrynanerocks.com | Tucows Domains Inc. | 7 Apr 2016 | 11 Apr 2017 | 7 Apr 2017 |
| 453 | derryhaletractorandplantsales.com | GoDaddy.com, LLC | 23 Sep 2019 | 23 Sep 2019 | 23 Sep 2020 |
| 454 | derrysel.com | GoDaddy.com, LLC | 9 Apr 2016 | 22 Apr 2025 | 9 Apr 2026 |
| 455 | derryphoto.com | FastDomain Inc. | 21 Apr 2016 | 21 Apr 2017 | 21 Apr 2018 |
| 456 | derryberrypr.com | Wild West Domains, LLC | 28 Nov 2005 | 29 Nov 2024 | 28 Nov 2025 |
| 457 | derrycoin.com | Tucows Domains Inc. | 21 Apr 2016 | 23 Mar 2025 | 21 Apr 2026 |
| 458 | derrymedicalcenter.com | Tucows Domains Inc. | 26 May 1999 | 24 Apr 2023 | 26 May 2026 |
| 459 | derryneilbaptist.org | - | 18 Apr 2009 | 18 Apr 2009 | 18 Apr 2017 |
| 460 | derryckfit.com | GoDaddy.com, LLC | 24 Apr 2016 | 24 Apr 2016 | 24 Apr 2017 |
| 461 | derryfoodtours.org | GoDaddy.com, LLC | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 462 | derryfoodtours.net | GoDaddy.com, LLC | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 463 | derryfoodtours.com | Beijing Lanhai Jiye Technology Co., Ltd | 14 May 2023 | 15 May 2025 | 14 May 2026 |
| 464 | derryfoodtour.com | GoDaddy.com, LLC | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 465 | derrysontagdc.com | GoDaddy.com, LLC | 27 Apr 2016 | 27 Apr 2016 | 27 Apr 2017 |
| 466 | derryckmccaul.com | Gandi SAS | 29 Apr 2016 | 29 Apr 2016 | 29 Apr 2017 |
| 467 | derryhabir.org | GoDaddy.com, LLC | 29 Apr 2016 | 29 Apr 2016 | 29 Apr 2017 |
| 468 | derrychan.top | DNSPod, Inc. | 9 Sep 2020 | 9 Oct 2024 | 9 Sep 2024 |
| 469 | derrycreatives.org | Tucows Domains Inc. | 1 May 2016 | 5 May 2025 | 1 May 2026 |
| 470 | derrycreatives.com | Tucows Domains Inc. | 1 May 2016 | 30 Apr 2025 | 1 May 2026 |
| 471 | derryroofingllc.net | Tucows Domains Inc. | 4 May 2016 | 8 May 2018 | 4 May 2018 |
| 472 | derrymore.net | Google, Inc. | 4 May 2016 | 19 Apr 2025 | 4 May 2026 |
| 473 | derryexpress.com | register.com, Inc. | 4 May 2016 | 4 May 2016 | 4 May 2017 |
| 474 | derrybyrne.com | Tucows Domains Inc. | 4 May 2016 | 8 May 2017 | 4 May 2017 |
| 475 | derryoffenbach.org | Register.it SPA | 6 May 2016 | 21 Apr 2017 | 6 May 2018 |
| 476 | derryoffenbach.com | Mesh Digital Limited | 6 May 2016 | 4 Apr 2017 | 6 May 2018 |
| 477 | derrydirectory.com | DropCatch.com 1151 LLC | 26 Jul 2017 | 26 Jul 2017 | 26 Jul 2018 |
| 478 | derryon.science | - | 9 May 2016 | 9 May 2016 | 8 May 2017 |
| 479 | derryaddpalletsltd.com | MAFF Inc. | 29 Jul 2022 | 6 Oct 2023 | 29 Jul 2023 |
| 480 | derryselfstorage.org | 1&1 Internet AG | 10 May 2016 | 10 Jul 2016 | 10 May 2018 |
| 481 | derrynhselfstorage.org | 1&1 Internet AG | 10 May 2016 | 10 Jul 2016 | 10 May 2018 |
| 482 | derryconstructionltd.co.uk | - | 5 Aug 2024 | 5 Aug 2024 | 5 Aug 2025 |
| 483 | derryselfstorage.net | 1&1 Internet AG | 10 May 2016 | 10 May 2016 | 10 May 2018 |
| 484 | derrynhselfstorage.net | 1&1 Internet AG | 10 May 2016 | 10 May 2016 | 10 May 2018 |
| 485 | derryselfstorage.info | 1&1 Internet AG | 10 May 2016 | 10 May 2020 | 10 May 2021 |
| 486 | derrynhselfstorage.info | 1&1 Internet AG | 10 May 2016 | 10 May 2020 | 10 May 2021 |
| 487 | derrynhselfstorage.com | 1&1 Internet AG | 10 May 2016 | 10 May 2016 | 10 May 2018 |
| 488 | derrynaflanfoods.com | - | 10 May 2016 | 10 May 2016 | 10 May 2017 |
| 489 | derrylawfirm.com | GoDaddy.com, LLC | 10 May 2016 | 22 Jul 2024 | 10 May 2024 |
| 490 | derryunderbelly.com | - | 12 May 2016 | 12 May 2016 | 12 May 2017 |
| 491 | derryy.com | 1&1 Internet AG | 8 Oct 2022 | 8 Oct 2023 | 8 Oct 2024 |
| 492 | derryvoid.com | Register.it SPA | 12 Oct 2005 | 12 Oct 2023 | 12 Oct 2025 |
| 493 | derrygarment.com | Chengdu West Dimension Digital Technology Co., Ltd… | 17 May 2016 | 17 May 2016 | 17 May 2017 |
| 494 | derrycellmajalengka.com | - | 19 May 2016 | 19 May 2016 | 19 May 2017 |
| 495 | derrycityaviaries.com | Tucows Domains Inc. | 22 May 2016 | 26 May 2017 | 22 May 2017 |
| 496 | derryography.com | GoDaddy.com, LLC | 23 May 2016 | 22 May 2025 | 23 May 2026 |
| 497 | derrycreatives.club | Tucows Domains Inc. | 1 May 2016 | 4 May 2025 | 30 Apr 2026 |
| 498 | derrynanestorage.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 May 2016 | 25 May 2025 | 26 May 2026 |
| 499 | derrymortgageadvisor.com | eNom, Inc. | 26 May 2016 | 27 Apr 2017 | 26 May 2018 |
| 500 | derrywellness.com | GoDaddy.com, LLC | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 501 | derryautomotiverepairs.com | eNom, Inc. | 18 Feb 2019 | 18 Feb 2019 | 18 Feb 2020 |
| 502 | derryproperty.click | Uniregistrar Corp | 1 Jun 2016 | 13 Jul 2017 | 1 Jun 2017 |
| 503 | derrynsinch.com | Crazy Domains FZ-LLC | 5 Jun 2016 | 16 Jun 2017 | 5 Jun 2017 |
| 504 | derryberrylawfirm.com | Dynadot, LLC | 25 Jul 2025 | 25 Jul 2025 | 25 Jul 2026 |
| 505 | derryproperty.online | Uniregistrar Corp | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 506 | derryproperty.link | Uniregistrar Corp | 1 Jun 2016 | 13 Jul 2017 | 1 Jun 2017 |
| 507 | derryproperty.xyz | Uniregistrar Corp | 1 Jun 2016 | 23 Sep 2016 | 1 Jun 2017 |
| 508 | derryl.xyz | Uniregistrar Corp | 1 Jun 2016 | 23 Sep 2016 | 1 Jun 2017 |
| 509 | derryberry.xyz | Uniregistrar Corp | 1 Jun 2016 | 23 Sep 2016 | 1 Jun 2017 |
| 510 | derryberry.org | Google, Inc. | 15 Jul 2013 | 15 Jun 2017 | 15 Jul 2017 |
| 511 | derryazlin.com | Uniregistrar Corp | 8 Jun 2016 | 8 Jun 2016 | 8 Jun 2017 |
| 512 | derrythgy.xyz | TLD Registrar Solutions Ltd. | 5 Jun 2016 | 13 Jul 2016 | 5 Jun 2017 |
| 513 | derrythcodi.xyz | TLD Registrar Solutions Ltd. | 5 Jun 2016 | 27 Oct 2016 | 5 Jun 2017 |
| 514 | derry-gaa.com | Tucows Domains Inc. | 30 Sep 2018 | 30 Sep 2018 | 30 Sep 2019 |
| 515 | derryfireelite.org | Domain.com, LLC | 14 Jun 2016 | 25 Jun 2025 | 14 Jun 2026 |
| 516 | derrytreskplastering.com | Domain Original, LLC | 2 Sep 2024 | 5 Sep 2024 | 2 Sep 2025 |
| 517 | derryclothing.com | REALTIME REGISTER BV | 17 Jun 2016 | 17 Jun 2016 | 17 Jun 2017 |
| 518 | derryfield.info | Network Solutions, LLC | 19 Jun 2016 | 20 Apr 2024 | 19 Jun 2027 |
| 519 | derryllb.us | pair Networks, Inc. d/b/a pairNIC | 21 Jun 2016 | 27 Mar 2017 | 20 Jun 2019 |
| 520 | derryllb.org | pair Networks, Inc. d/b/a pairNIC | 21 Jun 2016 | 27 Mar 2017 | 21 Jun 2019 |
| 521 | derryllb.net | - | 21 Jun 2016 | 21 Jun 2016 | 21 Jun 2017 |
| 522 | derryllb.info | pair Networks, Inc. d/b/a pairNIC | 21 Jun 2016 | 30 Mar 2019 | 21 Jun 2020 |
| 523 | derryllb.com | pair Networks, Inc. d/b/a pairNIC | 21 Jun 2016 | 27 Apr 2025 | 21 Jun 2028 |
| 524 | derryllb.biz | pair Networks, Inc. d/b/a pairNIC | 21 Jun 2016 | 26 May 2020 | 20 Jun 2021 |
| 525 | derrygaragedoors.com | Dynadot, LLC | 24 Jun 2016 | 11 Jul 2017 | 24 Jun 2018 |
| 526 | derrynock.com | Melbourne IT, Ltd | 30 Jun 2016 | 30 Jun 2025 | 30 Jun 2026 |
| 527 | derrynockpolldorset.com | Melbourne IT, Ltd | 30 Jun 2016 | 30 Jun 2025 | 30 Jun 2026 |
| 528 | derryhotels.com | TurnCommerce, Inc. DBA NameBright.com | 30 Jun 2016 | 24 Jun 2020 | 30 Jun 2026 |
| 529 | derryer.xyz | NameCheap, Inc. | 30 Jun 2016 | 29 Jul 2016 | 30 Jun 2017 |
| 530 | derrymanagement.com | Domain.com, LLC | 1 May 2009 | 25 Jun 2025 | 1 May 2026 |
| 531 | derryhicks.com | Tucows Domains Inc. | 6 Jul 2013 | 10 Jul 2025 | 6 Jul 2026 |
| 532 | derrywebhosting.com | - | 28 Sep 2022 | 29 Sep 2023 | 28 Sep 2024 |
| 533 | derrybraces.com | GoDaddy.com, LLC | 13 Jul 2016 | 22 Sep 2022 | 13 Jul 2026 |
| 534 | derrynhbraces.com | GoDaddy.com, LLC | 13 Jul 2016 | 22 Sep 2022 | 13 Jul 2026 |
| 535 | derryzombiewalk.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jul 2016 | 26 Aug 2017 | 15 Jul 2017 |
| 536 | derrylldesign.biz | GoDaddy.com, LLC | 16 Jun 2014 | 27 Jun 2016 | 15 Jun 2016 |
| 537 | derryberry.biz | GoDaddy.com, LLC | 20 Aug 2010 | 31 Aug 2015 | 19 Aug 2016 |
| 538 | derrythedroid.biz | Tucows Domains Inc. | 16 Sep 2011 | 15 Dec 2016 | 15 Sep 2017 |
| 539 | derryll.biz | GoDaddy.com, LLC | 16 Jun 2014 | 17 Mar 2017 | 15 Jun 2018 |
| 540 | derrydirectory.biz | - | 7 Mar 2011 | 19 Oct 2024 | 6 Mar 2026 |
| 541 | derryrestaurantpizza.com | GoDaddy.com, LLC | 16 Jul 2016 | 16 Jul 2016 | 16 Jul 2017 |
| 542 | derry1916.com | Webfusion Ltd. | 18 Jul 2016 | 19 Jul 2025 | 18 Jul 2026 |
| 543 | derrybrewery.com | eNom, Inc. | 22 Jul 2016 | 22 Jul 2016 | 22 Jul 2018 |
| 544 | derrycitybiz.com | - | 21 Jul 2005 | 21 Jul 2005 | 21 Jul 2017 |
| 545 | derrydown.com | Hongkong Domain Name Information Management Co., L… | 16 Oct 2022 | 25 Dec 2023 | 16 Oct 2023 |
| 546 | derrynanebooks.com | eNom, Inc. | 28 Jul 2016 | 29 Jun 2025 | 28 Jul 2026 |
| 547 | derryberryconcretedesigns.com | GoDaddy.com, LLC | 28 Jun 2018 | 3 Jul 2025 | 28 Jun 2026 |
| 548 | derryvineyard.com | - | 5 Aug 2016 | 5 Aug 2016 | 5 Aug 2017 |
| 549 | derryelegantaffairsllc.com | Network Solutions, LLC | 6 Aug 2016 | 7 Jul 2025 | 6 Aug 2026 |
| 550 | derryexpresschineserestaurant.com | - | 8 Aug 2016 | 8 Aug 2016 | 8 Aug 2017 |
| 551 | derrybet.com | Domeneshop AS dba domainnameshop.com | 10 Aug 2016 | 21 Oct 2024 | 10 Aug 2024 |
| 552 | derrypro.com | - | 11 Aug 2016 | 11 Aug 2016 | 11 Aug 2017 |
| 553 | derrycurry.com | Webfusion Ltd. | 24 Feb 2000 | 20 Dec 2024 | 24 Feb 2026 |
| 554 | derrybluebadgeguide.com | Tucows Domains Inc. | 5 Jul 2006 | 6 Jun 2025 | 5 Jul 2026 |
| 555 | derry-real-estate.com | West263 International Limited | 17 Apr 2020 | 17 Apr 2020 | 17 Apr 2021 |
| 556 | derryleberger.com | GoDaddy.com, LLC | 22 Mar 2007 | 4 Sep 2022 | 22 Mar 2028 |
| 557 | derrynanebeach.com | Blacknight Internet Solutions Ltd. | 28 Jul 2013 | 7 Jul 2017 | 28 Jul 2018 |
| 558 | derryeastfarmhouse.com | 1API GmbH | 15 Jun 2020 | 15 Jun 2020 | 15 Jun 2021 |
| 559 | derrycityofculturetour.com | FastDomain Inc. | 21 Jul 2010 | 22 Jul 2015 | 21 Jul 2016 |
| 560 | derryautochoicewarehouse.com | GoDaddy.com, LLC | 22 Oct 2013 | 23 Oct 2024 | 22 Oct 2025 |
| 561 | derrypediatrics.com | register.com, Inc. | 30 Sep 1999 | 27 Oct 2022 | 30 Sep 2027 |
| 562 | derrygreen.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 18 Nov 2021 | 21 Nov 2021 | 18 Nov 2022 |
| 563 | derryhicksticks.com | Tucows Domains Inc. | 31 Mar 2011 | 18 Mar 2025 | 31 Mar 2026 |
| 564 | derrynhlocksmith.com | West263 International Limited | 18 Sep 2020 | 18 Sep 2020 | 18 Sep 2021 |
| 565 | derrybetts.com | GoDaddy.com, LLC | 3 Jan 2011 | 4 Jan 2016 | 3 Jan 2017 |
| 566 | derrynanefarm.com | Tucows Domains Inc. | 28 Feb 2007 | 4 Mar 2019 | 28 Feb 2019 |
| 567 | derrybirkett.com | Squarespace Domains LLC | 24 Sep 2011 | 9 Sep 2024 | 24 Sep 2025 |
| 568 | derry-hotels.com | TierraNet Inc. d/b/a DomainDiscover | 31 Jul 2000 | 4 Jun 2025 | 31 Jul 2026 |
| 569 | derrythediver.com | Blacknight Internet Solutions Ltd. | 22 Oct 2010 | 1 Oct 2015 | 22 Oct 2016 |
| 570 | derry-spartans.com | Namebay SAM | 17 Sep 2020 | 6 Oct 2024 | 17 Sep 2025 |
| 571 | derryrover.com | GoDaddy.com, LLC | 18 Dec 2013 | 19 Dec 2015 | 18 Dec 2016 |
| 572 | derryheightsvet.com | eNom, Inc. | 29 Jan 2013 | 13 Jun 2017 | 29 Jan 2018 |
| 573 | derrypark.com | GoDaddy.com, LLC | 31 Jan 2012 | 31 Jan 2012 | 31 Jan 2017 |
| 574 | derryontheweb.com | GoDaddy.com, LLC | 23 Feb 2003 | 28 Feb 2016 | 23 Feb 2017 |
| 575 | derryhotairballoonrides.com | GoDaddy.com, LLC | 8 Feb 2010 | 9 Feb 2016 | 8 Feb 2017 |
| 576 | derrylinmanor.com | GoDaddy.com, LLC | 4 Feb 2010 | 5 Feb 2015 | 4 Feb 2018 |
| 577 | derryata.com | GoDaddy.com, LLC | 30 Jan 2017 | 30 Jan 2017 | 30 Jan 2019 |
| 578 | derrycops.com | GoDaddy.com, LLC | 20 Nov 1997 | 20 Nov 2024 | 19 Nov 2025 |
| 579 | derrynvranch.com | Hostinger, UAB | 6 Jan 2011 | 9 Feb 2025 | 6 Jan 2026 |
| 580 | derrydownproject.com | Amazon Registrar, Inc. | 19 Nov 2013 | 11 Jul 2016 | 19 Nov 2021 |
| 581 | derrypopesinging.com | One.com A/S | 13 Apr 2012 | 14 Mar 2025 | 13 Apr 2026 |
| 582 | derryhumma.com | - | 19 Jun 2025 | 19 Jun 2025 | 19 Jun 2026 |
| 583 | derrymosscode.com | Web Commerce Communications Limited dba WebNic.cc | 7 Aug 2014 | 7 Aug 2014 | 7 Aug 2016 |
| 584 | derrycox.com | Media Elite Holdings Limited | 23 Aug 2022 | 6 Nov 2023 | 23 Aug 2023 |
| 585 | derrybarnas.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 17 Jun 2014 | 18 Jun 2017 | 17 Jun 2018 |
| 586 | derrynagarra.com | GoDaddy.com, LLC | 17 Jul 2019 | 17 Jul 2019 | 17 Jul 2020 |
| 587 | derryaire.com | 1&1 Internet AG | 2 Jan 2025 | 2 Jan 2025 | 2 Jan 2026 |
| 588 | derryfieldgolf.com | Network Solutions, LLC | 27 Jan 1999 | 24 Jan 2022 | 27 Jan 2027 |
| 589 | derrywebb.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 Apr 2021 | 5 Apr 2023 | 4 Apr 2024 |
| 590 | derryexcavation.com | NameCheap, Inc. | 20 May 2023 | 20 Apr 2025 | 20 May 2026 |
| 591 | derryboydfortaxcommissioner.com | GoDaddy.com, LLC | 12 Jun 2012 | 13 Jun 2016 | 12 Jun 2017 |
| 592 | derryhale.com | Tucows Domains Inc. | 4 Oct 2007 | 7 Oct 2024 | 4 Oct 2025 |
| 593 | derryrepublicans.com | NameCheap, Inc. | 18 Feb 2008 | 19 Jan 2025 | 18 Feb 2026 |
| 594 | derryonline.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Feb 2024 | 29 Apr 2025 | 27 Feb 2026 |
| 595 | derryhvaccontractor.com | eNom, Inc. | 1 Apr 2013 | 28 Feb 2017 | 1 Apr 2018 |
| 596 | derry-holding.com | Mesh Digital Limited | 22 Sep 2011 | 15 Sep 2024 | 22 Sep 2025 |
| 597 | derryberryheat-ac.com | Xin Net Technology Corporation | 14 Nov 2017 | 15 Nov 2017 | 14 Nov 2018 |
| 598 | derryauto.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Mar 2014 | 30 Mar 2025 | 9 Mar 2027 |
| 599 | derrybootsdirect.com | Global Domain Name Trading Center Ltd | 15 Jul 2021 | 15 Jul 2021 | 15 Jul 2022 |
| 600 | derrydalepress.com | Tucows Domains Inc. | 3 Jan 2000 | 5 Dec 2024 | 3 Jan 2026 |
| 601 | derrycrystal.com | 1&1 Internet AG | 18 Oct 2012 | 19 Oct 2020 | 18 Oct 2025 |
| 602 | derrymotorhomehire.com | GoDaddy.com, LLC | 22 May 2012 | 22 May 2012 | 22 May 2017 |
| 603 | derryengineering.com | One.com A/S | 19 Jan 2014 | 20 Dec 2024 | 19 Jan 2026 |
| 604 | derrycaseyconstruction.com | Network Solutions, LLC | 13 Jun 2008 | 14 Apr 2025 | 13 Jun 2027 |
| 605 | derrycraftvillage.com | One.com A/S | 15 Apr 2011 | 16 Mar 2025 | 15 Apr 2026 |
| 606 | derrybizlist.com | eNom, Inc. | 14 Sep 2011 | 17 Sep 2017 | 14 Sep 2017 |
| 607 | derryair.com | Network Solutions, LLC | 11 Nov 2010 | 11 Nov 2023 | 11 Nov 2033 |
| 608 | derrynshrosbree.com | GoDaddy.com, LLC | 22 Jul 2009 | 6 Sep 2022 | 22 Jul 2029 |
| 609 | derrymoore.com | Tucows Domains Inc. | 26 Sep 1999 | 28 Aug 2025 | 26 Sep 2026 |
| 610 | derrydean.com | Dynadot, LLC | 14 May 2010 | 5 Jul 2025 | 14 May 2026 |
| 611 | derry724locksmith.com | GoDaddy.com, LLC | 16 Mar 2011 | 22 Jun 2016 | 16 Mar 2017 |
| 612 | derryareaartists.com | GoDaddy.com, LLC | 22 Apr 2005 | 2 Jun 2025 | 22 Apr 2026 |
| 613 | derryanddavid.com | Webnames.ca Inc. | 23 Jan 2005 | 8 Jul 2025 | 23 Jan 2028 |
| 614 | derryntalart.com | Tucows Domains Inc. | 3 Apr 2009 | 19 Mar 2025 | 3 Apr 2026 |
| 615 | derrymanor.com | eNom, Inc. | 18 May 2012 | 11 May 2025 | 18 May 2026 |
| 616 | derryvideos.com | Webfusion Ltd. | 26 Sep 2011 | 25 Sep 2015 | 26 Sep 2016 |
| 617 | derrypreschool.com | Tucows Domains Inc. | 6 Jan 2011 | 17 Dec 2024 | 6 Jan 2027 |
| 618 | derrynaflan.com | - | 9 Aug 2022 | 11 Oct 2023 | 9 Aug 2023 |
| 619 | derrycommons.com | Network Solutions, LLC | 15 Jan 2009 | 16 Nov 2024 | 15 Jan 2026 |
| 620 | derrypubs.com | Tucows Domains Inc. | 2 May 2025 | 2 May 2025 | 2 May 2026 |
| 621 | derrynjones.com | Synergy Wholesale Pty Ltd | 7 Jul 2011 | 11 Jun 2024 | 7 Jul 2026 |
| 622 | derrytransport.com | Tucows Domains Inc. | 9 Jul 2005 | 22 Jul 2025 | 9 Jul 2026 |
| 623 | derrybingo.com | GoDaddy.com, LLC | 7 Aug 2007 | 8 Aug 2025 | 7 Aug 2026 |
| 624 | derry-bingo.com | Network Solutions, LLC | 1 May 2007 | 16 Apr 2017 | 1 May 2018 |
| 625 | derryburgess.com | Melbourne IT, Ltd | 16 Jul 2007 | 17 Jul 2025 | 16 Jul 2030 |
| 626 | derrysolicitors.com | LCN.COM Ltd. | 8 Aug 2012 | 9 Jul 2017 | 8 Aug 2018 |
| 627 | derryrooney.com | GoDaddy.com, LLC | 4 Feb 2004 | 5 Feb 2025 | 4 Feb 2026 |
| 628 | derryquinn.com | GoDaddy.com, LLC | 31 Oct 2007 | 1 Nov 2015 | 31 Oct 2016 |
| 629 | derryccl.com | 1&1 Internet AG | 1 Feb 2013 | 2 Feb 2016 | 1 Feb 2017 |
| 630 | derrylz.com | 1&1 Internet AG | 6 Sep 2012 | 8 Mar 2018 | 6 Sep 2025 |
| 631 | derrypennsylvania.com | AvidDomain LLC | 16 Nov 2013 | 22 Feb 2017 | 16 Nov 2017 |
| 632 | derryworld.com | Register.it SPA | 26 Jan 2021 | 2 Dec 2024 | 26 Jan 2026 |
| 633 | derrydoyle.com | Crazy Domains FZ-LLC | 13 Sep 2011 | 17 Oct 2023 | 13 Sep 2023 |
| 634 | derrysdeals.com | NameCheap, Inc. | 9 Jul 2020 | 10 Jul 2025 | 9 Jul 2026 |
| 635 | derrytaxis.com | NameCheap, Inc. | 30 Nov 2022 | 10 Feb 2024 | 30 Nov 2023 |
| 636 | derryplumbingrepair.com | eNom, Inc. | 13 Jun 2014 | 16 Jun 2016 | 13 Jun 2017 |
| 637 | derrystreet.com | Nom-iq Ltd. dba COM LAUDE | 21 Oct 2013 | 4 Feb 2025 | 21 Oct 2025 |
| 638 | derrycarpetcleaning.com | Webfusion Ltd. | 6 Jan 2014 | 30 Dec 2015 | 6 Jan 2018 |
| 639 | derryberryaudio.com | GoDaddy.com, LLC | 18 Jun 2001 | 19 Jun 2024 | 18 Jun 2026 |
| 640 | derryroadvet.com | Tucows Domains Inc. | 7 Mar 2007 | 6 Feb 2025 | 7 Mar 2026 |
| 641 | derryosullivan.com | Protocol Internet Technology Limited T/A Hosting I… | 24 Mar 2005 | 30 Apr 2024 | 24 Mar 2024 |
| 642 | derrynhrealty.com | GoDaddy.com, LLC | 2 Aug 2012 | 4 Jul 2025 | 3 Jul 2026 |
| 643 | derryconsulting.com | TurnCommerce, Inc. DBA NameBright.com | 3 Jun 2020 | 13 Aug 2024 | 3 Jun 2024 |
| 644 | derrynhplumbing.com | Tucows Domains Inc. | 22 Feb 2011 | 26 Feb 2021 | 22 Feb 2021 |
| 645 | derrywilliams.com | GoDaddy.com, LLC | 2 Apr 2008 | 26 Aug 2025 | 25 Aug 2026 |
| 646 | derrycrafts.com | ZoomRegistrar LLC | 24 May 2018 | 24 May 2018 | 24 May 2019 |
| 647 | derrydaily.com | TurnCommerce, Inc. DBA NameBright.com | 20 Mar 2013 | 14 Mar 2021 | 20 Mar 2026 |
| 648 | derrybeg.com | Porkbun, LLC | 1 May 2005 | 29 Apr 2025 | 1 May 2026 |
| 649 | derryhull2017.com | Register.it SPA | 20 Nov 2013 | 20 Nov 2013 | 20 Nov 2016 |
| 650 | derrytours.com | eNom, Inc. | 4 Aug 2006 | 5 Aug 2025 | 4 Aug 2025 |
| 651 | derryberryfamily.com | GoDaddy.com, LLC | 1 Jun 2014 | 2 Jun 2016 | 1 Jun 2017 |
| 652 | derrydressdesigns.com | Name.com, Inc. | 20 Jul 2008 | 14 Aug 2017 | 20 Jul 2018 |
| 653 | derryroad.com | GoDaddy.com, LLC | 9 Dec 2002 | 9 Jul 2025 | 8 Jul 2026 |
| 654 | derryjohnson.com | Network Information Center Mexico, S.C. | 1 Jul 2024 | 1 Jul 2025 | 1 Jul 2025 |
| 655 | derrycitytours.com | Easyspace LTD | 14 Mar 2007 | 13 Feb 2024 | 14 Mar 2026 |
| 656 | derrycoderdojo.com | GoDaddy.com, LLC | 5 Apr 2019 | 5 Apr 2019 | 5 Apr 2020 |
| 657 | derryls.com | GoDaddy.com, LLC | 19 Jun 2006 | 19 Jun 2025 | 19 Jun 2026 |
| 658 | derryroadphysio.com | Tucows Domains Inc. | 15 May 2014 | 30 Apr 2025 | 15 May 2026 |
| 659 | derrylahanhostel.com | Network Solutions, LLC | 5 Nov 2009 | 5 Mar 2017 | 5 Nov 2017 |
| 660 | derryleckabedding.com | Network Solutions, LLC | 19 Jun 2008 | 20 May 2025 | 19 Jun 2026 |
| 661 | derrymortgage.com | GoDaddy.com, LLC | 16 Jan 2013 | 17 Jan 2025 | 16 Jan 2027 |
| 662 | derrylondonderryguide.com | 1&1 Internet AG | 22 Jul 2010 | 20 Aug 2016 | 22 Jul 2018 |
| 663 | derryprecision.com | TurnCommerce, Inc. DBA NameBright.com | 1 Jan 2018 | 10 Feb 2025 | 1 Jan 2025 |
| 664 | derryireland.com | NameCheap, Inc. | 1 Mar 2023 | 2 Mar 2025 | 1 Mar 2026 |
| 665 | derryhomevalues.com | GoDaddy.com, LLC | 2 Jun 2014 | 3 Jun 2016 | 2 Jun 2017 |
| 666 | derrycaseybuilders.com | GoDaddy.com, LLC | 12 Aug 2014 | 5 Aug 2016 | 12 Aug 2017 |
| 667 | derryswalls.com | TurnCommerce, Inc. DBA NameBright.com | 19 Jun 2000 | 3 Jun 2020 | 19 Jun 2026 |
| 668 | derryrestaurantandpizza.com | NameCheap, Inc. | 23 Apr 2024 | 14 Sep 2024 | 23 Apr 2026 |
| 669 | derryplumbing.com | GoDaddy.com, LLC | 25 Sep 2024 | 4 Jul 2025 | 25 Sep 2025 |
| 670 | derryplumbingheating.com | register.com, Inc. | 12 Apr 2013 | 24 Apr 2025 | 12 Apr 2026 |
| 671 | derryselfcatering.com | Tucows Domains Inc. | 23 Aug 2007 | 27 Aug 2019 | 23 Aug 2019 |
| 672 | derryckspastries.com | GoDaddy.com, LLC | 4 Aug 2011 | 16 Aug 2013 | 4 Aug 2016 |
| 673 | derrycn.com | Beijing Lanhai Jiye Technology Co., Ltd | 18 Dec 2023 | 30 Jul 2025 | 18 Dec 2025 |
| 674 | derrytownshiphomes.com | GoDaddy.com, LLC | 27 Jul 2009 | 28 Jul 2024 | 27 Jul 2026 |
| 675 | derry-print.com | Tucows Domains Inc. | 17 Jun 1999 | 19 May 2025 | 17 Jun 2026 |
| 676 | derrythedroid.com | GoDaddy.com, LLC | 8 Oct 2010 | 9 Oct 2015 | 8 Oct 2016 |
| 677 | derryroundhousecourtapartments.com | GoDaddy.com, LLC | 28 Feb 2014 | 29 Feb 2016 | 28 Feb 2018 |
| 678 | derryphotos.com | Tucows Domains Inc. | 21 Sep 2011 | 16 Dec 2024 | 21 Sep 2025 |
| 679 | derrydiner.com | Launchpad, Inc. | 18 Nov 2020 | 19 Nov 2020 | 18 Nov 2021 |
| 680 | derrylcarter.com | eNom, Inc. | 2 Oct 2010 | 5 Oct 2017 | 2 Oct 2017 |
| 681 | derryfieldrestaurant.com | Network Solutions, LLC | 29 Nov 2001 | 30 Sep 2024 | 29 Nov 2029 |
| 682 | derryboots.com | DomainPrime.com LLC | 18 Feb 2013 | 19 Feb 2017 | 18 Feb 2018 |
| 683 | derrymeeleen.com | Amazon Registrar, Inc. | 6 May 2007 | 1 Apr 2025 | 6 May 2026 |
| 684 | derryleatrees.com | register.com, Inc. | 14 Feb 2003 | 13 Feb 2025 | 14 Feb 2026 |
| 685 | derryroofing.com | GoDaddy.com, LLC | 24 Jul 2010 | 24 Jul 2025 | 24 Jul 2026 |
| 686 | derryart.com | Network Solutions, LLC | 31 Mar 2009 | 1 Mar 2025 | 31 Mar 2026 |
| 687 | derrycityfc.com | GoDaddy.com, LLC | 25 Apr 2004 | 5 Apr 2025 | 25 Apr 2026 |
| 688 | derryckgreen.com | GoDaddy.com, LLC | 15 Apr 2013 | 4 May 2025 | 15 Apr 2027 |
| 689 | derryveagh.com | Name.com, Inc. | 29 Mar 2005 | 25 Mar 2025 | 29 Mar 2026 |
| 690 | derryweaver.com | Sibername Internet and Software Technologies Inc. | 7 Jan 2004 | 2 Jan 2025 | 7 Jan 2026 |
| 691 | derryremapping.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 8 Dec 2021 | 8 Dec 2021 | 8 Dec 2022 |
| 692 | derryroofingllc.com | GoDaddy.com, LLC | 16 Apr 2012 | 4 Jun 2025 | 16 Apr 2027 |
| 693 | derrytoday.com | Register.it SPA | 18 Oct 2015 | 2 Dec 2024 | 31 Jan 2026 |
| 694 | derrypneumatic.com | Bizcn.com, Inc. | 6 Jan 2014 | 10 Jan 2023 | 6 Jan 2026 |
| 695 | derrygaa.com | OVH sas | 16 Aug 2024 | 17 Aug 2025 | 16 Aug 2025 |
| 696 | derryhoo.com | NameCheap, Inc. | 28 Nov 1999 | 31 Dec 2024 | 28 Nov 2025 |
| 697 | derrysushibar.com | register.com, Inc. | 21 Apr 2023 | 4 Jul 2024 | 21 Apr 2024 |
| 698 | derrylmitchell.com | GMO Internet Inc. | 10 Nov 2023 | 21 Dec 2024 | 10 Nov 2024 |
| 699 | derrycityweb.com | eNom, Inc. | 28 Mar 2009 | 11 Mar 2024 | 28 Mar 2026 |
| 700 | derryfamily.com | Tucows Domains Inc. | 11 Dec 2000 | 10 Dec 2018 | 11 Dec 2026 |
| 701 | derryinfo.com | GoDaddy.com, LLC | 28 Nov 2007 | 12 Nov 2014 | 28 Nov 2016 |
| 702 | derrycity.com | Tucows Domains Inc. | 11 Feb 1998 | 3 Feb 2025 | 10 Feb 2026 |
| 703 | derrynaneseasports.com | Network Solutions, LLC | 11 May 2009 | 20 May 2025 | 11 May 2027 |
| 704 | derry-nh-realestate.com | Name.com, Inc. | 1 Sep 2007 | 26 Sep 2017 | 1 Sep 2017 |
| 705 | derryodonnell.com | Blacknight Internet Solutions Ltd. | 19 Mar 2009 | 14 Mar 2025 | 19 Mar 2026 |
| 706 | derrywholesaleautos.com | GoDaddy.com, LLC | 8 Jun 2012 | 9 Jun 2025 | 8 Jun 2026 |
| 707 | derryliveandloud.com | Everyones Internet, Ltd. dba SoftLayer | 25 Jul 2013 | 12 Nov 2015 | 25 Jul 2016 |
| 708 | derryhomesforsale.com | GoDaddy.com, LLC | 13 Sep 2022 | 14 Sep 2024 | 13 Sep 2026 |
| 709 | derrylimos.com | Hosting Concepts B.V. dba Openprovider | 1 Jul 2002 | 24 Jun 2025 | 1 Jul 2026 |
| 710 | derryarchitects.com | GoDaddy.com, LLC | 4 Sep 2013 | 5 Sep 2024 | 4 Sep 2025 |
| 711 | derrycitywalls.com | eNom, Inc. | 25 Feb 2005 | 11 Feb 2017 | 25 Feb 2018 |
| 712 | derrydol.com | NameCheap, Inc. | 7 Apr 2006 | 8 Mar 2025 | 7 Apr 2026 |
| 713 | derryplumbers.com | eNom, Inc. | 1 Feb 2008 | 18 Jan 2017 | 1 Feb 2018 |
| 714 | derrydeals.com | Tucows Domains Inc. | 6 Mar 2012 | 10 Mar 2020 | 6 Mar 2020 |
| 715 | derrymorefinancial.com | GoDaddy.com, LLC | 2 Jan 2013 | 3 Jan 2025 | 2 Jan 2026 |
| 716 | derryborofire.com | GoDaddy.com, LLC | 22 Mar 2011 | 23 Mar 2024 | 22 Mar 2026 |
| 717 | derryhippocottage.com | eNom, Inc. | 7 Sep 2009 | 10 Sep 2017 | 7 Sep 2017 |
| 718 | derrylounge.com | Wild West Domains, LLC | 18 Feb 2013 | 20 Jan 2015 | 18 Feb 2018 |
| 719 | derrythedog.com | Beijing Lanhai Jiye Technology Co., Ltd | 9 Nov 2022 | 10 Nov 2024 | 9 Nov 2025 |
| 720 | derryquay.com | GoDaddy.com, LLC | 10 Mar 2012 | 11 Mar 2025 | 10 Mar 2026 |
| 721 | derryberryassociates.com | GoDaddy.com, LLC | 1 Jun 2014 | 2 Jun 2016 | 1 Jun 2017 |
| 722 | derrydowns.com | Tucows Domains Inc. | 23 Aug 2024 | 27 Aug 2025 | 23 Aug 2026 |
| 723 | derryprint.com | TurnCommerce, Inc. DBA NameBright.com | 30 Sep 2020 | 9 Nov 2024 | 30 Sep 2024 |
| 724 | derryassoc.com | GoDaddy.com, LLC | 31 Jul 2013 | 1 Aug 2015 | 31 Jul 2017 |
| 725 | derrybarber.com | OnlineNIC, Inc. | 6 May 2020 | 23 Mar 2025 | 6 May 2026 |
| 726 | derrylrees.com | NetEarth One Inc. d/b/a NetEarth | 19 Mar 2002 | 22 Feb 2025 | 19 Mar 2026 |
| 727 | derrybegcottage.com | LCN.COM Ltd. | 5 Jan 2007 | 4 Jul 2017 | 5 Jan 2019 |
| 728 | derrylimited.com | eNom, Inc. | 29 Jan 2014 | 22 Jan 2025 | 29 Jan 2026 |
| 729 | derryquayns.com | MAFF Inc. | 30 Jul 2022 | 8 Oct 2023 | 30 Jul 2023 |
| 730 | derrygarve.com | Webfusion Ltd. | 8 Feb 2014 | 9 Feb 2025 | 8 Feb 2026 |
| 731 | derrywalsh.com | NameCheap, Inc. | 9 Jul 2024 | 10 Jul 2025 | 9 Jul 2026 |
| 732 | derryberrigan.com | Tucows Domains Inc. | 30 Apr 2006 | 4 May 2017 | 30 Apr 2017 |
| 733 | derryrush.com | GoDaddy.com, LLC | 6 Apr 2025 | 6 Apr 2025 | 6 Apr 2028 |
| 734 | derrymore.com | TurnCommerce, Inc. DBA NameBright.com | 10 Dec 2012 | 4 Dec 2020 | 10 Dec 2025 |
| 735 | derry-family.com | NameCheap, Inc. | 9 Jul 2004 | 4 Aug 2025 | 3 Sep 2026 |
| 736 | derrydigs.com | Amazon Registrar, Inc. | 10 Jan 2014 | 7 Dec 2024 | 10 Jan 2026 |
| 737 | derrydesign.com | Automattic Inc. | 13 Mar 2024 | 24 Jun 2024 | 13 Mar 2026 |
| 738 | derrypa.com | Cosmotown, Inc. | 16 Aug 2023 | 26 Sep 2024 | 16 Aug 2024 |
| 739 | derrystcarwash.com | GoDaddy.com, LLC | 29 Jun 2013 | 9 Aug 2024 | 29 Jun 2024 |
| 740 | derrymail.com | Name.com, Inc. | 7 May 2003 | 4 May 2025 | 7 May 2026 |
| 741 | derryoil.com | GoDaddy.com, LLC | 27 Sep 2012 | 27 Sep 2024 | 27 Sep 2025 |
| 742 | derryanne.com | GoDaddy.com, LLC | 14 May 2004 | 23 Sep 2024 | 14 May 2026 |
| 743 | derryprecisiontools.com | Melbourne IT, Ltd | 4 Jul 2000 | 11 Oct 2024 | 4 Jul 2027 |
| 744 | derryberrynaifeh.com | GoDaddy.com, LLC | 18 Oct 2006 | 21 Jul 2015 | 18 Oct 2016 |
| 745 | derrycityandstrabanedistrict.com | eNom, Inc. | 11 Apr 2014 | 13 Mar 2025 | 11 Apr 2026 |
| 746 | derrydevlin.com | Tucows Domains Inc. | 24 Nov 2013 | 3 May 2025 | 24 Nov 2025 |
| 747 | derrylbarnes.com | eNom, Inc. | 27 Jan 2002 | 26 Jan 2025 | 27 Jan 2026 |
| 748 | derrymeetinghouse.com | Tucows Domains Inc. | 3 Mar 2014 | 2 Mar 2025 | 3 Mar 2026 |
| 749 | derryonmonday.com | West263 International Limited | 28 Nov 2021 | 28 Nov 2021 | 28 Nov 2022 |
| 750 | derrychurchbakery.com | GMO Internet Inc. | 17 Aug 2017 | 27 Feb 2018 | 17 Aug 2018 |
| 751 | derryc.com | GoDaddy.com, LLC | 18 Oct 2009 | 19 Oct 2024 | 18 Oct 2029 |
| 752 | derryinstituteoftechnicaltraining.com | Blacknight Internet Solutions Ltd. | 4 Oct 2011 | 13 Sep 2017 | 4 Oct 2018 |
| 753 | derrylmclaren.com | GoDaddy.com, LLC | 6 Apr 2005 | 7 Apr 2024 | 6 Apr 2029 |
| 754 | derrysrichardson.com | Tucows Domains Inc. | 9 Nov 2004 | 11 Oct 2024 | 9 Nov 2025 |
| 755 | derrycycle.com | GoDaddy.com, LLC | 23 Apr 2004 | 21 Mar 2025 | 23 Apr 2026 |
| 756 | derrydentistry.com | Epik Inc. | 20 Aug 2013 | 7 Aug 2025 | 20 Aug 2026 |
| 757 | derrydesignandprinter.com | eNom, Inc. | 1 Oct 2010 | 5 Oct 2015 | 1 Oct 2016 |
| 758 | derrysgarage.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Sep 2012 | 24 Sep 2024 | 11 Sep 2025 |
| 759 | derryloran.com | 1&1 Internet AG | 25 Aug 2003 | 26 Aug 2025 | 25 Aug 2026 |
| 760 | derryowen.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 May 2008 | 7 May 2024 | 6 May 2025 |
| 761 | derryl.com | DreamHost, LLC | 6 Nov 1999 | 6 Oct 2024 | 6 Nov 2025 |
| 762 | derryrugcleaning.com | Webfusion Ltd. | 6 Jan 2014 | 30 Dec 2015 | 6 Jan 2018 |
| 763 | derryclassaction.com | GoDaddy.com, LLC | 28 Aug 2013 | 5 Feb 2024 | 28 Aug 2025 |
| 764 | derryairesphotography.com | Tucows Domains Inc. | 22 Jul 2004 | 26 Jul 2017 | 22 Jul 2017 |
| 765 | derryx.com | 1&1 Internet AG | 24 Jul 2010 | 24 Jul 2025 | 24 Jul 2026 |
| 766 | derrywaterlodge.com | Tucows Domains Inc. | 5 Jun 2009 | 9 Jun 2022 | 5 Jun 2022 |
| 767 | derrydalesadler.com | register.com, Inc. | 17 Aug 2006 | 18 Aug 2025 | 17 Aug 2026 |
| 768 | derryadam.com | 1&1 Internet AG | 26 Aug 2011 | 4 Sep 2024 | 26 Aug 2025 |
| 769 | derrybegholdings.com | Network Solutions, LLC | 19 May 2014 | 1 Jul 2025 | 19 May 2025 |
| 770 | derryvegal.com | Key-Systems GmbH | 14 Jan 2008 | 18 Jul 2016 | 14 Jan 2017 |
| 771 | derrysoccer-pa.com | GoDaddy.com, LLC | 8 Aug 2010 | 3 Jul 2016 | 8 Aug 2017 |
| 772 | derrylaptoprepairs.com | Webfusion Ltd. | 27 Oct 2008 | 20 Oct 2016 | 27 Oct 2017 |
| 773 | derryconstructioninc.com | Squarespace Domains LLC | 28 Jan 2025 | 28 Jan 2025 | 28 Jan 2026 |
| 774 | derryberryassoc.com | GoDaddy.com, LLC | 10 Jun 2024 | 10 Jun 2024 | 10 Jun 2027 |
| 775 | derryman.com | Network Solutions, LLC | 29 Jan 2024 | 13 Apr 2025 | 29 Jan 2025 |
| 776 | derryparking.com | Web Commerce Communications Limited dba WebNic.cc | 31 May 2023 | 28 May 2023 | 31 May 2024 |
| 777 | derrynorthernireland.com | Uniregistrar Corp | - | - | - |
| 778 | derrytradesmen.com | 1&1 Internet AG | 2 Dec 2004 | 3 Dec 2024 | 2 Dec 2025 |
| 779 | derrysheds.com | DropCatch.com 601 LLC | 1 May 2018 | 1 May 2018 | 1 May 2019 |
| 780 | derrynewhampshirerealestate.com | GoDaddy.com, LLC | 6 May 2004 | 6 May 2025 | 6 May 2026 |
| 781 | derrysfinishings.com | Google, Inc. | 12 Mar 2025 | 12 Mar 2025 | 12 Mar 2026 |
| 782 | derrynewhampshire.com | GoDaddy.com, LLC | 6 Mar 2000 | 6 Mar 2025 | 6 Mar 2026 |
| 783 | derryparklodge.com | - | 4 Apr 2024 | 7 Apr 2025 | 4 Apr 2026 |
| 784 | derrygirlslacrosse.com | GoDaddy.com, LLC | 8 Oct 2013 | 13 Dec 2023 | 8 Oct 2028 |
| 785 | derryhaveyoursay.com | Blacknight Internet Solutions Ltd. | 27 Feb 2008 | 6 Feb 2016 | 27 Feb 2017 |
| 786 | derrysauctions.com | GoDaddy.com, LLC | 16 Nov 2018 | 16 Nov 2018 | 16 Nov 2019 |
| 787 | derrydentist.com | eNom, Inc. | 3 Jun 2010 | 5 May 2025 | 3 Jun 2026 |
| 788 | derrycarshow.com | GoDaddy.com, LLC | 19 Jun 2007 | 20 Jun 2016 | 19 Jun 2017 |
| 789 | derryconstruction.com | Domain.com, LLC | 8 Mar 1999 | 9 Jul 2025 | 8 Mar 2026 |
| 790 | derryckbirch.com | Tucows Domains Inc. | 3 Dec 2013 | 7 Dec 2017 | 3 Dec 2017 |
| 791 | derrysrestaurant.com | GoDaddy.com, LLC | 12 Feb 2014 | 25 Apr 2024 | 12 Feb 2024 |
| 792 | derryproperty.com | 1&1 Internet AG | 31 Jan 2003 | 8 Mar 2018 | 31 Jan 2026 |
| 793 | derrysecuritycameras.com | GoDaddy.com, LLC | 3 Mar 2014 | 3 Mar 2014 | 3 Mar 2017 |
| 794 | derrycityonline.com | 1&1 Internet AG | 9 Jan 2006 | 10 Jan 2017 | 9 Jan 2018 |
| 795 | derryhaws.com | GoDaddy.com, LLC | 22 Jul 2006 | 23 Jul 2024 | 22 Jul 2026 |
| 796 | derryberrypatchwork.com | Omnis Network, LLC | 9 Aug 2005 | 10 Aug 2025 | 9 Aug 2026 |
| 797 | derryproducts.com | register.com, Inc. | 19 Feb 2000 | 21 Jan 2025 | 19 Feb 2027 |
| 798 | derryconnellmarine.com | - | 1 Jun 2012 | 14 May 2025 | 1 Jun 2026 |
| 799 | derrymarwick.com | Netistrar Limited | 4 Jul 2006 | 3 Jul 2025 | 4 Jul 2026 |
| 800 | derrynandrachel.com | TPP Wholesale Pty Ltd. | 13 Nov 2013 | 4 Oct 2016 | 13 Nov 2017 |
| 801 | derryselfcateringapartments.com | Hosting Concepts B.V. dba Openprovider | 11 Jul 2008 | 4 Jul 2025 | 11 Jul 2026 |
| 802 | derrychurchchocolates.com | 1API GmbH | 21 Aug 2017 | 21 Aug 2017 | 21 Aug 2018 |
| 803 | derrycashelcrafts.com | Hosting Concepts B.V. dba Openprovider | 27 Aug 2010 | 31 Jul 2025 | 27 Aug 2025 |
| 804 | derrytrailriders.com | GoDaddy.com, LLC | 22 Feb 2004 | 11 Jun 2024 | 22 Feb 2026 |
| 805 | derrytownshiplistingalerts.com | register.com, Inc. | 2 Jun 2011 | 2 Jun 2011 | 2 Jun 2026 |
| 806 | derrywrightfarms.com | GoDaddy.com, LLC | 5 Feb 2010 | 6 Feb 2025 | 5 Feb 2026 |
| 807 | derryaires.com | GoDaddy.com, LLC | 5 Nov 2021 | 5 Nov 2023 | 5 Nov 2025 |
| 808 | derrylubell.com | Tucows Domains Inc. | 16 Feb 2009 | 2 Feb 2025 | 16 Feb 2026 |
| 809 | derryjane.com | DropCatch.com 598 LLC | 24 Mar 2022 | 24 Apr 2023 | 24 Mar 2024 |
| 810 | derryboyps.com | Mesh Digital Limited | 8 Apr 2010 | 3 Apr 2025 | 8 Apr 2026 |
| 811 | derryguitar.com | Tucows Domains Inc. | 31 Jan 2012 | 4 Feb 2017 | 31 Jan 2017 |
| 812 | derrybrabbs.com | Tucows Domains Inc. | 20 Jun 2003 | 21 May 2025 | 20 Jun 2026 |
| 813 | derrytherapist.com | eNom, Inc. | 10 Dec 2013 | 30 Nov 2015 | 10 Dec 2016 |
| 814 | derrycunihy.com | DropCatch.com 1277 LLC | 19 Jun 2018 | 20 Jun 2020 | 19 Jun 2021 |
| 815 | derrylife.com | Hosting Concepts B.V. dba Openprovider | 18 Oct 2024 | 15 Jul 2025 | 18 Oct 2025 |
| 816 | derrychurchartisanchocolates.com | NameCheap, Inc. | 24 Jul 2025 | 24 Jul 2025 | 24 Jul 2026 |
| 817 | derryelectrolysis.com | GoDaddy.com, LLC | 2 Nov 2013 | 3 Nov 2024 | 2 Nov 2027 |
| 818 | derryweddingphotographer.com | Netistrar Limited | 29 Jan 2011 | 5 Feb 2025 | 29 Jan 2026 |
| 819 | derryguardian.com | NameCheap, Inc. | 9 Oct 2012 | 15 Sep 2024 | 9 Oct 2025 |
| 820 | derryteam.com | DNC Holdings, Inc. | 6 Oct 2022 | 18 Nov 2023 | 6 Oct 2023 |
| 821 | derryll.com | TurnCommerce, Inc. DBA NameBright.com | 2 Feb 2014 | 27 Jan 2021 | 2 Feb 2026 |
| 822 | derrypsychotherapy.com | DropCatch.com 1063 LLC | 15 Aug 2017 | 15 Aug 2017 | 15 Aug 2018 |
| 823 | derryrealestatelistings.com | Moniker Online Services LLC | 1 Apr 2009 | 14 May 2025 | 1 Apr 2025 |
| 824 | derry500.com | West263 International Limited | 2 Apr 2021 | 2 Apr 2021 | 2 Apr 2022 |
| 825 | derrypediatricdentistry.com | GoDaddy.com, LLC | 15 May 2014 | 16 May 2025 | 15 May 2026 |
| 826 | derryaccountingandtaxation.com | GoDaddy.com, LLC | 3 Apr 2013 | 14 Apr 2024 | 3 Apr 2025 |
| 827 | derryhotairballoons.com | GoDaddy.com, LLC | 17 Sep 2009 | 4 Sep 2015 | 17 Sep 2016 |
| 828 | derry-bs.com | Webfusion Ltd. | 21 Jul 2006 | 20 Jul 2025 | 21 Jul 2026 |
| 829 | derrysdownunder.com | Melbourne IT, Ltd | 9 Jul 2010 | 5 Jul 2025 | 9 Jul 2026 |
| 830 | derrywarehouse.com | DomainPeople, Inc. | 9 Apr 2013 | 25 Mar 2025 | 9 Apr 2026 |
| 831 | derryfit.com | Tucows Domains Inc. | 11 Jun 2014 | 15 Jun 2019 | 11 Jun 2019 |
| 832 | derrydobermans.com | DOMAIN NAME NETWORK PTY LTD | 7 Oct 2024 | 7 Oct 2024 | 7 Oct 2025 |
| 833 | derryfeedbiz.com | eNom, Inc. | 23 Sep 2011 | 11 Sep 2023 | 23 Sep 2025 |
| 834 | derrypost.com | Blacknight Internet Solutions Ltd. | 10 Feb 2007 | 5 Feb 2025 | 10 Feb 2026 |
| 835 | derryloans.com | GoDaddy.com, LLC | 18 Feb 2004 | 25 Feb 2016 | 18 Feb 2018 |
| 836 | derrymor.com | Blacknight Internet Solutions Ltd. | 24 Apr 2014 | 7 Jun 2025 | 24 Apr 2025 |
| 837 | derryinklink.com | eNom, Inc. | 2 Feb 2010 | 26 Jan 2025 | 2 Feb 2026 |
| 838 | derrygladfolkmuseum.com | Protocol Internet Technology Limited T/A Hosting I… | 13 Sep 2008 | 16 Jul 2024 | 13 Sep 2025 |
| 839 | derrysexport.com | Xin Net Technology Corporation | 17 Mar 2018 | 20 Mar 2018 | 17 Mar 2019 |
| 840 | derrywood.com | eNom, Inc. | 21 Mar 2000 | 24 Mar 2025 | 21 Mar 2026 |
| 841 | derryautorepair.com | 1&1 Internet AG | 22 Mar 2024 | 6 Apr 2024 | 22 Mar 2026 |
| 842 | derryvreehouse.com | Register.it SPA | 25 Jan 2008 | 29 Jun 2024 | 25 Jan 2026 |
| 843 | derrywaterhouse.com | Tucows Domains Inc. | 24 Nov 2022 | 11 Nov 2024 | 24 Nov 2025 |
| 844 | derrynaneselfcatering.com | eNom, Inc. | 3 Feb 2006 | 20 Jan 2017 | 3 Feb 2018 |
| 845 | derrydonegal.com | TurnCommerce, Inc. DBA NameBright.com | 28 Jul 2019 | 12 Feb 2025 | 28 Jul 2025 |
| 846 | derrydillon.com | Blacknight Internet Solutions Ltd. | 27 Dec 2011 | 22 Dec 2023 | 27 Dec 2025 |
| 847 | derryphotography.com | Namesilo, LLC | 22 Oct 2024 | 22 Oct 2024 | 22 Oct 2025 |
| 848 | derryberrychiropractic.com | Squarespace Domains LLC | 4 Aug 2008 | 5 Sep 2024 | 4 Aug 2026 |
| 849 | derrybusiness.com | GoDaddy.com, LLC | 5 Aug 2012 | 15 Sep 2024 | 5 Aug 2024 |
| 850 | derrymoto.com | Tucows Domains Inc. | 29 Jun 2024 | 9 Aug 2025 | 29 Jun 2025 |
| 851 | derry-plumbers.com | Xin Net Technology Corporation | 19 Jan 2021 | 19 Jan 2021 | 19 Jan 2022 |
| 852 | derryckpestcontrol.com | - | 26 Oct 2010 | 26 Oct 2010 | 26 Oct 2017 |
| 853 | derryweddingphotography.com | eNom, Inc. | 24 Apr 2014 | 10 Apr 2016 | 24 Apr 2017 |
| 854 | derrytheband.com | GMO Internet Inc. | 27 Sep 2017 | 27 Sep 2017 | 27 Sep 2018 |
| 855 | derryberries.com | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Jun 2019 | 26 Jun 2019 | 26 Jun 2020 |
| 856 | derrymusic.com | Webfusion Ltd. | 16 Jan 2010 | 11 Jan 2025 | 16 Jan 2027 |
| 857 | derryberrypt.com | GoDaddy.com, LLC | 23 Feb 2010 | 24 Feb 2024 | 23 Feb 2026 |
| 858 | derryhabir.com | DropCatch.com 347 LLC | 16 Jul 2017 | 16 Jul 2017 | 16 Jul 2018 |
| 859 | derryrailroaddays.com | GoDaddy.com, LLC | 24 Mar 2010 | 25 Mar 2025 | 24 Mar 2028 |
| 860 | derrydownway.com | GoDaddy.com, LLC | 15 May 2014 | 16 May 2016 | 15 May 2017 |
| 861 | derrypeds.com | GoDaddy.com, LLC | 19 May 2004 | 22 Apr 2024 | 19 May 2029 |
| 862 | derryyouthcommunity.com | Internet Domain Services BS Corp | 26 May 2022 | 27 May 2023 | 26 May 2024 |
| 863 | derrystautorepair.com | DomainPeople, Inc. | 7 Jan 2011 | 9 Dec 2016 | 7 Jan 2018 |
| 864 | derrydalegolf.com | register.com, Inc. | 7 Nov 2003 | 7 Nov 2024 | 7 Nov 2031 |
| 865 | derryhomes.com | GoDaddy.com, LLC | 22 Oct 2002 | 15 Mar 2025 | 22 Oct 2025 |
| 866 | derrylocal.com | Tucows Domains Inc. | 18 Jan 2011 | 22 Jan 2017 | 18 Jan 2017 |
| 867 | derryfoods.com | DropCatch.com 1526 LLC | 13 Nov 2017 | 13 Nov 2017 | 13 Nov 2018 |
| 868 | derryhealthcenter.com | GoDaddy.com, LLC | 21 May 2011 | 22 May 2025 | 21 May 2027 |
| 869 | derryaccommodation.com | Hosting Concepts B.V. dba Openprovider | 3 Apr 2024 | 21 Jul 2025 | 3 Apr 2026 |
| 870 | derryairporttransfers.com | Wild West Domains, LLC | 26 Mar 2011 | 12 Apr 2016 | 26 Mar 2017 |
| 871 | derrylin.com | Tucows Domains Inc. | 13 Mar 2007 | 4 Mar 2025 | 13 Mar 2027 |
| 872 | derryjayneread.com | Tucows Domains Inc. | 9 Aug 2013 | 13 Aug 2017 | 9 Aug 2017 |
| 873 | derryfieldmedicalgroup.com | Network Solutions, LLC | 16 Jun 2004 | 5 Mar 2017 | 16 Jun 2020 |
| 874 | derry-bs-mail.com | CloudFlare, Inc. | 8 Aug 2014 | 9 Jul 2025 | 8 Aug 2026 |
| 875 | derrycricket.com | Blacknight Internet Solutions Ltd. | 14 Feb 2012 | 24 Jan 2015 | 14 Feb 2018 |
| 876 | derryyank.com | Tucows Domains Inc. | 20 Feb 2012 | 13 Feb 2025 | 20 Feb 2026 |
| 877 | derrywoodpc.com | GoDaddy.com, LLC | 2 Apr 2014 | 26 Mar 2015 | 2 Apr 2017 |
| 878 | derrydalefarm.com | GoDaddy.com, LLC | 4 May 2010 | 4 May 2025 | 4 May 2027 |
| 879 | derrylgabel.com | GoDaddy.com, LLC | 4 Jul 2001 | 30 Jun 2025 | 4 Jul 2026 |
| 880 | derryfamilylife.com | GoDaddy.com, LLC | 29 Sep 2011 | 16 Dec 2024 | 29 Sep 2025 |
| 881 | derrybryson.com | GoDaddy.com, LLC | 7 Jul 2001 | 21 Jul 2025 | 7 Jul 2026 |
| 882 | derryclassifieds.com | GoDaddy.com, LLC | 9 Oct 2008 | 5 Oct 2015 | 9 Oct 2016 |
| 883 | derrynh.com | Network Solutions, LLC | 7 Nov 1996 | 14 Jun 2022 | 6 Nov 2031 |
| 884 | derryckthornton.com | GoDaddy.com, LLC | 21 Jun 2012 | 22 May 2016 | 21 Jun 2017 |
| 885 | derryclooneylodge.com | Protocol Internet Technology Limited T/A Hosting I… | 5 Apr 2002 | 2 Jun 2017 | 5 Apr 2018 |
| 886 | derryitconsulting.com | Gandi SAS | 23 Feb 2011 | 20 Jan 2025 | 23 Feb 2026 |
| 887 | derryservicedapartments.com | 1&1 Internet AG | 29 Sep 2011 | 29 Oct 2017 | 29 Sep 2018 |
| 888 | derryhyundai.com | DropCatch.com 476 LLC | 5 Jul 2019 | 5 Jul 2019 | 5 Jul 2020 |
| 889 | derryhomeimprovement.com | GoDaddy.com, LLC | 22 Jul 2010 | 23 Jul 2014 | 22 Jul 2016 |
| 890 | derrybars.com | Tucows Domains Inc. | 31 Oct 2024 | 2 May 2025 | 31 Oct 2025 |
| 891 | derrysmith.com | Google, Inc. | 18 May 2020 | 18 May 2025 | 18 May 2026 |
| 892 | derryckmcluhan.com | GoDaddy.com, LLC | 23 Jan 2014 | 1 Apr 2025 | 23 Jan 2026 |
| 893 | derrylo.com | HiChina Zhicheng Technology Limited | 22 May 2012 | 13 Apr 2017 | - |
| 894 | derrycitygrantaid.com | GMO Internet Inc. | 7 Feb 2021 | 7 Feb 2021 | 7 Feb 2022 |
| 895 | derrypd.com | Network Solutions, LLC | 6 Jun 2011 | 7 Apr 2025 | 6 Jun 2026 |
| 896 | derrywilkinson.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 13 Jan 2009 | 18 Jul 2025 | 13 Jan 2026 |
| 897 | derrylondonderry.com | eNom, Inc. | 23 Oct 2009 | 27 Sep 2017 | 23 Oct 2019 |
| 898 | derrymedical.com | Tucows Domains Inc. | 26 May 1999 | 24 Apr 2023 | 26 May 2026 |
| 899 | derrymortgagecentre.com | 1&1 Internet AG | 30 May 2008 | 14 Apr 2025 | 30 May 2026 |
| 900 | derrydeter.com | eNom, Inc. | 21 Jan 2013 | 20 Dec 2013 | 21 Jan 2017 |
| 901 | derryairporttaxis.com | GoDaddy.com, LLC | 9 Feb 2012 | 6 Feb 2025 | 9 Feb 2026 |
| 902 | derryberryac.com | GoDaddy.com, LLC | 9 Feb 2006 | 11 Apr 2025 | 9 Feb 2028 |
| 903 | derrynane.com | GMO Internet Inc. | 15 Apr 1998 | 13 Apr 2025 | 14 Apr 2026 |
| 904 | derryvalefurniture.com | - | 28 Apr 2023 | 11 Jun 2025 | 28 Apr 2025 |
| 905 | derrytaheny.com | eNom, Inc. | 22 Mar 2011 | 21 Mar 2025 | 22 Mar 2026 |
| 906 | derryphilip.com | GoDaddy.com, LLC | 1 Aug 2012 | 12 Sep 2022 | 1 Aug 2026 |
| 907 | derryvisitor.com | TLDs LLC dba SRSplus | 6 Mar 1999 | 7 Mar 2025 | 6 Mar 2026 |
| 908 | derrymorgan.com | Melbourne IT, Ltd | 5 Jul 2005 | 9 Oct 2024 | 5 Jul 2026 |
| 909 | derry-line.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Feb 2008 | 17 Jan 2016 | 1 Feb 2017 |
| 910 | derryfield.com | Network Solutions, LLC | 3 Aug 1995 | 3 Jun 2025 | 2 Aug 2028 |
| 911 | derryliverycab.com | GoDaddy.com, LLC | 16 Jul 2008 | 27 Sep 2024 | 16 Jul 2024 |
| 912 | derrynhrealestate.com | GoDaddy.com, LLC | 21 Nov 2000 | 13 Sep 2024 | 12 Sep 2025 |
| 913 | derrynanegaa.com | CloudFlare, Inc. | 4 Jan 2006 | 5 Dec 2024 | 4 Jan 2026 |
| 914 | derrymorecapital.com | FastDomain Inc. | 1 Feb 2014 | 1 Feb 2017 | 1 Feb 2018 |
| 915 | derrylargey.com | Domain.com, LLC | 25 Nov 2002 | 5 Nov 2024 | 25 Nov 2025 |
| 916 | derrynhrealtor.com | GoDaddy.com, LLC | 19 Sep 2006 | 20 Sep 2024 | 19 Sep 2025 |
| 917 | derrychurch.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 18 Oct 2021 | 19 Oct 2021 | 18 Oct 2022 |
| 918 | derrywolverine.com | Network Solutions, LLC | 25 Jul 2012 | 13 Mar 2022 | 25 Jul 2028 |
| 919 | derrychiropractic.com | Tucows Domains Inc. | 15 Feb 2000 | 31 Jan 2025 | 15 Feb 2026 |
| 920 | derryghosts.com | Netistrar Limited | 23 Nov 2002 | 21 Nov 2024 | 23 Nov 2026 |
| 921 | derrypeacebridge.com | Tucows Domains Inc. | 29 Jun 2011 | 3 Jul 2019 | 29 Jun 2019 |
| 922 | derrykanddisa.com | GoDaddy.com, LLC | 14 Sep 2013 | 22 Sep 2015 | 14 Sep 2016 |
| 923 | derry-air.com | Network Solutions, LLC | 31 Jan 2012 | 1 Dec 2023 | 31 Jan 2027 |
| 924 | derrysphotos.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 11 Nov 2012 | 29 Jan 2016 | 11 Nov 2016 |
| 925 | derryberryal.com | Tucows Domains Inc. | 27 Jan 2014 | 31 Jan 2019 | 27 Jan 2019 |
| 926 | derrytaxiservice.com | Tucows Domains Inc. | 5 Jun 2014 | 9 Jun 2018 | 5 Jun 2018 |
| 927 | derryyoga.com | GoDaddy.com, LLC | 6 Mar 2019 | 6 Mar 2019 | 6 Mar 2020 |
| 928 | derryvillageclasses.com | GoDaddy.com, LLC | 12 Jan 2011 | 13 Jan 2016 | 12 Jan 2017 |
| 929 | derrynswork.com | eNom, Inc. | 20 Mar 2014 | 17 Feb 2015 | 20 Mar 2017 |
| 930 | derrydale.com | Dynadot, LLC | 30 Mar 1999 | 6 Aug 2024 | 30 Mar 2026 |
| 931 | derryairconditioning.com | register.com, Inc. | 12 Apr 2013 | 24 Apr 2025 | 12 Apr 2026 |
| 932 | derrybeck.com | Tucows Domains Inc. | 19 Jul 2013 | 20 Jun 2025 | 19 Jul 2026 |
| 933 | derryodowd.com | CloudFlare, Inc. | 12 Jan 2009 | 21 Feb 2025 | 12 Jan 2025 |
| 934 | derrybennett.com | Tucows Domains Inc. | 12 Aug 2024 | 16 Aug 2025 | 12 Aug 2026 |
| 935 | derrytech.com | Tucows Domains Inc. | 29 Dec 2005 | 28 Dec 2024 | 29 Dec 2025 |
| 936 | derryforums.com | NameCheap, Inc. | 9 Jun 2005 | 22 Jun 2025 | 9 Jun 2026 |
| 937 | derryprenkert.com | Wix.com Ltd. | 1 Apr 2008 | 2 Mar 2025 | 1 Apr 2026 |
| 938 | derryauncrafts.com | - | 2 Jul 2002 | 13 May 2025 | 2 Jul 2026 |
| 939 | derryskemer.com | NameCheap, Inc. | 20 Mar 2023 | 1 May 2024 | 20 Mar 2024 |
| 940 | derrystandard.com | NameCheap, Inc. | 29 Nov 2009 | 28 Nov 2024 | 29 Nov 2025 |
| 941 | derry24.com | West263 International Limited | 1 Feb 2020 | 1 Feb 2020 | 1 Feb 2021 |
| 942 | derrysketcher.com | eNom, Inc. | 12 Mar 2014 | 11 Mar 2025 | 12 Mar 2026 |
| 943 | derrymensah.com | Webfusion Ltd. | 21 May 2020 | 21 May 2020 | 21 May 2021 |
| 944 | derryhale-transport.com | TLDs LLC dba SRSplus | 12 Feb 2002 | 27 Mar 2025 | 12 Feb 2025 |
| 945 | derryest.com | DropCatch.com 1489 LLC | 23 Feb 2019 | 23 Feb 2019 | 23 Feb 2020 |
| 946 | derryph.com | register.com, Inc. | 16 Apr 2013 | 24 Apr 2025 | 16 Apr 2026 |
| 947 | derryarea.com | TurnCommerce, Inc. DBA NameBright.com | 12 Feb 2014 | 25 Apr 2025 | 12 Feb 2025 |
| 948 | derrytunes.com | Network Solutions, LLC | 21 Mar 2012 | 5 Mar 2017 | 20 Mar 2018 |
| 949 | derryspann.com | CloudFlare, Inc. | 10 Dec 2013 | 20 Dec 2024 | 10 Dec 2025 |
| 950 | derryapartments.com | Key-Systems GmbH | 23 Feb 2023 | 8 May 2024 | 23 Feb 2024 |
| 951 | derryanimalhospital.com | GoDaddy.com, LLC | 16 Mar 2005 | 23 Jun 2025 | 16 Mar 2026 |
| 952 | derrynhfleamarket.com | DropCatch.com 1307 LLC | 21 Nov 2021 | 21 Nov 2021 | 21 Nov 2022 |
| 953 | derryelectrical.com | GoDaddy.com, LLC | 12 Oct 2013 | 13 Oct 2015 | 12 Oct 2017 |
| 954 | derrymcdermott.com | GMO Internet Inc. | 4 Jul 2023 | 14 Sep 2024 | 4 Jul 2024 |
| 955 | derrycitysocialclub.com | eNom, Inc. | 19 Jun 2014 | 31 Jul 2016 | 19 Jun 2016 |
| 956 | derryphotofestival.com | Webfusion Ltd. | 24 Jul 2014 | 8 Aug 2025 | 24 Jul 2026 |
| 957 | derryhoyland.com | Beijing Lanhai Jiye Technology Co., Ltd | 27 Apr 2024 | 30 Jul 2025 | 27 Apr 2026 |
| 958 | derryronanestud.com | GoDaddy.com, LLC | 20 Dec 2018 | 20 Dec 2018 | 20 Dec 2020 |
| 959 | derrynbrown.com | GoDaddy.com, LLC | 15 Feb 2011 | 26 Aug 2024 | 15 Feb 2026 |
| 960 | derryfordelectrical.com | Everyones Internet, Ltd. dba SoftLayer | 17 Aug 2010 | 11 Jan 2017 | 17 Aug 2018 |
| 961 | derryfleadh2013.com | GoDaddy.com, LLC | 28 Jan 2012 | 29 Jan 2015 | 28 Jan 2017 |
| 962 | derrylperry.com | GoDaddy.com, LLC | 9 Sep 1999 | 1 Sep 2023 | 9 Sep 2025 |
| 963 | derryvenues.com | TierraNet Inc. d/b/a DomainDiscover | 10 Aug 2007 | 27 Jul 2025 | 10 Aug 2026 |
| 964 | derryplayhouse.com | Register.it SPA | 7 Sep 2018 | 7 Sep 2024 | 7 Sep 2025 |
| 965 | derrynissan.com | GoDaddy.com, LLC | 7 May 2012 | 4 May 2015 | 7 May 2018 |
| 966 | derrydentalcentre.com | Protocol Internet Technology Limited T/A Hosting I… | 18 Jun 2014 | 15 Jun 2017 | 18 Jun 2018 |
| 967 | derrysleepclinic.com | Webfusion Ltd. | 28 Sep 2010 | 28 Aug 2017 | 28 Sep 2018 |
| 968 | derrylodge.com | GoDaddy.com, LLC | 13 Jul 2011 | 2 Aug 2015 | 13 Jul 2016 |
| 969 | derrynsemple.com | Network Solutions, LLC | 17 Feb 2025 | 24 Feb 2025 | 17 Feb 2026 |
| 970 | derryberryzips.com | GoDaddy.com, LLC | 25 Aug 2003 | 26 Aug 2025 | 25 Aug 2026 |
| 971 | derrynaflanhouse.com | - | 17 Oct 2023 | 18 Dec 2024 | 17 Oct 2024 |
| 972 | derryairport.com | TLDs LLC dba SRSplus | 28 May 2002 | 29 May 2025 | 28 May 2026 |
| 973 | derryquicklocksmith.com | GoDaddy.com, LLC | 6 May 2014 | 7 May 2025 | 6 May 2026 |
| 974 | derrycounseling.com | GoDaddy.com, LLC | 23 May 2019 | 1 Jul 2025 | 23 May 2026 |
| 975 | derrytools.com | eNom, Inc. | 29 Nov 2006 | 31 Oct 2024 | 29 Nov 2025 |
| 976 | derryhomesecurity.com | Wild West Domains, LLC | 1 Apr 2013 | 6 Apr 2016 | 1 Apr 2019 |
| 977 | derrysneardeathexperience.com | BigRock Solutions Ltd. | 22 Apr 2007 | 22 Jul 2016 | 22 Apr 2017 |
| 978 | derrygifts.com | 1&1 Internet AG | 8 Jun 2011 | 9 Jun 2025 | 8 Jun 2026 |
| 979 | derry-londonderry.com | Eranet International Limited | 18 Apr 2022 | 2 Jun 2023 | 18 Apr 2023 |
| 980 | derrywedding.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 1 Jun 2023 | 1 Jun 2024 | 1 Jun 2025 |
| 981 | derryring.com | HiChina Zhicheng Technology Limited | 27 May 2014 | 16 Apr 2024 | 27 May 2026 |
| 982 | derryguide.com | Namesilo, LLC | 21 Jun 2003 | 21 Jul 2025 | 21 Jun 2026 |
| 983 | derrykickboxingclasses.com | GoDaddy.com, LLC | 5 Jan 2012 | 6 Jan 2014 | 5 Jan 2017 |
| 984 | derrynhinch.com | Beijing Lanhai Jiye Technology Co., Ltd | 8 Mar 2023 | 8 Mar 2025 | 8 Mar 2026 |
| 985 | derrybawnhouse.com | GoDaddy.com, LLC | 27 Jan 2020 | 27 Jan 2020 | 27 Jan 2021 |
| 986 | derryford.com | DropCatch.com 400 LLC | 5 Jul 2019 | 5 Jul 2019 | 5 Jul 2020 |
| 987 | derrycheng.com | eName Technology Co., Ltd. | 18 Jun 2025 | 27 Jun 2025 | 18 Jun 2026 |
| 988 | derryhumanesociety.com | Network Solutions, LLC | 18 Oct 1999 | 28 Oct 2024 | 18 Oct 2026 |
| 989 | derryplumbingandheating.com | register.com, Inc. | 28 Oct 2008 | 1 Oct 2024 | 28 Oct 2025 |
| 990 | derry32csm.com | GMO Internet Inc. | 27 Nov 2023 | 8 Jan 2025 | 27 Nov 2024 |
| 991 | derryquaylodge.com | Register.it SPA | 20 Oct 2008 | 14 May 2010 | 20 Oct 2019 |
| 992 | derrywater.com | Brandon Gray Internet Services, Inc. (dba NameJuic… | 20 Nov 2002 | 20 Feb 2025 | 20 Nov 2028 |
| 993 | derrymontessori.com | Metaregistrar BV Applications | 26 Jan 2025 | 27 Mar 2025 | 26 Jan 2026 |
| 994 | derrypediatricdentist.com | GoDaddy.com, LLC | 15 May 2014 | 16 May 2025 | 15 May 2026 |
| 995 | derrystockbridge.com | Beijing Lanhai Jiye Technology Co., Ltd | 6 Nov 2022 | 8 Jan 2025 | 6 Nov 2024 |
| 996 | derrywhyte.com | Beijing Lanhai Jiye Technology Co., Ltd | 8 May 2021 | 9 May 2023 | 8 May 2024 |
| 997 | derrysirishpub.com | eNom, Inc. | 24 Jul 2012 | 28 Jul 2016 | 24 Jul 2016 |
| 998 | derryandneha.com | Tucows Domains Inc. | 23 Jun 2014 | 3 Jun 2025 | 23 Jun 2026 |
| 999 | derryckmenere.com | Xin Net Technology Corporation | 17 Dec 2005 | 15 Jan 2025 | 17 Dec 2029 |
| 1000 | derrybarbellclub.com | Freeparking Domain Registrars, Inc. | 2 May 2013 | 4 Apr 2016 | 2 May 2019 |
Displaying 1,000 out of 2,777 domains starting with the keyword "DERRY". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=derry
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |