With support for 
Keyword: CLASHOFCLANS
Reverse Whois » KEYWORD [clashofclans ] { 2,625 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | clashofclans.com | GoDaddy.com, LLC | 30 May 2012 | 31 May 2024 | 30 May 2027 |
| 2 | clashofclans.fr | - | 23 Dec 2012 | 23 Dec 2017 | 23 Dec 2018 |
| 3 | clashofclans.web.tr | - | 1 Oct 2013 | - | 30 Sep 2016 |
| 4 | clashofclans.ir | - | - | - | - |
| 5 | clashofclans.su | - | 5 Jul 2022 | - | 5 Jul 2025 |
| 6 | clashofclans.vn | - | - | - | - |
| 7 | clashofclans.co.kr | - | 22 Mar 2014 | 9 Aug 2018 | 22 Mar 2023 |
| 8 | clashofclans.party | Name.com, Inc. | 5 Mar 2015 | 14 May 2015 | 4 Mar 2016 |
| 9 | clashofclans.pro | NameCheap, Inc. | 10 Feb 2023 | 24 Mar 2025 | 10 Feb 2025 |
| 10 | clashofclans.club | NameCheap, Inc. | 17 May 2019 | 17 May 2019 | 17 May 2020 |
| 11 | clashofclans.tokyo | GMO Internet Inc. | 27 Jul 2014 | 27 Jul 2014 | 27 Jul 2018 |
| 12 | clashofclans.uno | eNom, Inc. | 7 Sep 2014 | 7 Sep 2014 | 6 Sep 2015 |
| 13 | clashofclans.today | eNom, Inc. | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2017 |
| 14 | clashofclans.rocks | GoDaddy.com, LLC | 29 Aug 2017 | 29 Aug 2017 | 29 Aug 2018 |
| 15 | clashofclans.center | TLD Registrar Solutions Ltd. | 11 Aug 2015 | 29 Sep 2017 | 11 Aug 2018 |
| 16 | clashofclans.ninja | Name.com, Inc. | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 17 | clashofclans.guide | Namesilo, LLC | 24 Jul 2019 | 7 Jul 2020 | 24 Jul 2021 |
| 18 | clashofclans.gratis | eNom, Inc. | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 19 | clashofclans.ovh | OVH sas | 28 Nov 2014 | 22 Feb 2017 | 28 Nov 2018 |
| 20 | clashofclans.website | Hosting Ukraine LLC | 2 Jan 2023 | 14 Feb 2024 | 2 Jan 2024 |
| 21 | clashofclans.city | Eranet International Limited | 7 Jan 2022 | 7 Jan 2023 | 7 Jan 2024 |
| 22 | clashofclans.nyc | GoDaddy.com, LLC | 8 Jan 2015 | 8 Jan 2015 | 7 Jan 2017 |
| 23 | clashofclans.link | GMO Internet Inc. | 6 Nov 2016 | 11 Nov 2016 | 6 Nov 2017 |
| 24 | clashofclans.life | NameCheap, Inc. | 9 Mar 2019 | 14 Mar 2019 | 9 Mar 2020 |
| 25 | clashofclans.how | Tucows Domains Inc. | 4 Feb 2015 | 8 Feb 2016 | 4 Feb 2017 |
| 26 | clashofclans.systems | GoDaddy.com, LLC | 19 Feb 2015 | 20 Feb 2015 | 19 Feb 2016 |
| 27 | clashofclans.space | GMO Internet Inc. | 14 Oct 2024 | 19 Oct 2024 | 14 Oct 2025 |
| 28 | clashofclans.click | NameCheap, Inc. | 7 Sep 2023 | 19 Oct 2024 | 7 Sep 2024 |
| 29 | clashofclans.news | CloudFlare, Inc. | 6 Jul 2024 | 11 Jun 2025 | 6 Jul 2026 |
| 30 | clashofclans.buzz | GoDaddy.com, LLC | 13 Aug 2015 | 14 Aug 2015 | 12 Aug 2016 |
| 31 | clashofclans.kim | FBS Inc. | 16 Apr 2015 | - | 16 Apr 2016 |
| 32 | clashofclans.video | GoDaddy.com, LLC | 17 May 2015 | 17 May 2015 | 17 May 2016 |
| 33 | clashofclans.work | FBS Inc. | 20 May 2015 | 22 May 2015 | 20 May 2016 |
| 34 | clashofclans.casa | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 35 | clashofclans.world | Epik Inc. | 2 Dec 2021 | 3 Dec 2021 | 2 Dec 2022 |
| 36 | clashofclans.business | Google, Inc. | 15 Jul 2018 | 15 Jul 2018 | 15 Jul 2019 |
| 37 | clashofclans.gift | Uniregistrar Corp | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 38 | clashofclans.one | NameCheap, Inc. | 2 Apr 2023 | 17 Apr 2024 | 2 Apr 2024 |
| 39 | clashofclans.wiki | CloudFlare, Inc. | 7 Jan 2024 | 13 Dec 2024 | 7 Jan 2026 |
| 40 | clashofclans.tools | TLD Registrar Solutions Ltd. | 10 Aug 2015 | 23 Jul 2017 | 10 Aug 2018 |
| 41 | clashofclans.expert | TLD Registrar Solutions Ltd. | 10 Aug 2015 | 6 Mar 2017 | 10 Aug 2017 |
| 42 | clashofclans.chat | Google, Inc. | 4 Jan 2024 | 3 Jun 2025 | 4 Jan 2026 |
| 43 | clashofclans.ooo | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 44 | clashofclans.webcam | Alpnames Limited | 7 May 2015 | - | 6 May 2016 |
| 45 | clashofclans.online | GoDaddy.com, LLC | 12 Jan 2024 | 23 Feb 2025 | 12 Jan 2025 |
| 46 | clashofclans.site | Hostinger, UAB | 3 Oct 2024 | 8 Oct 2024 | 3 Oct 2025 |
| 47 | clashofclans.lol | NameCheap, Inc. | 24 Aug 2023 | 5 Oct 2024 | 24 Aug 2024 |
| 48 | clashofclans.gold | GoDaddy.com, LLC | 8 Jan 2017 | 13 Jan 2017 | 8 Jan 2018 |
| 49 | clashofclans.events | Tucows Domains Inc. | 31 Jan 2017 | 4 Feb 2018 | 31 Jan 2019 |
| 50 | clashofclans.support | Tucows Domains Inc. | 19 Nov 2015 | 23 Nov 2016 | 19 Nov 2017 |
| 51 | clashofclans.solutions | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 14 Nov 2015 | 6 Jan 2017 | 14 Nov 2017 |
| 52 | clashofclans.gifts | Tucows Domains Inc. | 19 Nov 2015 | 20 Nov 2015 | 19 Nov 2016 |
| 53 | clashofclans.tech | DOTSERVE INC. | 30 Dec 2024 | 1 Feb 2025 | 30 Dec 2025 |
| 54 | clashofclans.press | NameCheap, Inc. | 1 Dec 2015 | 1 Dec 2015 | 1 Dec 2016 |
| 55 | clashofclans.sale | GoDaddy.com, LLC | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2016 |
| 56 | clashofclans.christmas | Uniregistrar Corp | 29 Dec 2015 | 29 Dec 2015 | 29 Dec 2016 |
| 57 | clashofclans.asia | DNSPod, Inc. | 22 Oct 2021 | 22 Oct 2021 | 22 Oct 2022 |
| 58 | clashofclans.land | Mesh Digital Limited | 23 Mar 2021 | 23 Mar 2021 | 23 Mar 2022 |
| 59 | clashofclans.top | Porkbun, LLC | 28 Nov 2023 | 10 Jan 2025 | 28 Nov 2024 |
| 60 | clashofclans.game | Nom-iq Ltd. dba COM LAUDE | 2 May 2016 | 12 Apr 2025 | 2 May 2026 |
| 61 | clashofclans.science | Alpnames Limited | 25 Feb 2015 | 14 Jul 2016 | 24 Feb 2017 |
| 62 | clashofclans.guru | Mesh Digital Limited | 5 Mar 2014 | 3 Mar 2016 | 5 Mar 2017 |
| 63 | clashofclans.biz | Nom-iq Ltd. dba COM LAUDE | 30 May 2012 | 20 Nov 2024 | 29 May 2028 |
| 64 | clashofclans.store | NameCheap, Inc. | 21 Jun 2024 | 22 Jun 2025 | 21 Jun 2026 |
| 65 | clashofclans.ws | Namesilo, LLC | 4 Sep 2014 | 4 Sep 2023 | 4 Sep 2024 |
| 66 | clashofclans.info | Nom-iq Ltd. dba COM LAUDE | 30 May 2012 | 20 Nov 2024 | 30 May 2028 |
| 67 | clashofclans.mobi | Nom-iq Ltd. dba COM LAUDE | 30 May 2012 | 20 Nov 2024 | 30 May 2028 |
| 68 | clashofclans.net | Nom-iq Ltd. dba COM LAUDE | 30 May 2012 | 21 Apr 2025 | 30 May 2028 |
| 69 | clashofclans.org | Nom-iq Ltd. dba COM LAUDE | 30 May 2012 | 20 Nov 2024 | 30 May 2028 |
| 70 | clashofclans.cat | Soluciones Corporativas IP, SLU | 12 Oct 2015 | 14 Oct 2016 | 12 Oct 2016 |
| 71 | clashofclans.co | Dynadot, LLC | 9 Mar 2020 | 14 Mar 2024 | 9 Mar 2024 |
| 72 | clashofclans.eu | - | - | - | - |
| 73 | clashofclans.co.uk | - | 8 Jul 2024 | 10 Nov 2024 | 8 Jul 2025 |
| 74 | clashofclans.xyz | GMO Internet Inc. | 25 Aug 2024 | 21 Jan 2025 | 25 Aug 2025 |
| 75 | clashofclans.tips | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 28 Mar 2017 | 29 Sep 2017 | 28 Mar 2018 |
| 76 | clashofclans.money | TLD Registrar Solutions Ltd. | 30 May 2017 | 29 Sep 2017 | 30 May 2018 |
| 77 | clashofclans.ltd | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Sep 2022 | 26 Sep 2022 | 26 Sep 2023 |
| 78 | clashofclans.live | NameCheap, Inc. | 3 Oct 2017 | 3 Oct 2017 | 3 Oct 2018 |
| 79 | clashofclans.network | Eranet International Limited | 7 Jan 2022 | 12 Jan 2022 | 7 Jan 2023 |
| 80 | clashofclans.org.uk | - | 21 Dec 2016 | 21 Dec 2016 | 21 Dec 2017 |
| 81 | clashofclans.services | Google, Inc. | 9 Oct 2018 | 9 Oct 2018 | 9 Oct 2019 |
| 82 | clashofclans.onl | GoDaddy.com, LLC | 8 Oct 2019 | 22 Nov 2024 | 8 Oct 2025 |
| 83 | clashofclans.moe | OVH sas | 13 May 2021 | 10 Jun 2025 | 13 May 2025 |
| 84 | clashofclans.ru.com | NameKing.com Inc. | 22 Mar 2022 | 9 Apr 2022 | 22 Mar 2023 |
| 85 | clashofclans.cloud | GMO Internet Inc. | 18 Feb 2024 | 20 Mar 2025 | 18 Feb 2026 |
| 86 | clashofclans.cn | ???????????? | 11 Oct 2012 | - | 11 Oct 2029 |
| 87 | clashofclans.us | Nom-iq Ltd. dba COM LAUDE | 30 May 2012 | 20 Nov 2024 | 29 May 2028 |
| 88 | clashofclans.global | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Oct 2022 | 29 Oct 2022 | 29 Oct 2023 |
| 89 | clashofclans.uk | - | 5 Jan 2023 | 13 Jan 2024 | 5 Jan 2026 |
| 90 | clashofclans.app | Nom-iq Ltd. dba COM LAUDE | 29 Mar 2018 | 21 Apr 2025 | 29 Mar 2026 |
| 91 | clashofclans.blog | NameCheap, Inc. | 13 Nov 2024 | 18 Nov 2024 | 13 Nov 2025 |
| 92 | clashofclans.ca | - | 25 Oct 2022 | 7 Nov 2024 | 25 Oct 2025 |
| 93 | clashofclans.in | Hostinger, UAB | 9 Mar 2024 | 9 Mar 2025 | 9 Mar 2025 |
| 94 | clashofclans.io | Above.com Pty Ltd. | 3 Jul 2021 | 28 May 2025 | 3 Jul 2026 |
| 95 | clashofclans.shop | Porkbun, LLC | 28 Nov 2023 | 19 Jan 2024 | 28 Nov 2024 |
| 96 | clashofclans.market | Limited Liability Company "Registrar of domain nam… | 29 Dec 2023 | 6 Feb 2025 | 29 Dec 2024 |
| 97 | clashofclans.email | NameCheap, Inc. | 30 Jan 2024 | 13 Mar 2025 | 30 Jan 2025 |
| 98 | clashofclans.pics | Porkbun, LLC | 17 Feb 2024 | 2 Apr 2025 | 17 Feb 2025 |
| 99 | clashofclans.fun | - | 10 May 2025 | 4 Jun 2025 | 10 May 2026 |
| 100 | clashofclans.co.th | - | 26 Jan 2018 | 5 Dec 2024 | 25 Jan 2026 |
| 101 | clashofclans.com.br | - | 20 Aug 2012 | 22 Jul 2024 | 20 Aug 2026 |
| 102 | clashofclans.hu | - | 4 Sep 2017 | - | - |
| 103 | clashofclans.cz | - | 20 Apr 2022 | 20 Apr 2022 | 20 Apr 2025 |
| 104 | clashofclans.forum | NameCheap, Inc. | 17 Dec 2024 | 22 Dec 2024 | 17 Dec 2025 |
| 105 | clashofclans.de | - | - | 31 Jan 2025 | - |
| 106 | clashofclans.jp | - | 18 Mar 2016 | 1 Apr 2025 | 31 Mar 2026 |
| 107 | clashofclans-base.com | GoDaddy.com, LLC | 6 Feb 2022 | 6 Feb 2022 | 6 Feb 2023 |
| 108 | clashofclans-coc.com | UdomainName.com LLC | 25 Jan 2018 | 26 Jan 2018 | 25 Jan 2019 |
| 109 | clashofclans-dicas.com | Dynadot, LLC | 3 Apr 2014 | 31 Mar 2025 | 3 Apr 2026 |
| 110 | clashofclans-gemmesfr.com | Lucky Elephant Domains, LLC | 6 Mar 2016 | 6 Mar 2017 | 6 Mar 2018 |
| 111 | clashofclans-hacks.com | 1&1 Internet AG | 12 Sep 2019 | 12 Sep 2019 | 12 Sep 2020 |
| 112 | clashofclans-tools.com | CloudFlare, Inc. | 7 Jun 2013 | 8 May 2025 | 7 Jun 2026 |
| 113 | clashofclans-tracker.com | CloudFlare, Inc. | 22 May 2014 | 2 Nov 2024 | 22 May 2026 |
| 114 | clashofclans-world.com | eNom1035, Inc. | 28 Jul 2017 | 28 Jul 2017 | 28 Jul 2018 |
| 115 | clashofclansapp.net | Beijing Lanhai Jiye Technology Co., Ltd | 12 May 2021 | 13 May 2023 | 12 May 2024 |
| 116 | clashofclansbr.com.br | - | - | - | - |
| 117 | clashofclansbuilder.com | GMO Internet Inc. | 14 Jan 2013 | 13 Jun 2025 | 14 Jan 2027 |
| 118 | clashofclansforpcc.com | Namesilo, LLC | 5 Jun 2014 | 22 Apr 2025 | 5 Jun 2026 |
| 119 | clashofclansforpcs.com | DropCatch.com 1312 LLC | 21 Jul 2022 | 21 Aug 2023 | 21 Jul 2023 |
| 120 | clashofclansforum.de | - | - | 18 Jul 2016 | - |
| 121 | clashofclansgameonline.com | Hosting Concepts B.V. dba Openprovider | 8 Sep 2022 | 7 Sep 2024 | 8 Sep 2025 |
| 122 | clashofclansgamesonline.com | NameCheap, Inc. | 16 Nov 2018 | 16 Nov 2018 | 16 Nov 2019 |
| 123 | clashofclansgemhack.com | GoDaddy.com, LLC | 7 Nov 2021 | 10 Nov 2021 | 7 Nov 2022 |
| 124 | clashofclansgemsrewards.com | Above.com Pty Ltd. | 25 Apr 2014 | 28 Jan 2025 | 25 Apr 2026 |
| 125 | clashofclansguidehq.com | Dynadot, LLC | 28 Apr 2018 | 27 Apr 2025 | 28 Apr 2026 |
| 126 | clashofclanshackapk.com | Tucows Domains Inc. | 31 Jul 2021 | 31 Jul 2021 | 31 Jul 2022 |
| 127 | clashofclanshackedapk.com | HiChina Zhicheng Technology Limited | 8 Oct 2018 | 8 Oct 2018 | 8 Oct 2019 |
| 128 | clashofclanshackonline.org | Internet Domain Services BS Corp | 13 Jun 2014 | 8 Jun 2017 | 13 Jun 2018 |
| 129 | clashofclanshacksnosurvey.com | DropCatch.com 887 LLC | 23 Dec 2019 | 23 Dec 2019 | 23 Dec 2020 |
| 130 | clashofclanshackunlimitedgems.com | Above.com Pty Ltd. | 9 Nov 2018 | 19 Jan 2024 | 9 Nov 2023 |
| 131 | clashofclanshelper.eu | USA Intra Corp. | - | - | - |
| 132 | clashofclanshilesi.com | Dynadot, LLC | 9 Jan 2021 | 9 Jan 2021 | 9 Jan 2022 |
| 133 | clashofclansmio.com | GoDaddy.com, LLC | 23 Feb 2024 | 7 May 2025 | 23 Feb 2025 |
| 134 | clashofclanstips.org | Domeneshop AS dba domainnameshop.com | 17 Dec 2013 | 21 May 2025 | 17 Dec 2026 |
| 135 | clashofclanstool.com | GoDaddy.com, LLC | 6 Apr 2023 | 18 May 2024 | 6 Apr 2024 |
| 136 | clashofclanstr.com | IHS Telekom, Inc. | 1 Oct 2012 | 3 Dec 2024 | 1 Oct 2025 |
| 137 | clashofclansgem.net | eNom, Inc. | 19 Oct 2014 | 19 Oct 2014 | 19 Oct 2015 |
| 138 | clashofclanstroopupgrades.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 139 | clashofclans-wiki.ru | - | - | - | - |
| 140 | clashofclans-wikia.com | Domain.com, LLC | 26 Apr 2016 | 4 Oct 2016 | 26 Apr 2017 |
| 141 | clashofclansforecaster.com | GoDaddy.com, LLC | 21 Feb 2015 | 28 Jun 2025 | 21 Feb 2026 |
| 142 | clashofclans-layouts.com | CloudFlare, Inc. | 2 Mar 2015 | 5 Mar 2025 | 2 Mar 2026 |
| 143 | clashofclansdownload.net | GoDaddy.com, LLC | 7 Dec 2014 | 8 Dec 2024 | 7 Dec 2025 |
| 144 | clashofclanspcworld.com | enom387, Incorporated | 14 May 2024 | 17 May 2025 | 14 May 2026 |
| 145 | clashofclanssucks.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 146 | clashofclanshackcheat.com | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Mar 2021 | 24 Mar 2021 | 24 Mar 2022 |
| 147 | clashofclansaction.com | OnlineNIC, Inc. | 23 Oct 2014 | 24 Oct 2014 | 23 Oct 2015 |
| 148 | clashofclans-hacknow.com | GoDaddy.com, LLC | 3 Apr 2017 | 3 Apr 2017 | 3 Apr 2018 |
| 149 | clashofclans-hackgems.com | TLD Registrar Solutions Ltd. | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 150 | clashofclans-hack-tool.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Mar 2021 | 23 May 2023 | 21 Mar 2023 |
| 151 | clashofclans-hack-gems.com | GoDaddy.com, LLC | 14 Apr 2017 | 14 Apr 2017 | 14 Apr 2018 |
| 152 | clashofclansastuces.us | eNom, Inc. | 22 Oct 2014 | 22 Oct 2014 | 21 Oct 2015 |
| 153 | clashofclansgame.ir | - | - | - | - |
| 154 | clashofclanspcs.net | GoDaddy.com, LLC | 26 Sep 2014 | 21 Apr 2015 | 26 Sep 2015 |
| 155 | clashofclanstaktik.com | GoDaddy.com, LLC | 24 Jun 2014 | 21 Jun 2015 | 24 Jun 2016 |
| 156 | clashofclans-tolls.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 157 | clashofclans-france.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 158 | clashofclanstuts.com | GMO Internet Inc. | 20 Sep 2019 | 6 Jan 2025 | 20 Sep 2025 |
| 159 | clashofclanscorner.com | GoDaddy.com, LLC | 24 May 2014 | 25 May 2015 | 24 May 2016 |
| 160 | clashofclanshackez.com | GoDaddy.com, LLC | 7 Nov 2014 | 16 Nov 2014 | 7 Nov 2015 |
| 161 | clashofclanspcdownload.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 14 Jan 2016 | 15 Jan 2017 | 14 Jan 2018 |
| 162 | clashofclansdating.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Nov 2015 | 7 Nov 2015 | 7 Nov 2016 |
| 163 | clashofclansfreegem.com | 1API GmbH | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 164 | clashofclans-gems.com | GoDaddy.com, LLC | 19 Jul 2019 | 19 Jul 2019 | 19 Jul 2020 |
| 165 | clashofclanshelpme.com | GoDaddy.com, LLC | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 166 | clashofclanshack-new.com | Beijing Lanhai Jiye Technology Co., Ltd | 3 Mar 2022 | 4 Apr 2023 | 3 Mar 2023 |
| 167 | clashofclansgemme-france.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 168 | clashofclans-tool.net | eNom, Inc. | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 169 | clashofclansgemshack.net | Dynadot, LLC | 25 Mar 2017 | 4 Apr 2017 | 25 Mar 2018 |
| 170 | clashofclansgemscheats.net | TLD Registrar Solutions Ltd. | 26 Oct 2014 | 27 Oct 2014 | 26 Oct 2015 |
| 171 | clashofclans-strategy.com | eNom, Inc. | 8 Mar 2016 | 8 Mar 2016 | 8 Mar 2017 |
| 172 | clashofclansonline.com | GoDaddy.com, LLC | 4 Oct 2012 | 5 Oct 2024 | 4 Oct 2025 |
| 173 | clashofclanstricks.com | eNom, Inc. | 26 May 2016 | 24 May 2017 | 26 May 2018 |
| 174 | clashofclansdownloads.com | GoDaddy.com, LLC | 20 Aug 2014 | 22 Apr 2015 | 20 Aug 2015 |
| 175 | clashofclansmarket.com | GoDaddy.com, LLC | 20 Aug 2014 | 20 Oct 2014 | 20 Aug 2015 |
| 176 | clashofclansprotips.com | GoDaddy.com, LLC | 20 Aug 2014 | 22 Apr 2015 | 20 Aug 2015 |
| 177 | clashofclanshacks.com | Key-Systems GmbH | 11 Jan 2013 | 17 Feb 2025 | 11 Jan 2026 |
| 178 | clashofclanslottery.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 179 | clashofclansfreepc.com | TLD Registrar Solutions Ltd. | 14 Mar 2015 | 14 Mar 2015 | 14 Mar 2016 |
| 180 | clashofclansbuilder.org | IHS Telekom, Inc. | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 181 | clashofclansbulder.com | Tucows Domains Inc. | 31 Aug 2017 | 31 Aug 2017 | 31 Aug 2018 |
| 182 | clashofclansnetwork.com | GoDaddy.com, LLC | 19 Jan 2014 | 19 Jan 2025 | 19 Jan 2026 |
| 183 | clashofclanswebsites.com | GoDaddy.com, LLC | 19 Jul 2013 | 20 Jul 2014 | 19 Jul 2015 |
| 184 | clashofclansforpc.com | Namesilo, LLC | 13 Sep 2019 | 17 Nov 2024 | 13 Sep 2024 |
| 185 | clashofclanshacktool.com | Key-Systems GmbH | 4 Mar 2013 | 8 Apr 2025 | 4 Mar 2026 |
| 186 | clashofclanscheatcodes.com | Key-Systems GmbH | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 187 | clashofclanstalk.com | - | - | - | - |
| 188 | clashofclanspcplayfree.com | TLD Registrar Solutions Ltd. | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 189 | clashofclanswarplan.com | Internet Domain Services BS Corp | 16 Apr 2021 | 16 Apr 2021 | 16 Apr 2022 |
| 190 | clashofclanstroopshack.com | NameCheap, Inc. | 29 Jan 2024 | 30 Jan 2025 | 29 Jan 2026 |
| 191 | clashofclanscheats-hack.com | GoDaddy.com, LLC | 10 Jun 2014 | 11 Jun 2015 | 10 Jun 2016 |
| 192 | clashofclans-hackcheats.net | GoDaddy.com, LLC | 10 Jun 2014 | 11 Jun 2015 | 10 Jun 2016 |
| 193 | clashofclansmn.com | GoDaddy.com, LLC | 28 Dec 2013 | 4 May 2015 | 28 Dec 2015 |
| 194 | clashofclanshelper.com | Key-Systems GmbH | 12 Sep 2019 | 21 Jan 2025 | 12 Sep 2025 |
| 195 | clashofclanshackdownload.com | eNom, Inc. | 30 Jul 2013 | 6 Aug 2014 | 30 Jul 2015 |
| 196 | clashofclanshack.com | - | 15 Feb 2025 | 20 Mar 2025 | 15 Feb 2026 |
| 197 | clashofclanscheater.com | GoDaddy.com, LLC | 7 Dec 2022 | 18 Feb 2024 | 7 Dec 2023 |
| 198 | clashofclansgemreward.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 199 | clashofclansunlimitedgems.com | Domain Landing Zone LLC | 20 Nov 2016 | 21 Nov 2017 | 20 Nov 2018 |
| 200 | clashofclanshacknodownload.com | GoDaddy.com, LLC | 9 Dec 2019 | 9 Dec 2019 | 9 Dec 2020 |
| 201 | clashofclansforums.com | NameCheap, Inc. | 14 Feb 2020 | - | 14 Feb 2021 |
| 202 | clashofclans-pc.com | GMO Internet Inc. | 26 Nov 2018 | 26 Nov 2018 | 26 Nov 2019 |
| 203 | clashofclansoyna.com | GoDaddy.com, LLC | 31 Mar 2016 | 31 Mar 2016 | 31 Mar 2017 |
| 204 | clashofclanssource.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2016 |
| 205 | clashofclanshacktips.com | GMO Internet Inc. | 24 Jan 2016 | 25 Nov 2016 | 24 Jan 2018 |
| 206 | clashofclansgemshacks.com | GoDaddy.com, LLC | 4 Oct 2019 | 4 Oct 2019 | 4 Oct 2020 |
| 207 | clashofclansbases.com | Hostinger, UAB | 7 Jan 2025 | 9 Mar 2025 | 7 Jan 2026 |
| 208 | clashofclanssecret.com | Name.com, Inc. | 22 Mar 2015 | 22 Mar 2015 | 22 Mar 2016 |
| 209 | clashofclanstips.net | - | 1 Jun 2023 | 3 Aug 2024 | 1 Jun 2024 |
| 210 | clashofclansgemshack.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 211 | clashofclansapk.net | Key-Systems GmbH | 13 Sep 2021 | 13 Sep 2022 | 13 Sep 2023 |
| 212 | clashofclansgemhack.org | Namesilo, LLC | 28 Feb 2016 | 28 Feb 2016 | 28 Feb 2017 |
| 213 | clashofclanswarmachine.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2023 | 20 Aug 2026 |
| 214 | clashofclansnews.com | 1&1 Internet AG | 12 Jun 2025 | 12 Jun 2025 | 12 Jun 2026 |
| 215 | clashofclans-blog.com | Launchpad, Inc. | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 216 | clashofclans-wiki.net | DomainContext, Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 217 | clashofclanstrucchigemme.com | eName Technology Co., Ltd. | 21 May 2019 | 21 May 2019 | 21 May 2020 |
| 218 | clashofclans-cheats.com | 1&1 Internet AG | 26 Jun 2016 | 24 Apr 2017 | 26 Jun 2018 |
| 219 | clashofclansdefensestrategy.com | GoDaddy.com, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 220 | clashofclansgemshelper.com | Tucows Domains Inc. | 28 Feb 2015 | 3 Mar 2016 | 28 Feb 2017 |
| 221 | clashofclansstrategyguides.com | GoDaddy.com, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 222 | clashofclanswalkthrough.com | GoDaddy.com, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 223 | clashofclanscheatsforfree.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 224 | clashofclanshackspro.com | GoDaddy.com, LLC | 22 Aug 2014 | 23 Aug 2014 | 22 Aug 2015 |
| 225 | clashofclanstutor.com | eNom, Inc. | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 226 | clashofclanswikia.com | PSI-USA, Inc. dba Domain Robot | 22 Aug 2014 | 16 Nov 2016 | 22 Aug 2017 |
| 227 | clashofclansyesiltashilesi.com | FBS Inc. | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 228 | clashofclanstooll.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 229 | clashofclansastucetriche.com | NameCheap, Inc. | 22 Mar 2023 | 3 May 2024 | 22 Mar 2024 |
| 230 | clashofclansmc.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 231 | clashofclanscheatsdeutsch.net | eNom, Inc. | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 232 | clashofclansmod.org | Launchpad, Inc. | 24 Jun 2015 | 26 Jun 2017 | 24 Jun 2019 |
| 233 | clashofclansunlimited.com | GoDaddy.com, LLC | 5 Aug 2022 | 16 Sep 2023 | 5 Aug 2023 |
| 234 | clashofclansastuces.net | Cronon AG | 24 Feb 2017 | 24 Feb 2017 | 24 Feb 2018 |
| 235 | clashofclanshacksonline.com | Baronofdomains.com LLC | 14 Nov 2015 | 7 Oct 2017 | 14 Nov 2018 |
| 236 | clashofclansz.com | GoDaddy.com, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 237 | clashofclans-hacker.com | Internet.bs Corp. | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 238 | clashofclanscheat.org | Internet.bs Corp. | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 239 | clashofclanstricherie.com | eNom, Inc. | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 240 | clashofclansturkiye.net | FBS Inc. | 18 Apr 2019 | 18 Apr 2019 | 18 Apr 2020 |
| 241 | clashofclanshacksguide.com | BigRock Solutions Ltd. | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2015 |
| 242 | clashofclanspc.org | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 243 | clashofclanse.com | GoDaddy.com, LLC | 12 Dec 2023 | 12 Dec 2023 | 12 Dec 2024 |
| 244 | clashofclanst.com | Network Solutions, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 245 | clashofclansapk.com | One.com A/S | 3 Dec 2024 | 3 Dec 2024 | 3 Dec 2025 |
| 246 | clashofclanstriches.com | GoDaddy.com, LLC | 14 Nov 2016 | 14 Nov 2016 | 14 Nov 2017 |
| 247 | clashofclansfadedhack.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 248 | clashofclansbuolder.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 249 | clashofclansbd.com | Name.com, Inc. | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 250 | clashofclanshacknosurveynopassword.net | GoDaddy.com, LLC | 25 Jan 2017 | 25 Jan 2017 | 25 Jan 2018 |
| 251 | clashofclansulmatehacks.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 252 | clashofclansvideos.com | Beijing Lanhai Jiye Technology Co., Ltd | 8 Mar 2021 | 10 May 2023 | 8 Mar 2023 |
| 253 | clashofclanscheats.asia | BigRock Solutions Ltd. | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 254 | clashofclansgeneratore.com | Top Tier Domains LLC | 31 Jan 2017 | 31 Jan 2017 | 31 Jan 2018 |
| 255 | clashofclansadvisor.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 256 | clashofclanscheats2015.com | eNom, Inc. | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 257 | clashofclans-cheatshacks.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 25 Sep 2018 | 25 Sep 2018 | 25 Sep 2019 |
| 258 | clashofclansrank.com | Nobel Networks | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 259 | clashofclansranking.com | Nobel Networks | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 260 | clashofclansrankings.com | Nobel Networks | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 261 | clashofclansfreegems.org | Namesilo, LLC | 28 Feb 2016 | 28 Feb 2016 | 28 Feb 2017 |
| 262 | clashofclansgemstool.com | GoDaddy.com, LLC | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 263 | clashofclansgemshacktool.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 264 | clashofclansunlimitedhacks.com | eNom, Inc. | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 265 | clashofclans-freegems.com | eNom, Inc. | 13 Oct 2016 | 24 Nov 2017 | 13 Oct 2017 |
| 266 | clashofclansdadepre.com | Network Solutions, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 267 | clashofclansph.org | PSI-USA, Inc. dba Domain Robot | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 268 | clashofclanscheatsengine.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Aug 2017 | 2 Aug 2017 | 2 Aug 2018 |
| 269 | clashofclansdb.com | eNom, Inc. | 3 Sep 2014 | 17 Jan 2017 | 3 Sep 2017 |
| 270 | clashofclanshackcheats.com | GMO Internet Inc. | 4 Jan 2017 | 15 Feb 2018 | 4 Jan 2018 |
| 271 | clashofclanslaboratory.com | GoDaddy.com, LLC | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 272 | clashofclans-gemmes-france.com | Gandi SAS | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 273 | clashofclansgemmes-france.com | GoDaddy.com, LLC | 19 Sep 2014 | 20 Sep 2014 | 19 Sep 2015 |
| 274 | clashofclansgemmesillimites.com | Internet Domain Services BS Corp | 20 Sep 2014 | 14 Jan 2016 | 20 Sep 2017 |
| 275 | clashofclanshelp.com | PSI-USA, Inc. dba Domain Robot | 19 Sep 2014 | 16 Nov 2016 | 19 Sep 2017 |
| 276 | clashofclanslayouts.com | Hostinger, UAB | 8 May 2025 | 19 Jun 2025 | 8 May 2026 |
| 277 | clashofclansgemmesillimite.com | GMO Internet Inc. | 18 Feb 2019 | 18 Feb 2019 | 18 Feb 2020 |
| 278 | clashofclans-kentucky44.com | Freeparking Domain Registrars, Inc. | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 279 | clashofclansonpc.com | Above.com Pty Ltd. | 13 Sep 2024 | 13 Sep 2024 | 13 Sep 2025 |
| 280 | clashofclansplayhere.com | Internet.bs Corp. | 7 Sep 2014 | 7 Sep 2014 | 7 Sep 2015 |
| 281 | clashofclansmaster.com | eNom, Inc. | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 282 | clashofclans-layout.com | Dynadot, LLC | 7 Mar 2021 | 26 Feb 2025 | 7 Mar 2026 |
| 283 | clashofclans-gemmesfrance.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 284 | clashofclansmafia.com | GoDaddy.com, LLC | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 285 | clashofclanshacks.net | SiteName Ltd. | 29 Dec 2016 | 30 Dec 2017 | 29 Dec 2017 |
| 286 | clashofclanshelpers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Oct 2014 | 4 Oct 2014 | 4 Oct 2015 |
| 287 | clashofclanscentro.com | GoDaddy.com, LLC | 11 Jan 2016 | 11 Jan 2016 | 11 Jan 2017 |
| 288 | clashofclansparadise.com | register.com, Inc. | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 289 | clashofclanscalculator.biz | Realtime Register B.V. | 24 Sep 2013 | 4 Oct 2014 | 23 Sep 2014 |
| 290 | clashofclansguru.com | GoDaddy.com, LLC | 4 Oct 2014 | 4 Oct 2014 | 4 Oct 2015 |
| 291 | clashofclans99.com | GoDaddy.com, LLC | 8 Apr 2016 | 8 Apr 2016 | 8 Apr 2017 |
| 292 | clashofclanscheatsdeutsch.com | eNom, Inc. | 18 Mar 2016 | 18 Mar 2016 | 18 Mar 2017 |
| 293 | clashofclansdescargar.com | GoDaddy.com, LLC | 11 Sep 2014 | 19 Sep 2016 | 11 Sep 2017 |
| 294 | clashofclanshack2015.com | DROPCATCH.COM 746 LLC | 28 Nov 2015 | 29 Nov 2015 | 28 Nov 2016 |
| 295 | clashofclanstipsandtricks.com | 1&1 Internet AG | 2 Jan 2016 | 3 Jan 2017 | 2 Jan 2018 |
| 296 | clashofclanshackplanet.com | GMO Internet Inc. | 24 Feb 2016 | 1 Feb 2017 | 24 Feb 2018 |
| 297 | clashofclans-hack.net | GMO Internet Inc. | 25 Jul 2018 | 25 Jul 2018 | 25 Jul 2019 |
| 298 | clashofclanspage.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 299 | clashofclanswars.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 300 | clashofclans-wiki.com | GoDaddy.com, LLC | 16 Mar 2024 | 28 May 2025 | 16 Mar 2025 |
| 301 | clashofclansaccounts.com | Tucows Domains Inc. | 24 Sep 2024 | 24 Sep 2024 | 24 Sep 2025 |
| 302 | clashofclanshacksntips.com | eNom, Inc. | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 303 | clashofclans-hacksonline.com | Key-Systems GmbH | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 304 | clashofclansgemas.com | Name.com, Inc. | 5 Mar 2016 | 5 Mar 2016 | 5 Mar 2017 |
| 305 | clashofclansmodupdatableapk.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 306 | clashofclansgiveaway.com | GoDaddy.com, LLC | 11 Feb 2019 | 11 Feb 2019 | 11 Feb 2020 |
| 307 | clashofclansblog.net | eNom, Inc. | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 308 | clashofclanstipshq.com | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 309 | clashofclanswarrior.com | eNom, Inc. | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 310 | clashofclansgameplayfree.com | Internet.bs Corp. | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 311 | clashofclansmodapk.com | NameCheap, Inc. | 21 Feb 2025 | 25 Feb 2025 | 21 Feb 2026 |
| 312 | clashofclansbugs.com | Namesilo, LLC | 8 Oct 2014 | 17 Jun 2017 | 8 Oct 2017 |
| 313 | clashofclanshack2014gem.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Oct 2014 | 9 Oct 2014 | 9 Oct 2015 |
| 314 | clashofclanshacks.us | NameCheap, Inc. | 28 Jun 2017 | 28 Jun 2017 | 27 Jun 2018 |
| 315 | clashofclansmanager.com | Key-Systems GmbH | 26 Dec 2022 | 9 Mar 2024 | 26 Dec 2023 |
| 316 | clashofclansmax.com | BigRock Solutions Ltd. | 8 Oct 2014 | 8 Sep 2016 | 8 Oct 2017 |
| 317 | clashofclanselite.com | eNom, Inc. | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 318 | clashofclansastucerie.com | Internet.bs Corp. | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 319 | clashofclansgaladonboombeachnewclasher.com | register.com, Inc. | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2016 |
| 320 | clashofclanshack8.com | GoDaddy.com, LLC | 8 Apr 2019 | 8 Apr 2019 | 8 Apr 2020 |
| 321 | clashofclanshackguide.com | GoDaddy.com, LLC | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 322 | clashofclansguides.com | DropCatch.com 929 LLC | 9 Oct 2022 | 19 Nov 2024 | 9 Oct 2024 |
| 323 | clashofclans-clans.com | 1&1 Internet AG | 23 Nov 2014 | 23 Nov 2016 | 23 Nov 2017 |
| 324 | clashofclansrow.com | GoDaddy.com, LLC | 16 Oct 2014 | 28 Oct 2016 | 16 Oct 2017 |
| 325 | clashofclanshacktooldevice.com | GoDaddy.com, LLC | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2015 |
| 326 | clashofclansjuwelenhack.com | GoDaddy.com, LLC | 23 Nov 2014 | 24 Nov 2016 | 23 Nov 2017 |
| 327 | clashofclanshackdeutsh.com | GoDaddy.com, LLC | 23 Nov 2014 | 23 Nov 2014 | 23 Nov 2015 |
| 328 | clashofclansdev.com | Key-Systems GmbH | 22 Jan 2016 | 22 Jan 2016 | 22 Jan 2017 |
| 329 | clashofclansgemrewards.com | Key-Systems GmbH | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 330 | clashofclansrehberi.com | GoDaddy.com, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 331 | clashofclanstemplates.com | eNom, Inc. | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 332 | clashofclansweb.com | Acens Technologies, S.L.U. | 22 Apr 2017 | 22 Apr 2017 | 22 Apr 2018 |
| 333 | clashofclansliburni.com | - | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2017 |
| 334 | clashofclanshackofficial.com | Epik Inc. | 11 Jul 2017 | 11 Jul 2017 | 11 Jul 2018 |
| 335 | clashofclanshackk.com | GoDaddy.com, LLC | 31 May 2017 | 31 May 2017 | 31 May 2018 |
| 336 | clashofclanscommunity.com | BigRock Solutions Ltd. | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 337 | clashofclans33.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 338 | clashofclans2015.com | Network Solutions, LLC | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 339 | clashofclansgratuit.com | eNom, Inc. | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 340 | clashofclansfree-hack.com | NameCheap, Inc. | 2 Mar 2022 | 13 Apr 2023 | 2 Mar 2023 |
| 341 | clashofclansfrancegemmes.com | 1API GmbH | 27 Feb 2016 | 27 Feb 2016 | 27 Feb 2018 |
| 342 | clashofclanscheats.info | NameKing.com Inc. | 19 Dec 2021 | 19 Dec 2021 | 19 Dec 2022 |
| 343 | clashofclanscheat.info | GoDaddy.com, LLC | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 344 | clashofclansastuce.info | GoDaddy.com, LLC | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 345 | clashofclansastuce2015.com | eNom, Inc. | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 346 | clashofclanshackscheatsnosurvey.com | eNom, Inc. | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 347 | clashofclansparapc.net | Namesilo, LLC | 6 Jan 2017 | 6 Jan 2018 | 6 Jan 2018 |
| 348 | clashofclansgenerator.net | GoDaddy.com, LLC | 26 Jul 2019 | 7 Oct 2024 | 26 Jul 2024 |
| 349 | clashofclansgemyesiltashilesi.mobi | FBS Inc. | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 350 | clashofclansadder.com | GoDaddy.com, LLC | 19 Oct 2014 | 19 Oct 2014 | 19 Oct 2015 |
| 351 | clashofclansdownloadforpc.com | Key-Systems GmbH | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 352 | clashofclansforpc.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Jan 2017 | 20 Mar 2017 | 18 Jan 2018 |
| 353 | clashofclansbuldier.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2015 |
| 354 | clashofclanshacktriche.net | Dynadot, LLC | 30 Nov 2014 | 30 Nov 2014 | 30 Nov 2015 |
| 355 | clashofclanshackgems.net | Namesilo, LLC | 28 Feb 2016 | 28 Feb 2016 | 28 Feb 2017 |
| 356 | clashofclansstrategytips.com | Name.com, Inc. | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 357 | clashofclansressourcengenerator.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 358 | clashofclansraidngstrats.com | register.com, Inc. | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 359 | clashofclansguide.net | - | 30 Apr 2016 | 30 Apr 2016 | 30 Apr 2017 |
| 360 | clashofclanshelp.net | CloudNineDomains, LLC | 22 Feb 2016 | 23 Feb 2017 | 22 Feb 2018 |
| 361 | clashofclanswindowsphone.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Oct 2017 | 27 Oct 2017 | 27 Oct 2018 |
| 362 | clashofclanssimulator.com | GoDaddy.com, LLC | 5 Dec 2014 | 5 Dec 2014 | 5 Dec 2015 |
| 363 | clashofclansfanclub.com | GMO Internet Inc. | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 364 | clashofclans-gamehack.com | eNom, Inc. | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 365 | clashofclansid.com | Tucows Domains Inc. | 7 Jun 2018 | 23 May 2025 | 7 Jun 2026 |
| 366 | clashofclanshack2015.net | Namesilo, LLC | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 367 | clashofclansgemsfr.com | GoDaddy.com, LLC | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 368 | clashofclans-wikii.com | CV. Jogjacamp | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 369 | clashofclanstriche.com | House of Domains, LLC | 4 May 2016 | 4 May 2017 | 4 May 2018 |
| 370 | clashofclansastuce.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Mar 2016 | 17 Mar 2017 | 30 Mar 2018 |
| 371 | clashofclansempire.com | GoDaddy.com, LLC | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 372 | clashofclansfc.com | GoDaddy.com, LLC | 2 May 2016 | 2 May 2016 | 2 May 2017 |
| 373 | clashofclansworld.net | Cronon AG | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 374 | clashofclanswiki.org | GoDaddy.com, LLC | 19 Jul 2017 | 19 Jul 2017 | 19 Jul 2018 |
| 375 | clashofclansgifts.com | NameCheap, Inc. | 7 Feb 2025 | 7 Feb 2025 | 7 Feb 2026 |
| 376 | clashofclanspro.net | GoDaddy.com, LLC | 17 Jan 2017 | 17 Jan 2017 | 17 Jan 2018 |
| 377 | clashofclansgenerator.com | PSI-USA, Inc. dba Domain Robot | 12 Dec 2013 | 1 Feb 2025 | 12 Dec 2025 |
| 378 | clashofclansbuilders.net | BigRock Solutions Ltd. | 15 Apr 2018 | 15 Apr 2018 | 15 Apr 2019 |
| 379 | clashofclans-gemmes.net | GMO Internet Inc. | 1 Apr 2016 | 1 Apr 2016 | 1 Apr 2017 |
| 380 | clashofclans-cheat.net | - | 11 Oct 2016 | 11 Oct 2016 | 11 Oct 2017 |
| 381 | clashofclansgemscheats.com | GoDaddy.com, LLC | 7 Jan 2022 | 7 Jan 2022 | 7 Jan 2023 |
| 382 | clashofclanstools.org | GoDaddy.com, LLC | 16 May 2016 | 7 Sep 2017 | 16 May 2018 |
| 383 | clashofclansgems4u.com | Key-Systems GmbH | 8 Jul 2021 | 8 Jul 2022 | 8 Jul 2023 |
| 384 | clashofclansgemmesilimite.com | eNom, Inc. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 385 | clashofclansforpcc.net | GMO Internet Inc. | 12 Mar 2016 | 12 Mar 2016 | 12 Mar 2017 |
| 386 | clashofclansastuces.org | eNom, Inc. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 387 | clashofclanspcz.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 388 | clashofclanspcv.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 389 | clashofclansonpcland.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 390 | clashofclansforpcs.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 391 | clashofclansforpccoc.net | BigRock Solutions Ltd. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 392 | clashofclansuz.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Dec 2014 | 29 Nov 2015 | 22 Dec 2017 |
| 393 | clashofclans-parapc.com | eNom, Inc. | 23 Dec 2014 | 23 Dec 2014 | 23 Dec 2015 |
| 394 | clashofclans2014.net | 1&1 Internet AG | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 395 | clashofclans-gemmesgratuites.com | GoDaddy.com, LLC | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 396 | clashofclanstas.com | TLD Registrar Solutions Ltd. | 23 Mar 2015 | 24 Mar 2015 | 23 Mar 2016 |
| 397 | clashofclansarabia.com | Namesilo, LLC | 10 Jul 2017 | 11 Jul 2017 | 10 Jul 2018 |
| 398 | clashofclansbuddy.com | eNom, Inc. | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2015 |
| 399 | clashofclansvn.com | GateKeeperDomains.net LLC | 17 Mar 2020 | 18 Mar 2020 | 17 Mar 2021 |
| 400 | clashofclanshacks4u.com | AB NameISP | 17 Jan 2020 | 17 Jan 2020 | 17 Jan 2021 |
| 401 | clashofclansfrance.com | 1&1 Internet AG | 5 Mar 2025 | 5 Mar 2025 | 5 Mar 2026 |
| 402 | clashofclanscheaters.com | GoDaddy.com, LLC | 7 Dec 2022 | 18 Feb 2024 | 7 Dec 2023 |
| 403 | clashofclans-indonesia.com | eNom, Inc. | 21 Jan 2017 | 16 Jan 2018 | 21 Jan 2018 |
| 404 | clashofclansserver.com | DropCatch.com 659 LLC | 20 Mar 2023 | 20 Apr 2024 | 20 Mar 2024 |
| 405 | clashofclanshack-nosurvey.com | Name.com, Inc. | 1 Jan 2015 | 1 Jan 2017 | 1 Jan 2018 |
| 406 | clashofclanserver.com | GoDaddy.com, LLC | 31 Dec 2014 | 21 May 2025 | 31 Dec 2025 |
| 407 | clashofclans-server.com | eNom, Inc. | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 408 | clashofclansserver.net | Eranet International Limited | 18 Sep 2023 | 19 Sep 2024 | 18 Sep 2024 |
| 409 | clashofclansfr.com | Namesilo, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 410 | clashofclans-on.net | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 411 | clashofclansrewards.net | eNom, Inc. | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2016 |
| 412 | clashofclansforpc.info | eNom, Inc. | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2016 |
| 413 | clashofclanstoll.com | Key-Systems GmbH | 22 Jan 2014 | 17 Feb 2025 | 22 Jan 2026 |
| 414 | clashofclansgemz.net | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 415 | clashofclanseu.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 416 | clashofclanscaller.com | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 417 | clashofclansresourcetool.website | NameCheap, Inc. | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 418 | clashofclanshackonline.ovh | OVH sas | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 419 | clashofclanscheats.science | Alpnames Limited | 27 Feb 2015 | - | 26 Feb 2016 |
| 420 | clashofclanshelper.club | eNom, Inc. | 24 Feb 2015 | 24 Feb 2015 | 23 Feb 2016 |
| 421 | clashofclanshack.space | NameCheap, Inc. | 24 Jun 2025 | 24 Jun 2025 | 24 Jun 2026 |
| 422 | clashofclanswallpaper.science | Alpnames Limited | 16 Mar 2015 | 16 Mar 2015 | 15 Mar 2016 |
| 423 | clashofclansgems.science | Alpnames Limited | 18 Mar 2015 | - | 17 Mar 2016 |
| 424 | clashofclansgenerateur.science | Alpnames Limited | 25 Mar 2015 | 25 Mar 2015 | 24 Mar 2016 |
| 425 | clashofclansunlimited.science | Alpnames Limited | 24 Mar 2015 | - | 23 Mar 2016 |
| 426 | clashofclanshacks.science | Alpnames Limited | 28 Mar 2015 | 28 Mar 2015 | 27 Mar 2016 |
| 427 | clashofclanshack2015.science | Alpnames Limited | 2 Apr 2015 | - | 1 Apr 2016 |
| 428 | clashofclans-guide.science | Alpnames Limited | 3 Apr 2015 | - | 2 Apr 2016 |
| 429 | clashofclanswikihacks.science | Alpnames Limited | 30 Mar 2015 | - | 29 Mar 2016 |
| 430 | clashofclansmodhack.science | Alpnames Limited | 30 Mar 2015 | - | 29 Mar 2016 |
| 431 | clashofclanshacktutorial.science | Alpnames Limited | 30 Mar 2015 | - | 29 Mar 2016 |
| 432 | clashofclansfreegems.science | Alpnames Limited | 30 Mar 2015 | 30 Mar 2015 | 29 Mar 2016 |
| 433 | clashofclansvideo.xyz | FBS Inc. | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2016 |
| 434 | clashofclanstutorial.com | Namesilo, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 435 | clashofclansthunderbolt.com | Dynadot, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 436 | clashofclansgoldhack.com | Namesilo, LLC | 13 Aug 2015 | 14 Aug 2015 | 13 Aug 2016 |
| 437 | clashofclansgameplay.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2018 |
| 438 | clashofclanscheattool.com | Namesilo, LLC | 13 Aug 2015 | 13 Aug 2017 | 13 Aug 2017 |
| 439 | clashofclans-gaming-hacks.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 440 | clashofclanshack.ninja | eNom, Inc. | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 441 | clashofclansturkey.net | GMO Internet Inc. | 25 Mar 2017 | 26 May 2017 | 25 Mar 2018 |
| 442 | clashofclansgift.com | eNom, Inc. | 5 Jan 2015 | 10 Jan 2025 | 5 Jan 2026 |
| 443 | clashofclansastucehack.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 444 | clashofclanshackbuilder.com | eNom, Inc. | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 445 | clashofclanstipspro.com | Name.com, Inc. | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 446 | clashofclans-helper.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 447 | clashofclanstips.info | 1&1 Internet AG | 14 Aug 2015 | - | 14 Aug 2016 |
| 448 | clashofclansstrateji.com | GoDaddy.com, LLC | 14 Aug 2015 | 15 Aug 2015 | 14 Aug 2016 |
| 449 | clashofclansnoserveynopassword.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 450 | clashofclanshackz.info | NameCheap, Inc. | 18 Dec 2019 | 16 Feb 2020 | 18 Dec 2020 |
| 451 | clashofclansfreegemsgiveaway.com | HiChina Zhicheng Technology Limited | 16 Jul 2018 | 16 Jul 2018 | 16 Jul 2019 |
| 452 | clashofclansforpcp.com | Magnate Domains, LLC | 30 Mar 2016 | 6 Oct 2016 | 30 Mar 2017 |
| 453 | clashofclanstraining.com | GoDaddy.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 454 | clashofclanshackpirater.com | NetArt Registrar Sp. z o.o. | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 455 | clashofclansgemmesfr.com | eNom, Inc. | 14 Sep 2016 | 27 Oct 2017 | 14 Sep 2017 |
| 456 | clashofclanspros.com | GoDaddy.com, LLC | 3 May 2017 | 3 May 2017 | 3 May 2018 |
| 457 | clashofclansplus.com | Namesilo, LLC | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 458 | clashofclansninja.com | eNom, Inc. | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 459 | clashofclansonline.org | Namesilo, LLC | 15 Aug 2015 | 6 Apr 2017 | 15 Aug 2018 |
| 460 | clashofclanshackcheats.biz | GoDaddy.com, LLC | 15 Aug 2015 | 15 Aug 2015 | 14 Aug 2016 |
| 461 | clashofclanshack4gems.com | GoDaddy.com, LLC | 26 Aug 2019 | 26 Aug 2019 | 26 Aug 2020 |
| 462 | clashofclanshack-free.com | eNom, Inc. | 15 Aug 2015 | 15 Aug 2015 | 15 Aug 2016 |
| 463 | clashofclanstipstricks.com | GoDaddy.com, LLC | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 464 | clashofclansgemmes.info | TLD Registrar Solutions Ltd. | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 465 | clashofclansbuilder.info | Belmontdomains.com LLC | 31 Jul 2018 | 31 Jul 2018 | 31 Jul 2019 |
| 466 | clashofclans-info.net | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 467 | clashofclanshack.webcam | Alpnames Limited | 21 May 2015 | - | 20 May 2016 |
| 468 | clashofclanscheat.science | Alpnames Limited | 18 May 2015 | - | 17 May 2016 |
| 469 | clashofclanshacktool.casa | Minds + Machines Registrar Limited | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 470 | clashofclanshackpc.casa | Minds + Machines Registrar Limited | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 471 | clashofclanshackonline.casa | Uniregistrar Corp | 2 Jun 2015 | 17 Sep 2016 | 2 Jun 2017 |
| 472 | clashofclanshackiphone.casa | Minds + Machines Registrar Limited | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 473 | clashofclanshackipad.casa | Minds + Machines Registrar Limited | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 474 | clashofclanshackandroid.casa | Minds + Machines Registrar Limited | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 475 | clashofclanshack2015.casa | Minds + Machines Registrar Limited | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 476 | clashofclanshackonline.work | Uniregistrar Corp | 1 Jun 2015 | 27 Oct 2016 | 1 Jun 2017 |
| 477 | clashofclanshacknosurvey.work | Minds + Machines Registrar Limited | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2016 |
| 478 | clashofclanshackiphone.work | Minds + Machines Registrar Limited | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2016 |
| 479 | clashofclanshackipad.work | Minds + Machines Registrar Limited | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2016 |
| 480 | clashofclanshack2015.work | Minds + Machines Registrar Limited | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2016 |
| 481 | clashofclansfreeunlimitedgemshack.work | Minds + Machines Registrar Limited | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2016 |
| 482 | clashofclanstips.work | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 483 | clashofclanstips.casa | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 484 | clashofclansstrategy.work | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 485 | clashofclansstrategy.casa | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 486 | clashofclansonline.work | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 487 | clashofclansonline.casa | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 488 | clashofclanshacktool.work | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 489 | clashofclanshack.work | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 490 | clashofclanshack.casa | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 491 | clashofclansfreegems.work | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 492 | clashofclansfreegems.casa | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 493 | clashofclansforpc.work | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 494 | clashofclansforpc.casa | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 495 | clashofclansdownload.work | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 496 | clashofclansdownload.casa | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 497 | clashofclanscheat.work | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 498 | clashofclanscheat.casa | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 499 | clashofclansandroid.work | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 500 | clashofclansandroid.casa | Minds + Machines Registrar Limited | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 501 | clashofclansgems.casa | Minds + Machines Registrar Limited | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 502 | clashofclans-hack.casa | Minds + Machines Registrar Limited | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 503 | clashofclanshacksgems.work | Minds + Machines Registrar Limited | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 504 | clashofclansgems.work | Minds + Machines Registrar Limited | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 505 | clashofclansgameplay.work | Minds + Machines Registrar Limited | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 506 | clashofclansbesthack.work | Minds + Machines Registrar Limited | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 507 | clashofclans-hack.work | Minds + Machines Registrar Limited | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 508 | clashofclans-freegems.work | Minds + Machines Registrar Limited | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 509 | clashofclanstoday.work | Minds + Machines Registrar Limited | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 510 | clashofclansgen.work | Minds + Machines Registrar Limited | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 511 | clashofclansapk.work | Minds + Machines Registrar Limited | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 512 | clashofclanshacks.work | Minds + Machines Registrar Limited | 10 Jun 2015 | 10 Jun 2015 | 10 Jun 2016 |
| 513 | clashofclanshacks.casa | Minds + Machines Registrar Limited | 10 Jun 2015 | 10 Jun 2015 | 10 Jun 2016 |
| 514 | clashofclanscheats.work | Minds + Machines Registrar Limited | 10 Jun 2015 | 10 Jun 2015 | 10 Jun 2016 |
| 515 | clashofclanscheats.casa | Minds + Machines Registrar Limited | 10 Jun 2015 | 10 Jun 2015 | 10 Jun 2016 |
| 516 | clashofclanscheats.party | Alpnames Limited | 13 Jun 2015 | - | 12 Jun 2016 |
| 517 | clashofclanshack.party | NameCheap, Inc. | 29 Jun 2017 | 4 Jul 2017 | 29 Jun 2018 |
| 518 | clashofclanscheat.party | Alpnames Limited | 17 Jun 2015 | - | 16 Jun 2016 |
| 519 | clashofclanshack.link | NameCheap, Inc. | 15 Jun 2015 | 15 Jun 2015 | 15 Jun 2016 |
| 520 | clashofclans-giftbonus.one | One.com A/S | 23 Jun 2015 | 23 Jun 2017 | 23 Jun 2017 |
| 521 | clashofclansastuce.link | NameCheap, Inc. | 28 Jun 2015 | 28 Jun 2015 | 28 Jun 2016 |
| 522 | clashofclanshacks.link | NameCheap, Inc. | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2016 |
| 523 | clashofclansgems.party | Alpnames Limited | 2 Jul 2015 | 3 Jul 2015 | 1 Jul 2016 |
| 524 | clashofclanstools.party | Alpnames Limited | 6 Jul 2015 | - | 5 Jul 2016 |
| 525 | clashofclanstool.party | Alpnames Limited | 6 Jul 2015 | - | 5 Jul 2016 |
| 526 | clashofclanshackunlimitedgems.party | Alpnames Limited | 6 Jul 2015 | - | 5 Jul 2016 |
| 527 | clashofclansgames.party | Alpnames Limited | 6 Jul 2015 | - | 5 Jul 2016 |
| 528 | clashofclansforpc.party | Alpnames Limited | 6 Jul 2015 | - | 5 Jul 2016 |
| 529 | clashofclanscoc.party | Alpnames Limited | 6 Jul 2015 | - | 5 Jul 2016 |
| 530 | clashofclans2.science | Alpnames Limited | 6 Jul 2015 | 6 Jul 2015 | 5 Jul 2016 |
| 531 | clashofclansonlinetips.com | GoDaddy.com, LLC | 16 Aug 2015 | 16 Aug 2015 | 16 Aug 2016 |
| 532 | clashofclanscheats.link | NameCheap, Inc. | 15 Jul 2015 | 15 Jul 2017 | 15 Jul 2018 |
| 533 | clashofclans-event.club | TLD Registrar Solutions Ltd. | 20 Jul 2015 | 22 Jul 2015 | 19 Jul 2016 |
| 534 | clashofclans-generator.xyz | eNom, Inc. | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 535 | clashofclans-event.xyz | NameCheap, Inc. | 7 Mar 2016 | 30 Mar 2016 | 7 Mar 2017 |
| 536 | clashofclanshack.tools | TLD Registrar Solutions Ltd. | 10 Aug 2015 | 10 Aug 2015 | 10 Aug 2016 |
| 537 | clashofclanstip.com | GoDaddy.com, LLC | 18 Jan 2015 | 18 Jan 2015 | 18 Jan 2016 |
| 538 | clashofclansonlinehacks.com | GoDaddy.com, LLC | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 539 | clashofclansvideo.com | eNom, Inc. | 18 Jan 2015 | 23 Dec 2016 | 18 Jan 2018 |
| 540 | clashofclanshacktool2015.com | Backstop Names LLC | 7 Apr 2016 | 6 Oct 2016 | 7 Apr 2017 |
| 541 | clashofclansgems.us | NameCheap, Inc. | 9 Jul 2016 | 9 Jul 2016 | 8 Jul 2017 |
| 542 | clashofclans-triche.net | Tucows Domains Inc. | 17 Jan 2015 | 21 Jan 2016 | 17 Jan 2017 |
| 543 | clashofclanss.net | eNom, Inc. | 14 Aug 2016 | 16 Jul 2017 | 14 Aug 2018 |
| 544 | clashofclansgembox.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 28 Jan 2023 | 6 Mar 2024 | 28 Jan 2024 |
| 545 | clashofclansebook.com | Domain.com, LLC | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 546 | clashofclanstrichegenerator.com | eNom, Inc. | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 547 | clashofclanshackcheats2015.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 548 | clashofclanscheatspro.net | GoDaddy.com, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 549 | clashofclanstrainer.com | eNom, Inc. | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 550 | clashofclansfreegemss.com | eNom, Inc. | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 551 | clashofclansprizes.com | Wild West Domains, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 552 | clashofclansgen.com | Painted Pony Names, LLC | 11 Apr 2016 | 11 Apr 2016 | 11 Apr 2017 |
| 553 | clashofclanshackers.com | Epik Inc. | 18 Dec 2018 | 18 Dec 2018 | 18 Dec 2019 |
| 554 | clashofclans-info.com | eNom, Inc. | 23 Jan 2017 | 9 Jan 2018 | 23 Jan 2018 |
| 555 | clashofclans-gen.com | Key-Systems GmbH | 8 Jul 2021 | 8 Jul 2021 | 8 Jul 2022 |
| 556 | clashofclansgiveaway.org | GoDaddy.com, LLC | 13 Jun 2016 | 7 Sep 2017 | 13 Jun 2018 |
| 557 | clashofclansgratis.com | Iconicnames LLC | 31 Mar 2017 | 1 Apr 2017 | 31 Mar 2018 |
| 558 | clashofclansastucegemmes.com | GoDaddy.com, LLC | 26 Jan 2015 | 26 Jan 2015 | 26 Jan 2016 |
| 559 | clashofclanswebguide.net | eNom, Inc. | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2016 |
| 560 | clashofclanswebguide.com | eNom, Inc. | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2016 |
| 561 | clashofclansbeststrategy.com | FastDomain Inc. | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 562 | clashofclanselixir.com | 1&1 Internet AG | 28 Jan 2015 | 29 Jan 2015 | 28 Jan 2016 |
| 563 | clashofclansguia.com | GoDaddy.com, LLC | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2016 |
| 564 | clashofclanscheats4u.com | OVH sas | 25 Apr 2017 | 25 Apr 2017 | 25 Apr 2018 |
| 565 | clashofclansapp.org | eNom, Inc. | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2016 |
| 566 | clashofclanshackcheatsfreegems.party | Alpnames Limited | 7 May 2015 | - | 6 May 2016 |
| 567 | clashofclanscheat2015.party | Alpnames Limited | 7 May 2015 | 7 May 2015 | 6 May 2016 |
| 568 | clashofclans2015.party | Alpnames Limited | 7 May 2015 | - | 6 May 2016 |
| 569 | clashofclans-hack.party | Alpnames Limited | 7 May 2015 | - | 6 May 2016 |
| 570 | clashofclansfreegemz.com | eNom, Inc. | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 571 | clashofclansfreegems.info | GoDaddy.com, LLC | 30 Jun 2016 | 12 Jul 2017 | 30 Jun 2018 |
| 572 | clashofclansforum.net | GoDaddy.com, LLC | 3 Jul 2016 | 3 Jul 2016 | 3 Jul 2017 |
| 573 | clashofclansitalia.com | Tucows Domains Inc. | 11 Apr 2019 | 12 Apr 2019 | 11 Apr 2020 |
| 574 | clashofclanshelpandtips.com | eNom, Inc. | 1 Feb 2015 | 3 Jan 2017 | 1 Feb 2018 |
| 575 | clashofclanscode.com | GoDaddy.com, LLC | 22 Apr 2016 | 22 Apr 2016 | 22 Apr 2017 |
| 576 | clashofclansreward.com | Namesilo, LLC | 24 Oct 2016 | 26 Nov 2017 | 24 Oct 2017 |
| 577 | clashofclansturkiye.org | Cronon AG | 20 Apr 2016 | 21 Apr 2017 | 20 Apr 2018 |
| 578 | clashofclanshacktool.org | GoDaddy.com, LLC | 31 Jan 2015 | 20 Mar 2017 | 31 Jan 2018 |
| 579 | clashofclans-onlinehack.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 580 | clashofclansgames.net | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 581 | clashofclanshackstrategy.com | eNom, Inc. | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 582 | clashofclansgemstool.org | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 583 | clashofclans-2015.com | GoDaddy.com, LLC | 28 Jun 2016 | 28 Jun 2016 | 28 Jun 2017 |
| 584 | clashofclanshackdeutsch.net | - | 7 May 2016 | 7 May 2016 | 7 May 2017 |
| 585 | clashofclansgemas.net | Wild West Domains, LLC | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 586 | clashofclansmovie.net | eNom, Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 587 | clashofclansitalia.org | eNom, Inc. | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 588 | clashofclansupdate.com | GoDaddy.com, LLC | 1 May 2016 | 1 May 2016 | 1 May 2017 |
| 589 | clashofclanshack.juegos | eNom, Inc. | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 590 | clashofclansbuzz.com | Tucows Domains Inc. | 20 Aug 2015 | 24 Aug 2018 | 20 Aug 2018 |
| 591 | clashofclansbr.net | Universo Online S/A (UOL) | 20 Aug 2015 | 21 Aug 2015 | 20 Aug 2016 |
| 592 | clashofclansitaly.com | GoDaddy.com, LLC | 8 Feb 2015 | 8 Feb 2015 | 8 Feb 2016 |
| 593 | clashofclans-hacking.com | eNom, Inc. | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2016 |
| 594 | clashofclans-builder.com | Hetzner Online AG | 9 Feb 2015 | 8 Feb 2017 | 9 Feb 2018 |
| 595 | clashofclansjuwelenhack.info | GoDaddy.com, LLC | 8 Feb 2015 | - | 8 Feb 2016 |
| 596 | clashofclansfrance.org | Network Solutions, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 597 | clashofclansturkce.com | FBS Inc. | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 598 | clashofclansjuwelengenerator.com | TLD Registrar Solutions Ltd. | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 599 | clashofclanstrucchi.net | eNom, Inc. | 12 Feb 2015 | 7 Feb 2017 | 12 Feb 2018 |
| 600 | clashofclansonlinegenerateur.com | eNom, Inc. | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 601 | clashofclans1150.com | GoDaddy.com, LLC | 14 Feb 2015 | 14 Feb 2015 | 14 Feb 2016 |
| 602 | clashofclans-gembox.com | GoDaddy.com, LLC | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 603 | clashofclanstrick.org | eNom, Inc. | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 604 | clashofclanstv.com | Dynadot, LLC | 16 Feb 2015 | 20 Mar 2025 | 16 Feb 2026 |
| 605 | clashofclansgenerateur.com | GMO Internet Inc. | 26 Apr 2019 | 9 Jul 2024 | 26 Apr 2024 |
| 606 | clashofclans4hack.com | PSI-USA, Inc. dba Domain Robot | 15 Feb 2015 | 6 Apr 2017 | 15 Feb 2018 |
| 607 | clashofclansio.com | GoDaddy.com, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 608 | clashofclans-event.org | eNom, Inc. | 2 Oct 2016 | 13 Nov 2017 | 2 Oct 2018 |
| 609 | clashofclans-event.net | eNom, Inc. | 7 Sep 2017 | 6 Sep 2017 | 7 Sep 2018 |
| 610 | clashofclanshacktoolfree.com | GoDaddy.com, LLC | 16 Feb 2015 | 16 Feb 2015 | 16 Feb 2016 |
| 611 | clashofclanssgems.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 612 | clashofclans4pc.com | eNom, Inc. | 30 Jul 2014 | 18 Feb 2015 | 30 Jul 2016 |
| 613 | clashofclanslayout.net | GMO Internet Inc. | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 614 | clashofclansonlinegems.com | eNom, Inc. | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 615 | clashofclansedu.com | eNom, Inc. | 20 Feb 2015 | 20 Feb 2015 | 20 Feb 2016 |
| 616 | clashofclanstricks.org | GoDaddy.com, LLC | 15 Jul 2017 | 15 Jul 2017 | 15 Jul 2018 |
| 617 | clashofclanshileleri.com | - | 14 Jul 2016 | 14 Jul 2016 | 14 Jul 2017 |
| 618 | clashofclanscp.com | GoDaddy.com, LLC | 21 Feb 2015 | 22 Feb 2015 | 21 Feb 2016 |
| 619 | clashofclansoffer.com | TLD Registrar Solutions Ltd. | 21 Feb 2015 | 1 Mar 2015 | 21 Feb 2016 |
| 620 | clashofclanshacktoolss.com | eName Technology Co., Ltd. | 25 Apr 2019 | 25 Apr 2019 | 25 Apr 2020 |
| 621 | clashofclanss-event.com | OpenTLD B.V. | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 622 | clashofclansh.com | Crazy Domains FZ-LLC | 21 Aug 2016 | 1 Sep 2017 | 21 Aug 2017 |
| 623 | clashofclansbuulder.com | GoDaddy.com, LLC | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 624 | clashofclansbuidler.com | GoDaddy.com, LLC | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 625 | clashofclansresources.com | NameCheap, Inc. | 28 Jan 2017 | 28 Jan 2017 | 28 Jan 2018 |
| 626 | clashofclansdownload.info | NameCheap, Inc. | 17 May 2017 | 16 Jul 2017 | 17 May 2018 |
| 627 | clashofclanshackeronline.com | eNom, Inc. | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 628 | clashofclans-rus.com | DNSPod, Inc. | 6 Sep 2018 | - | 6 Sep 2019 |
| 629 | clashofclansforpcz.com | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 630 | clashofclansbr.com | Rebel.com Corp. | 26 Feb 2015 | 7 Jan 2018 | 26 Feb 2019 |
| 631 | clashofclansonline.net | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 632 | clashofclansvn.org | GoDaddy.com, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 633 | clashofclanstriche.net | Internet Domain Services BS Corp | 19 Oct 2020 | 20 Oct 2024 | 19 Oct 2025 |
| 634 | clashofclanscheatsnow.net | eNom, Inc. | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 635 | clashofclansapk.org | - | 27 Jul 2024 | 27 Apr 2025 | 27 Jul 2025 |
| 636 | clashofclansportal.com | OnlineNIC, Inc. | 1 Mar 2015 | 1 Mar 2015 | 1 Mar 2016 |
| 637 | clashofclanshackz.net | - | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 638 | clashofclanshile.org | eNom, Inc. | 23 Aug 2015 | 23 Aug 2015 | 23 Aug 2016 |
| 639 | clashofclanshile.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 11 Nov 2021 | 11 Nov 2021 | 11 Nov 2022 |
| 640 | clashofclansapp24.com | eNom, Inc. | 11 Nov 2016 | 10 Nov 2016 | 11 Nov 2017 |
| 641 | clashofclansgemsz.com | eNom, Inc. | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 642 | clashofclans-generateur.com | GoDaddy.com, LLC | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 643 | clashofclanss.org | Tucows Domains Inc. | 2 Mar 2015 | 6 Mar 2016 | 2 Mar 2017 |
| 644 | clashofclansindonesia.com | EnomV, Inc. | 10 Aug 2017 | 11 Aug 2017 | 10 Aug 2018 |
| 645 | clashofclanshackz.org | GMO Internet Inc. | 19 May 2016 | 19 Mar 2017 | 19 May 2018 |
| 646 | clashofclansresources.net | eNom, Inc. | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 647 | clashofclansfrance.net | eNom, Inc. | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 648 | clashofclanstrichers.com | Xiamen ChinaSource Internet Service Co., Ltd. | 18 Aug 2020 | 18 Aug 2020 | 18 Aug 2021 |
| 649 | clashofclansshelper.com | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 650 | clashofclansscheat.net | BigRock Solutions Ltd. | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 651 | clashofclanshack.us | UdomainName.com LLC | 12 May 2017 | 13 May 2017 | 11 May 2018 |
| 652 | clashofclansgratuit.net | eNom, Inc. | 3 Mar 2015 | 3 Mar 2015 | 3 Mar 2016 |
| 653 | clashofclansgemtool.com | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 654 | clashofclansfun.com | GoDaddy.com, LLC | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 655 | clashofclansfrans.com | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 656 | clashofclansbuildrr.com | - | - | - | - |
| 657 | clashofclans-gemmerfr.com | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 658 | clashofclans-dica.com | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 659 | clashofclanstr.org | CommuniGal Communication Ltd. | 20 May 2016 | 9 Mar 2017 | 20 May 2017 |
| 660 | clashofclanssh.com | GoDaddy.com, LLC | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 661 | clashofclansworld.com | NameCheap, Inc. | 9 Sep 2019 | - | 9 Sep 2020 |
| 662 | clashofclansmovie.com | DropCatch.com 611 LLC | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 663 | clashofclanskindle.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 664 | clashofclansgemme.com | eNom, Inc. | 6 Mar 2015 | 7 Mar 2015 | 6 Mar 2016 |
| 665 | clashofclans-walkthrough.com | eNom, Inc. | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 666 | clashofclanswarplanner.com | DreamHost, LLC | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 667 | clashofclansstrategyguides.org | NameCheap, Inc. | 3 Sep 2019 | 9 Aug 2024 | 3 Sep 2025 |
| 668 | clashofclansmodhackapk.com | NameCheap, Inc. | 17 Oct 2019 | - | 17 Oct 2020 |
| 669 | clashofclansbloodynight.com | - | - | - | - |
| 670 | clashofclansnl.com | eNom, Inc. | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 671 | clashofclansgenerate.com | eNom, Inc. | 12 Jul 2016 | 23 Aug 2017 | 12 Jul 2017 |
| 672 | clashofclansmatome.info | GMO Internet Inc. | 10 Mar 2015 | 5 Sep 2015 | 10 Mar 2016 |
| 673 | clashofclanstoool.com | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 674 | clashofclanstool2015.com | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 675 | clashofclansmods.com | Name.com, Inc. | 23 Sep 2024 | 10 Mar 2025 | 23 Sep 2025 |
| 676 | clashofclanshackonline-cheats.com | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 677 | clashofclansforkindle.com | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 678 | clashofclansauto.com | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 679 | clashofclansakafinar.com | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 680 | clashofclans-gemmefr.com | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 681 | clashofclans-gemmasfr.com | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 682 | clashofclans-gammesfr.com | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 683 | clashofclanspirater.com | Tucows Domains Inc. | 30 Jun 2019 | 30 Jun 2019 | 30 Jun 2020 |
| 684 | clashofclansguidhq.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2016 |
| 685 | clashofclansdefensestrategy.org | eNom, Inc. | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 686 | clashofclans-cheats.org | eNom, Inc. | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2016 |
| 687 | clashofclanspcfree.com | TLD Registrar Solutions Ltd. | 14 Mar 2015 | 14 Mar 2015 | 14 Mar 2016 |
| 688 | clashofclansbulius.com | GoDaddy.com, LLC | 14 Nov 2018 | 14 Nov 2018 | 14 Nov 2019 |
| 689 | clashofclansapp.com | Tucows Domains Inc. | 30 Jun 2018 | 4 Jul 2019 | 30 Jun 2019 |
| 690 | clashofclansser.com | GoDaddy.com, LLC | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 691 | clashofclansthemovie.com | GoDaddy.com, LLC | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2016 |
| 692 | clashofclansthefilm.com | GoDaddy.com, LLC | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2016 |
| 693 | clashofclansfilm.com | GoDaddy.com, LLC | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2016 |
| 694 | clashofclansbots.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2016 |
| 695 | clashofclanshackapp.net | - | - | - | - |
| 696 | clashofclanshacktools.com | Key-Systems GmbH | 16 Mar 2015 | 21 Apr 2017 | 16 Mar 2018 |
| 697 | clashofclanshacktoolonline.com | GMO Internet Inc. | 2 Nov 2017 | 2 Nov 2017 | 2 Nov 2018 |
| 698 | clashofclanshackit.com | GoDaddy.com, LLC | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 699 | clashofclansfreegems2015.com | Namesilo, LLC | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 700 | clashofclansforpccc.com | GoDaddy.com, LLC | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 701 | clashofclansnolimit.com | TLD Registrar Solutions Ltd. | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 702 | clashofclansfreegemses.com | GoDaddy.com, LLC | 17 Mar 2015 | 18 Mar 2015 | 17 Mar 2016 |
| 703 | clashofclansloot.com | GoDaddy.com, LLC | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 704 | clashofclanshacktoll2015.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 705 | clashofclansvideo.net | GoDaddy.com, LLC | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 706 | clashofclansthemovie.net | GoDaddy.com, LLC | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2016 |
| 707 | clashofclansthefilm.net | GoDaddy.com, LLC | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2016 |
| 708 | clashofclansfilm.net | GoDaddy.com, LLC | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2016 |
| 709 | clashofclansstrats.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 710 | clashofclanshhgems.com | GoDaddy.com, LLC | 19 Mar 2015 | 19 Mar 2015 | 19 Mar 2016 |
| 711 | clashofclansaccountforsale.com | GoDaddy.com, LLC | 19 Mar 2015 | 19 Mar 2015 | 19 Mar 2016 |
| 712 | clashofclanstrucchi.org | GoDaddy.com, LLC | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 713 | clashofclansgemchest.com | GoDaddy.com, LLC | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 714 | clashofclansfreeresources.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 21 Mar 2015 | 21 Mar 2015 | 21 Mar 2016 |
| 715 | clashofclans-tr.com | GMO Internet Inc. | 23 Oct 2022 | 3 Jan 2024 | 23 Oct 2023 |
| 716 | clashofclansupgrades.com | FastDomain Inc. | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 717 | clashofclansvideos.net | Nhan Hoa Software Company Ltd | 19 Mar 2015 | 6 Mar 2017 | 19 Mar 2018 |
| 718 | clashofclansbot.net | OldTownDomains.com LLC | 5 Jun 2016 | 5 Oct 2016 | 5 Jun 2017 |
| 719 | clashofclansinfo.com | Name.com, Inc. | 23 Mar 2015 | 23 Mar 2015 | 23 Mar 2016 |
| 720 | clashofclansfashion.com | Network Solutions, LLC | 24 Mar 2015 | 29 Mar 2017 | 24 Mar 2018 |
| 721 | clashofclansrecuit.com | GoDaddy.com, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 722 | clashofclansofficial.com | NameCheap, Inc. | 7 Dec 2018 | 7 Dec 2018 | 7 Dec 2019 |
| 723 | clashofclansjuwelen.com | Namesilo, LLC | 23 Aug 2017 | 24 Aug 2017 | 23 Aug 2018 |
| 724 | clashofclanshackgenerator.com | GoDaddy.com, LLC | 9 Jun 2016 | 9 Jun 2016 | 9 Jun 2017 |
| 725 | clashofclanshackfreecodescheats.com | GoDaddy.com, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 726 | clashofclansgemscheat.com | - | 14 Jun 2016 | 14 Jun 2016 | 14 Jun 2017 |
| 727 | clashofclans-gemmedfr.com | GoDaddy.com, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 728 | clashofclansprivateservercreator.com | Tucows Domains Inc. | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2020 |
| 729 | clashofclanscalculator.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 22 Mar 2015 | - | 22 Mar 2016 |
| 730 | clashofclanstools7.com | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 731 | clashofclansglitch.com | Dynadot, LLC | 8 Jun 2021 | 18 Jul 2023 | 8 Jun 2023 |
| 732 | clashofclansforkindlefire.com | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 733 | clashofclansdream.com | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 734 | clashofclansassistant.com | Name.com, Inc. | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 735 | clashofclanshackxz.com | Hebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.… | 1 Apr 2015 | 1 Apr 2015 | 1 Apr 2016 |
| 736 | clashofclanssecrets.net | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 737 | clashofclanstrucosguia.com | - | - | - | - |
| 738 | clashofclanshack10.com | OnlineNIC, Inc. | 1 Apr 2015 | 1 Apr 2015 | 1 Apr 2016 |
| 739 | clashofclansfuite.com | eNom, Inc. | 1 Apr 2015 | 1 Apr 2015 | 1 Apr 2016 |
| 740 | clashofclansfan.com | IHS Telekom, Inc. | 1 Apr 2015 | 1 Jun 2015 | 1 Apr 2018 |
| 741 | clashofclansbet.com | eNom, Inc. | 1 Apr 2015 | 1 Apr 2015 | 1 Apr 2016 |
| 742 | clashofclanshileyesiltas.com | eNom, Inc. | 30 Nov 2016 | 3 Dec 2017 | 30 Nov 2017 |
| 743 | clashofclanshackerz.net | 1&1 Internet AG | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2016 |
| 744 | clashofclansnolimt.com | GoDaddy.com, LLC | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 745 | clashofclansnolimits.com | GoDaddy.com, LLC | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 746 | clashofclansnolimited.com | GoDaddy.com, LLC | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 747 | clashofclansilimite.com | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 748 | clashofclanshackunlimitedgem.com | GoDaddy.com, LLC | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 749 | clashofclanshack-mobilehacks4u.com | GoDaddy.com, LLC | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 750 | clashofclansgemhacks.com | NameCheap, Inc. | 10 May 2020 | 21 Jun 2025 | 10 May 2025 |
| 751 | clashofclansgemcheats.com | GoDaddy.com, LLC | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 752 | clashofclansfreegemsandcoins.com | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 753 | clashofclansfranc.com | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 754 | clashofclans-gemesfr.com | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 755 | clashofclans-gamesfr.com | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 756 | clashofclanstrucchigratis.com | GoDaddy.com, LLC | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2016 |
| 757 | clashofclansnosurveynopassword.com | GoDaddy.com, LLC | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2016 |
| 758 | clashofclanslimit.com | GoDaddy.com, LLC | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2016 |
| 759 | clashofclansgenerator.info | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 760 | clashofclanspromotion.us | NameCheap, Inc. | 9 Apr 2017 | 9 Apr 2017 | 8 Apr 2018 |
| 761 | clashofclanshack2015.info | Crazy Domains FZ-LLC | 1 Apr 2015 | 1 Apr 2015 | 1 Apr 2016 |
| 762 | clashofclansfan.net | IHS Telekom, Inc. | 1 Apr 2015 | 1 Apr 2015 | 1 Apr 2016 |
| 763 | clashofclanstreasure.com | GoDaddy.com, LLC | 5 Apr 2015 | 5 Apr 2015 | 5 Apr 2016 |
| 764 | clashofclanspremium.com | eNom, Inc. | 4 Apr 2015 | 4 Apr 2015 | 4 Apr 2016 |
| 765 | clashofclansgiftsonline.com | eNom, Inc. | 4 Apr 2015 | 4 Apr 2015 | 4 Apr 2016 |
| 766 | clashofclans-gift.com | Key-Systems GmbH | 4 Apr 2015 | 4 Apr 2015 | 4 Apr 2016 |
| 767 | clashofclansresources.info | Crazy Domains FZ-LLC | 5 Apr 2015 | 5 Apr 2015 | 5 Apr 2016 |
| 768 | clashofclanstrick.net | Tucows Domains Inc. | 29 Mar 2015 | 2 Apr 2017 | 29 Mar 2017 |
| 769 | clashofclanstools.us | eNom, Inc. | 29 Mar 2015 | 29 Mar 2015 | 28 Mar 2016 |
| 770 | clashofclansgifted.com | PSI-USA, Inc. dba Domain Robot | 6 Apr 2015 | 26 May 2017 | 6 Apr 2018 |
| 771 | clashofclansgemgeneratoractivationcode.com | DomainContext, Inc. | 7 Apr 2015 | 6 Apr 2017 | 7 Apr 2018 |
| 772 | clashofclansdatabase.com | GoDaddy.com, LLC | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 773 | clashofclanscca.com | Namesilo, LLC | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 774 | clashofclansbasereviews.com | GoDaddy.com, LLC | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2017 |
| 775 | clashofclanstricks.net | eNom, Inc. | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2016 |
| 776 | clashofclansiq.com | register.com, Inc. | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2016 |
| 777 | clashofclanstoys.com | GoDaddy.com, LLC | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 778 | clashofclansonline.biz | Namesilo, LLC | 31 Aug 2015 | 4 Sep 2024 | 30 Aug 2025 |
| 779 | clashofclansmerchandise.com | GoDaddy.com, LLC | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 780 | clashofclanscaster.com | GoDaddy.com, LLC | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 781 | clashofclansaccessories.com | GoDaddy.com, LLC | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 782 | clashofclanswallpaper.com | Domain.com, LLC | 29 Aug 2015 | 27 Aug 2016 | 29 Aug 2017 |
| 783 | clashofclanscoach.com | eNom, Inc. | 2 Sep 2015 | 3 Sep 2015 | 2 Sep 2016 |
| 784 | clashofclans-turkiye.com | FBS Inc. | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2016 |
| 785 | clashofclanstipps.com | DropCatch.com 1133 LLC | 19 Jun 2018 | 19 Jun 2018 | 19 Jun 2019 |
| 786 | clashofclansresourcesgenerator.com | Tucows Domains Inc. | 30 Jun 2019 | 4 Jul 2021 | 30 Jun 2021 |
| 787 | clashofclans4u.com | NameCheap, Inc. | 25 Oct 2017 | 25 Oct 2017 | 25 Oct 2018 |
| 788 | clashofclansgemsonline.info | NameCheap, Inc. | 20 Nov 2016 | 20 Nov 2017 | 20 Nov 2018 |
| 789 | clashofclansonlimit.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Apr 2015 | 11 Apr 2015 | 11 Apr 2016 |
| 790 | clashofclansolimit.com | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 791 | clashofclanskackz.com | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 792 | clashofclanshackdegemas.com | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 793 | clashofclansgemschest.com | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 794 | clashofclansdesertfire.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 795 | clashofclansmad.com | eNom, Inc. | 11 Apr 2015 | 11 Apr 2015 | 11 Apr 2016 |
| 796 | clashofclansforpcworld.com | BigRock Solutions Ltd. | 11 Apr 2015 | 11 Apr 2015 | 11 Apr 2016 |
| 797 | clashofclanstools.net | - | - | - | - |
| 798 | clashofclanson.net | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 799 | clashofclansnosurveynopassword.net | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 800 | clashofclanshacksnosurveynopassword.net | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 801 | clashofclansgems.info | NameCheap, Inc. | 11 Nov 2016 | 20 Jan 2017 | 11 Nov 2017 |
| 802 | clashofclanscobras.us | GoDaddy.com, LLC | 11 Apr 2015 | 11 Apr 2015 | 10 Apr 2016 |
| 803 | clashofclansvn.net | GoDaddy.com, LLC | 4 Sep 2015 | 4 Sep 2015 | 4 Sep 2016 |
| 804 | clashofclanstuff.com | eNom, Inc. | 4 Sep 2015 | 4 Sep 2015 | 4 Sep 2016 |
| 805 | clashofclansoffcial-supercell.com | Melbourne IT, Ltd | 4 Sep 2015 | 5 Sep 2015 | 4 Sep 2016 |
| 806 | clashofclanshacksupercell.com | Melbourne IT, Ltd | 4 Sep 2015 | 4 Sep 2015 | 4 Sep 2016 |
| 807 | clashofclansuniverse.com | FastDomain Inc. | 15 Apr 2015 | 15 Apr 2015 | 15 Apr 2016 |
| 808 | clashofclanshacktool-2015.com | eName Technology Co., Ltd. | 26 Apr 2019 | 26 Apr 2019 | 26 Apr 2020 |
| 809 | clashofclanscreditcardscams.com | register.com, Inc. | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2016 |
| 810 | clashofclanstr.biz | Realtime Register B.V. | 5 Sep 2015 | - | 4 Sep 2016 |
| 811 | clashofclanspro.com | Dynadot, LLC | 15 Mar 2024 | 24 Apr 2025 | 15 Mar 2025 |
| 812 | clashofclansool.com | GoDaddy.com, LLC | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2016 |
| 813 | clashofclansman.com | Namesilo, LLC | 6 Jul 2017 | 6 Jul 2017 | 6 Jul 2018 |
| 814 | clashofclansgemhacknosurvey.com | Namesilo, LLC | 18 Apr 2015 | 29 Oct 2017 | 18 Apr 2018 |
| 815 | clashofclansfrench.com | eNom, Inc. | 18 Apr 2015 | 18 Apr 2015 | 18 Apr 2016 |
| 816 | clashofclanstricheurs.com | Tucows Domains Inc. | 30 Sep 2018 | 30 Sep 2018 | 30 Sep 2019 |
| 817 | clashofclansgems.biz | GoDaddy.com, LLC | 26 Nov 2018 | 26 Nov 2018 | 26 Nov 2019 |
| 818 | clashofclanstrichegems.com | GoDaddy.com, LLC | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 819 | clashofclanshackerz.com | - | - | - | - |
| 820 | clashofclansastucess.com | eNom, Inc. | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 821 | clashofclans-offical.com | Gandi SAS | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 822 | clashofclans-new.org | PSI-USA, Inc. dba Domain Robot | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 823 | clashofclans-gifted.com | Domain.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 824 | clashofclanshackcheats.info | Dynadot, LLC | 28 Apr 2022 | 8 Jul 2023 | 28 Apr 2023 |
| 825 | clashofclansgemhack.info | Namesilo, LLC | 18 Apr 2015 | 18 Apr 2017 | 18 Apr 2018 |
| 826 | clashofclansjuwelen.org | Dynadot, LLC | 5 Jul 2017 | 5 Jul 2017 | 5 Jul 2018 |
| 827 | clashofclanshacks.info | Limited Liability Company "Registrar of domain nam… | 4 Oct 2018 | 4 Oct 2018 | 4 Oct 2019 |
| 828 | clashofclansxgenerator.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 829 | clashofclanshackonlinecheats.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 830 | clashofclanshack-cheats.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 831 | clashofclansgemcheast.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 832 | clashofclanschest.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 833 | clashofclansgenerator.us | - | 27 Sep 2016 | 27 Sep 2016 | 26 Sep 2017 |
| 834 | clashofclanshacktool.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Apr 2015 | 23 Apr 2015 | 22 Apr 2016 |
| 835 | clashofclans2015hilehack.com | FBS Inc. | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2016 |
| 836 | clashofclans-treasure.com | GoDaddy.com, LLC | 21 Apr 2015 | 3 May 2017 | 21 Apr 2018 |
| 837 | clashofclans-gen.net | eNom, Inc. | 7 Oct 2016 | 19 Nov 2017 | 7 Oct 2017 |
| 838 | clashofclans-completeguide.com | GoDaddy.com, LLC | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 839 | clashofclansgemsgenerator.org | GoDaddy.com, LLC | 21 Feb 2017 | 23 Apr 2017 | 21 Feb 2018 |
| 840 | clashofclanswebapp.com | Name.com, Inc. | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 841 | clashofclansusa.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 842 | clashofclanstwo.com | GoDaddy.com, LLC | 25 Apr 2015 | 25 Apr 2015 | 25 Apr 2016 |
| 843 | clashofclansmania.com | GoDaddy.com, LLC | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 844 | clashofclansinformacion.com | GoDaddy.com, LLC | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 845 | clashofclansgemmeilimite.com | GoDaddy.com, LLC | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 846 | clashofclansedelstenen.com | eNom, Inc. | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 847 | clashofclans-cheatz.com | Tucows Domains Inc. | 21 Apr 2014 | 25 Apr 2015 | 21 Apr 2016 |
| 848 | clashofclansgemsgratuit.com | GoDaddy.com, LLC | 26 Apr 2015 | 26 Apr 2015 | 26 Apr 2016 |
| 849 | clashofclansastuce-fr.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Jan 2016 | 16 Jan 2016 | 16 Jan 2017 |
| 850 | clashofclans101.com | GoDaddy.com, LLC | 26 Apr 2015 | 26 Apr 2015 | 26 Apr 2016 |
| 851 | clashofclanssavaslari.com | FBS Inc. | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2016 |
| 852 | clashofclanschestgems.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2016 |
| 853 | clashofclansadvice.com | GoDaddy.com, LLC | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2016 |
| 854 | clashofclansgemsbox.com | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2018 | 26 Sep 2018 | 26 Sep 2019 |
| 855 | clashofclanshacker.net | Crazy Domains FZ-LLC | 12 Oct 2016 | 23 Oct 2018 | 12 Oct 2018 |
| 856 | clashofclanswiki.info | Tucows Domains Inc. | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2017 |
| 857 | clashofclansgems.org | Wild West Domains, LLC | 8 Sep 2015 | 18 Sep 2016 | 8 Sep 2017 |
| 858 | clashofclansgenerators.com | GoDaddy.com, LLC | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2016 |
| 859 | clashofclans-on.com | GoDaddy.com, LLC | 24 Jun 2019 | 24 Jun 2019 | 24 Jun 2020 |
| 860 | clashofclansmap.com | GoDaddy.com, LLC | 1 May 2015 | 1 May 2015 | 1 May 2016 |
| 861 | clashofclansillimite.com | eNom, Inc. | 1 May 2015 | 1 May 2015 | 1 May 2016 |
| 862 | clashofclansonlineguide.com | GoDaddy.com, LLC | 2 May 2015 | 2 May 2015 | 2 May 2016 |
| 863 | clashofclanscr.com | GoDaddy.com, LLC | 2 May 2015 | 2 May 2015 | 2 May 2016 |
| 864 | clashofclans-planet.com | eNom, Inc. | 2 May 2015 | 2 May 2015 | 2 May 2016 |
| 865 | clashofclans-hack.org | eNom, Inc. | 2 May 2015 | 16 Jul 2017 | 2 May 2018 |
| 866 | clashofclanstaktikleri.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 May 2015 | 14 Jun 2017 | 3 May 2017 |
| 867 | clashofclansgemsfree.com | eNom, Inc. | 31 Oct 2017 | 31 Oct 2017 | 31 Oct 2018 |
| 868 | clashofclanspriv9.com | Tucows Domains Inc. | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 869 | clashofclansbulgaria.com | GoDaddy.com, LLC | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 870 | clashofclanstoolz.biz | eNom, Inc. | 4 May 2015 | 4 May 2015 | 3 May 2016 |
| 871 | clashofclansressources.com | GoDaddy.com, LLC | 20 Apr 2017 | 20 Apr 2017 | 20 Apr 2018 |
| 872 | clashofclansbuillder.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 873 | clashofclansbuildee.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 874 | clashofclans-windowsphone.com | OnlineNIC, Inc. | 26 Feb 2021 | 26 Feb 2021 | 26 Feb 2022 |
| 875 | clashofclansonlinecheats.com | Namesilo, LLC | 5 May 2015 | 5 May 2015 | 5 May 2016 |
| 876 | clashofclansleveling.com | Webfusion Ltd. | 5 May 2015 | 5 May 2015 | 5 May 2016 |
| 877 | clashofclansforpchome.com | BigRock Solutions Ltd. | 5 May 2015 | 5 May 2015 | 5 May 2016 |
| 878 | clashofclansgenerator.org | eNom, Inc. | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 879 | clashofclansgemmespromo.com | eNom, Inc. | 6 May 2015 | 7 May 2015 | 6 May 2016 |
| 880 | clashofclansme.com | GoDaddy.com, LLC | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 881 | clashofclanskoyduzenleri.com | FBS Inc. | 7 May 2015 | 17 Jun 2017 | 7 May 2017 |
| 882 | clashofclanshacksfree.com | - | 15 Aug 2016 | 15 Aug 2016 | 15 Aug 2017 |
| 883 | clashofclansfreeegems.com | - | - | - | - |
| 884 | clashofclanshacksandcheats.com | Namesilo, LLC | 27 Jul 2017 | 27 Jul 2017 | 27 Jul 2018 |
| 885 | clashofclansfreecoins.com | GoDaddy.com, LLC | 24 May 2017 | 24 May 2017 | 24 May 2018 |
| 886 | clashofclanstrichegemmesillimite.org | GoDaddy.com, LLC | 10 Sep 2015 | 10 Sep 2015 | 10 Sep 2016 |
| 887 | clashofclansraidhacks.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Sep 2015 | 10 Sep 2015 | 10 Sep 2016 |
| 888 | clashofclansgiftedfreebies.com | - | 10 Sep 2015 | 10 Sep 2015 | 10 Sep 2017 |
| 889 | clashofclanspromogems.com | Namesilo, LLC | 9 May 2015 | 9 May 2015 | 9 May 2016 |
| 890 | clashofclanshackgroup.com | Name.com, Inc. | 10 May 2015 | 10 May 2015 | 10 May 2016 |
| 891 | clashofclansgenerator.biz | GoDaddy.com, LLC | 26 Nov 2018 | 26 Nov 2018 | 26 Nov 2019 |
| 892 | clashofclansturkey.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 May 2015 | 11 May 2015 | 11 May 2016 |
| 893 | clashofclansfreenow.com | TLD Registrar Solutions Ltd. | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 894 | clashofclansforandroid.com | NameKing.com Inc. | 13 May 2015 | 18 Jun 2017 | 13 May 2017 |
| 895 | clashofclans-tricks.com | eNom, Inc. | 13 May 2015 | 25 Jun 2017 | 13 May 2017 |
| 896 | clashofclansreviews.com | GoDaddy.com, LLC | 14 May 2015 | 14 May 2015 | 14 May 2017 |
| 897 | clashofclansnow.com | GoDaddy.com, LLC | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 898 | clashofclanshck.com | GoDaddy.com, LLC | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 899 | clashofclansakagenerator.com | GoDaddy.com, LLC | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 900 | clashofclans-it.com | eNom, Inc. | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 901 | clashofclans-fr.com | eNom, Inc. | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 902 | clashofclans-de.com | eNom, Inc. | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 903 | clashofclanshackgemsfree.com | eNom, Inc. | 14 Sep 2016 | 26 Oct 2017 | 14 Sep 2017 |
| 904 | clashofclansgens.com | Name.com, Inc. | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 905 | clashofclansgamersunite.biz | eNom, Inc. | 16 May 2015 | 16 May 2015 | 15 May 2016 |
| 906 | clashofclanscheatios.biz | eNom, Inc. | 16 May 2015 | 16 May 2015 | 15 May 2016 |
| 907 | clashofclanscheatandroid.biz | eNom, Inc. | 16 May 2015 | 16 May 2015 | 15 May 2016 |
| 908 | clashofclans-prizes.com | GoDaddy.com, LLC | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 909 | clashofclansverified.com | GoDaddy.com, LLC | 17 May 2015 | 17 May 2015 | 17 May 2016 |
| 910 | clashofclansgamegifts.com | eNom, Inc. | 17 May 2015 | 29 Jun 2017 | 17 May 2017 |
| 911 | clashofclansfreegemsnodownload.com | eNom, Inc. | 17 Jul 2016 | 16 Jul 2016 | 17 Jul 2018 |
| 912 | clashofclansboost.com | ZNet Technologies Pvt Ltd. | 13 Sep 2015 | 13 Sep 2015 | 13 Sep 2016 |
| 913 | clashofclans-gemme.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 May 2015 | 18 May 2015 | 18 May 2016 |
| 914 | clashofclansultimateguide.com | GoDaddy.com, LLC | 19 May 2015 | 19 May 2015 | 19 May 2016 |
| 915 | clashofclansgemss.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 19 May 2015 | 19 May 2015 | 19 May 2016 |
| 916 | clashofclanshack.info | NameCheap, Inc. | 30 Oct 2019 | 30 Dec 2019 | 30 Oct 2020 |
| 917 | clashofclanswebs.com | GoDaddy.com, LLC | 21 May 2015 | 21 May 2025 | 21 May 2026 |
| 918 | clashofclansupdates.com | DropCatch.com 1053 LLC | 28 Dec 2019 | 28 Dec 2019 | 28 Dec 2020 |
| 919 | clashofclanshack4free.com | GMO Internet Inc. | 21 Mar 2017 | 21 Mar 2017 | 21 Mar 2018 |
| 920 | clashofclanscadeau.com | eNom, Inc. | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 921 | clashofclans-hack-cheats.com | Tucows Domains Inc. | 30 Dec 2018 | 30 Dec 2018 | 30 Dec 2019 |
| 922 | clashofclans-bot.com | Tucows Domains Inc. | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2017 |
| 923 | clashofclanstoo.com | Tucows Domains Inc. | 30 Sep 2016 | 4 Oct 2017 | 30 Sep 2017 |
| 924 | clashofclansgidehq.com | GoDaddy.com, LLC | 21 May 2015 | 21 May 2015 | 21 May 2016 |
| 925 | clashofclansnolimite.com | GoDaddy.com, LLC | 22 May 2015 | 22 May 2015 | 22 May 2016 |
| 926 | clashofclanscoc.com | GoDaddy.com, LLC | 14 Apr 2023 | 14 Apr 2023 | 14 Apr 2024 |
| 927 | clashofclansphilippines.org | GoDaddy.com, LLC | 22 May 2015 | 23 May 2015 | 22 May 2016 |
| 928 | clashofclansgemstore.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 25 May 2015 | 25 May 2015 | 25 May 2016 |
| 929 | clashofclansgemsonline.com | 1&1 Internet AG | 24 May 2015 | 25 May 2016 | 24 May 2018 |
| 930 | clashofclansfastgems.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 May 2015 | 24 May 2015 | 24 May 2016 |
| 931 | clashofclansgemgenerator.net | eNom, Inc. | 23 May 2015 | 23 May 2015 | 23 May 2016 |
| 932 | clashofclansvip.com | GoDaddy.com, LLC | 25 May 2015 | 25 May 2015 | 25 May 2016 |
| 933 | clashofclansturkey.com | GoDaddy.com, LLC | 10 Jan 2017 | 10 Jan 2017 | 10 Jan 2018 |
| 934 | clashofclansplayers.biz | eNom, Inc. | 25 May 2015 | 25 May 2015 | 24 May 2016 |
| 935 | clashofclanshacker2015.com | GoDaddy.com, LLC | 26 May 2015 | 26 May 2015 | 26 May 2016 |
| 936 | clashofclanshacker.org | eNom, Inc. | 27 Dec 2016 | 28 Dec 2017 | 27 Dec 2018 |
| 937 | clashofclansstools.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 938 | clashofclansnolomit.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 939 | clashofclansforcaster.com | Media Elite Holdings Limited | 11 Oct 2022 | 12 Oct 2023 | 11 Oct 2023 |
| 940 | clashofclans-gem.com | GoDaddy.com, LLC | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 941 | clashofclanscheats.org | eNom, Inc. | 25 May 2015 | 7 Jul 2017 | 25 May 2018 |
| 942 | clashofclansunited.com | GoDaddy.com, LLC | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 943 | clashofclanseasyhacks.com | 1&1 Internet AG | 27 May 2015 | 28 May 2015 | 27 May 2016 |
| 944 | clashofclans-tips.com | Soluciones Corporativas IP, SLU | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 945 | clashofclans-secrets.com | 1&1 Internet AG | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 946 | clashofclansgenerator.online | NameCheap, Inc. | 22 Aug 2017 | 22 Aug 2017 | 22 Aug 2018 |
| 947 | clashofclansc.com | GoDaddy.com, LLC | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 948 | clashofclans-france.net | eNom, Inc. | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 949 | clashofclansgiftsnow.com | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 950 | clashofclansgemmeillimite.com | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 951 | clashofclansgemglitch.com | eNom, Inc. | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 952 | clashofclansforecater.com | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 953 | clashofclansforecast.com | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 954 | clashofclans-tresure.com | - | - | - | - |
| 955 | clashofclans-cheat.com | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 956 | clashofclansunlimitedgem.com | - | 18 Aug 2016 | 18 Aug 2016 | 18 Aug 2017 |
| 957 | clashofclansgemshack24.com | eNom, Inc. | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 958 | clashofclansclan.com | easyDNS Technologies, Inc. | 30 May 2015 | 3 Jun 2017 | 30 May 2017 |
| 959 | clashofclans-gemmesgratuit.com | Namesilo, LLC | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 960 | clashofclansresourcesgems.com | Tucows Domains Inc. | 31 May 2015 | 31 May 2015 | 31 May 2017 |
| 961 | clashofclansfreegemsz.com | GoDaddy.com, LLC | 31 May 2015 | 31 May 2015 | 31 May 2016 |
| 962 | clashofclans-awad.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 31 May 2015 | 31 May 2015 | 31 May 2016 |
| 963 | clashofclanshackgem.com | GoDaddy.com, LLC | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2016 |
| 964 | clashofclansdiary.com | DreamHost, LLC | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2016 |
| 965 | clashofclansblog.com | GoDaddy.com, LLC | 10 Mar 2017 | 10 Mar 2017 | 10 Mar 2018 |
| 966 | clashofclansastucedefense.com | PocketDomain.com Inc. | 16 Mar 2020 | 18 Mar 2020 | 16 Mar 2021 |
| 967 | clashofclanshackscheats.com | GMO Internet Inc. | 3 Jun 2015 | 14 Jul 2017 | 2 Jun 2017 |
| 968 | clashofclans-gemmesillimite.com | Namesilo, LLC | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 969 | clashofclansgemchests.com | GoDaddy.com, LLC | 20 Jul 2020 | 20 Jul 2020 | 20 Jul 2021 |
| 970 | clashofclanssp.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 971 | clashofclansq.com | GoDaddy.com, LLC | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 972 | clashofclanshackmasters.com | eNom, Inc. | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 973 | clashofclanshacklot.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 974 | clashofclansgemsgeneratornosurvey.com | NameKing.com Inc. | 4 Jun 2015 | 10 Jul 2017 | 4 Jun 2017 |
| 975 | clashofclansgemes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 976 | clashofclansbuildr.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 977 | clashofclansgemsgifts.com | eNom, Inc. | 5 Jun 2015 | 7 May 2017 | 5 Jun 2018 |
| 978 | clashofclansforpcmi.com | BigRock Solutions Ltd. | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 979 | clashofclanshackmobile.com | GoDaddy.com, LLC | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 980 | clashofclansguide.online | GoDaddy.com, LLC | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 981 | clashofclans-gemmsfr.com | GoDaddy.com, LLC | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 982 | clashofclans-events.net | Launchpad, Inc. | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 983 | clashofclanshacknosurvaynopassword.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 984 | clashofclansonlinegenerator.com | NameCheap, Inc. | 23 Aug 2019 | - | 23 Aug 2020 |
| 985 | clashofclansgemz.com | GoDaddy.com, LLC | 6 Jun 2015 | 7 Jun 2015 | 6 Jun 2016 |
| 986 | clashofclansandroid.com | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 987 | clashofclansgenarator.com | - | - | - | - |
| 988 | clashofclanshacktoolsget.com | TLD Registrar Solutions Ltd. | 9 Jun 2015 | 9 Jun 2015 | 9 Jun 2016 |
| 989 | clashofclans-xmod.org | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 990 | clashofclansv.com | GoDaddy.com, LLC | 17 Sep 2015 | 17 Sep 2015 | 17 Sep 2016 |
| 991 | clashofclanshackpro.com | eName Technology Co., Ltd. | 25 Apr 2019 | 25 Apr 2019 | 25 Apr 2020 |
| 992 | clashofclansbase.com | CloudFlare, Inc. | 8 Apr 2025 | 14 Apr 2025 | 8 Apr 2026 |
| 993 | clashofclanspromogemmes.com | eNom, Inc. | 11 Jun 2015 | 11 Jun 2015 | 11 Jun 2016 |
| 994 | clashofclanshackwiki.com | eNom, Inc. | 11 Jun 2015 | 11 Jun 2015 | 11 Jun 2017 |
| 995 | clashofclansresource.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 996 | clashofclanslobby.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 997 | clashofclansforum.com | eNom, Inc. | 6 Apr 2017 | 10 Apr 2025 | 6 Apr 2026 |
| 998 | clashofclanshacknosurveys.com | GoDaddy.com, LLC | 13 Jun 2015 | 14 Jun 2015 | 13 Jun 2016 |
| 999 | clashofclansfreetips.com | 1&1 Internet AG | 18 Sep 2015 | 19 Sep 2015 | 18 Sep 2016 |
| 1000 | clashofclans-gemmersfr.com | GoDaddy.com, LLC | 18 Sep 2015 | 18 Sep 2015 | 18 Sep 2016 |
Displaying 1,000 out of 2,625 domains starting with the keyword "CLASHOFCLANS". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=clashofclans
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |