Our database now contains whois records of 658 Million (658,883,551) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1595 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [658 Million Domains] $10,000 Details

Keyword: CHIMNEY

Reverse Whois » KEYWORD [chimney ]  { 16,087 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1chimney.co.jp-28 Jun 199910 Sep 2025-
2chimney.expertNameCheap, Inc.21 Dec 20223 Mar 202421 Dec 2023
3chimney.systems-3 Jul 20143 Jul 20143 Jul 2015
4chimney.tokyoGMO Internet Inc.22 Jul 201422 Jul 201422 Jul 2015
5chimney.votingRegistryGate GmbH18 Aug 201418 Aug 201418 Aug 2015
6chimney.xyzWest263 International Limited4 Nov 201718 Aug 20254 Nov 2027
7chimney.campNetwork Solutions, LLC18 Sep 201418 Sep 201418 Sep 2015
8chimney.christmasNameCheap, Inc.19 Dec 202411 Apr 202519 Dec 2025
9chimney.nycPorkbun, LLC11 Sep 202420 Oct 202511 Sep 2026
10chimney.oooPDR Ltd. d/b/a PublicDomainRegistry.com7 Nov 20147 Nov 20147 Nov 2015
11chimney.kitchenPDR Ltd. d/b/a PublicDomainRegistry.com16 Nov 201416 Nov 202516 Nov 2026
12chimney.clubGoDaddy.com, LLC29 Dec 201921 Oct 202529 Dec 2025
13chimney.servicesGoogle, Inc.12 Jan 20193 Jun 202512 Jan 2026
14chimney.directoryMesh Digital Limited3 Dec 20146 Jan 20173 Dec 2017
15chimney.networkNameCheap, Inc.26 May 202026 May 202026 May 2021
16chimney.discountGoDaddy.com, LLC28 Jan 201514 Mar 201728 Jan 2018
17chimney.businessNameCheap, Inc.15 Jan 202416 Dec 2024-
18chimney.helpPorkbun, LLC8 Sep 202523 Oct 20258 Sep 2026
19chimney.greenGo China Domains, LLC24 Mar 201524 Mar 201524 Mar 2017
20chimney.topDynadot, LLC11 Jun 202411 Jun 202511 Jun 2026
21chimney.tipsGoDaddy.com, LLC14 Jul 201514 Jul 202014 Jul 2021
22chimney.workAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Dec 201716 Oct 20256 Dec 2027
23chimney.coffeeGoogle, Inc.29 Jun 20173 Jun 202529 Jun 2026
24chimney.newsGoDaddy.com, LLC30 Sep 201510 Jan 201730 Sep 2018
25chimney.miamiGoDaddy.com, LLC15 Oct 201515 Oct 201515 Oct 2016
26chimney.filmName.com, Inc.23 Oct 20155 Dec 202423 Oct 2024
27chimney.comGoDaddy.com, LLC3 Jun 19979 Sep 20222 Jun 2029
28chimney.rocksGoDaddy.com, LLC24 Nov 201516 May 201724 Nov 2017
29chimney.websiteGoogle, Inc.20 Nov 20196 Nov 202520 Nov 2026
30chimney.university-22 Aug 2024-22 Aug 2025
31chimney.onlineXin Net Technology Corporation17 Apr 202022 Apr 202517 Apr 2026
32chimney.cricketOnlineNIC, Inc.16 Mar 2016-15 Mar 2017
33chimney.cloudGandi SAS8 Nov 20199 Oct 20258 Nov 2026
34chimney.linkName.com, Inc.28 Sep 201828 Sep 202428 Sep 2025
35chimney.techSquarespace Domains LLC18 Nov 202022 Nov 202518 Nov 2026
36chimney.hostingReserved for non-billable transactions where Regis…25 Jul 2024-25 Jul 2025
37chimney.institutePDR Ltd. d/b/a PublicDomainRegistry.com20 May 201630 Jun 202020 May 2020
38chimney.academyPDR Ltd. d/b/a PublicDomainRegistry.com20 May 201630 Jun 202020 May 2020
39chimney.careersPDR Ltd. d/b/a PublicDomainRegistry.com20 May 201620 May 201620 May 2017
40chimney.trainingAscio Technologies, Inc. Danmark - Filial af Ascio…18 Jun 202518 Jun 202518 Jun 2026
41chimney.consultingDynadot, LLC2 Jul 201611 Aug 20242 Jul 2024
42chimney.contractorsGoDaddy.com, LLC4 Mar 201418 Apr 20204 Mar 2021
43chimney.solarGoDaddy.com, LLC9 Apr 201421 Apr 20209 Apr 2021
44chimney.houseGoDaddy.com, LLC9 Apr 201424 May 20259 Apr 2026
45chimney.clickGMO Internet Inc.3 Apr 2019-3 Apr 2020
46chimney.solutionsNameKing.com Inc.25 Jul 202523 Sep 202525 Jul 2026
47chimney.toolseNom, Inc.25 Jun 20147 Aug 202425 Jun 2024
48chimney.supplieseNom, Inc.25 Jun 20147 Aug 202425 Jun 2024
49chimney.supplyeNom, Inc.25 Jun 201426 Jun 201625 Jun 2017
50chimney.cleaning-22 Jun 202222 Jun 202222 Jun 2023
51chimney.parts-11 Sep 2024-11 Sep 2025
52chimney.bizTucows Domains Inc.5 Oct 200123 Oct 20256 Nov 2026
53chimney.groupDNSPod, Inc.14 Oct 2024-14 Oct 2026
54chimney.vipSoluciones Corporativas IP, SLU22 Sep 201622 Sep 201622 Sep 2017
55chimney.infoNameCheap, Inc.23 Oct 20249 Jun 2025-
56chimney.mobiNameCheap, Inc.27 Feb 202027 Apr 202027 Feb 2021
57chimney.netregister.com, Inc.26 Sep 200027 Aug 202526 Sep 2026
58chimney.orgDynadot, LLC18 Aug 200516 Oct 202518 Aug 2027
59chimney.usNamesilo, LLC24 Apr 200212 Mar 202523 Apr 2026
60chimney.plNamware.com, Inc.16 Jan 202529 Oct 202516 Jan 2026
61chimney.softwareGoDaddy.com, LLC4 Apr 202219 May 20254 Apr 2026
62chimney.repairGoogle, Inc.12 May 202311 Jul 202412 May 2024
63chimney.inkAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…17 Sep 201720 Oct 202517 Sep 2027
64chimney.companyNameCheap, Inc.15 Jan 20241 Jul 2024-
65chimney.guruNameKing.com Inc.18 Oct 202422 Nov 202518 Oct 2025
66chimney.siteAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Dec 201731 Aug 20236 Dec 2027
67chimney.emailTucows Domains Inc.10 Jun 202330 Apr 202510 Jun 2026
68chimney.co.uk-4 Apr 20023 Sep 20244 Apr 2027
69chimney.uk-29 Oct 20173 Sep 202429 Oct 2026
70chimney.guideGoogle, Inc.26 Jan 20183 Jun 202526 Jan 2026
71chimney.plusDNC Holdings, Inc.2 Feb 201819 Mar 20252 Feb 2026
72chimney.agencyNameCheap, Inc.4 Mar 201818 Apr 20204 Mar 2021
73chimney.watchName.com, Inc.9 Mar 20185 May 20189 Mar 2019
74chimney.menNameCheap, Inc.30 Jun 2018-30 Jun 2019
75chimney.digitalPDR Ltd. d/b/a PublicDomainRegistry.com4 Oct 201818 Nov 20194 Oct 2020
76chimney.showName.com, Inc.18 Oct 201818 Oct 202418 Oct 2025
77chimney.doctorGoDaddy.com, LLC25 Feb 201711 Apr 202525 Feb 2026
78chimney.devGlobal Domains International, Inc. DBA DomainCostC…5 Mar 20199 Oct 20255 Mar 2026
79chimney.org.uk-28 Jan 201830 Apr 201928 Jan 2020
80chimney.technologyGandi SAS8 Aug 2019--
81chimney.financePorkbun, LLC14 Feb 202214 Feb 202214 Feb 2023
82chimney.townGoogle, Inc.29 Nov 201919 Nov 202529 Nov 2026
83chimney.worksGoDaddy.com, LLC23 Feb 20209 Apr 202523 Feb 2026
84chimney.lifeDNSPod, Inc.7 Nov 2024-7 Nov 2026
85chimney.co1&1 Internet AG20 Sep 201322 Aug 202419 Sep 2025
86chimney.cheapName.com, Inc.5 Jun 20205 Jun 20205 Jun 2021
87chimney.designDynadot, LLC6 Apr 20246 Apr 20256 Apr 2025
88chimney.proGoDaddy.com, LLC4 Aug 200819 Jul 20248 Sep 2026
89chimney.spacePDR Ltd. d/b/a PublicDomainRegistry.com7 Jun 201730 Jun 20207 Jun 2021
90chimney.realtyEpik Inc.17 Oct 202017 Oct 202017 Oct 2021
91chimney.engineeringGoDaddy.com, LLC20 Oct 202020 Oct 202020 Oct 2022
92chimney.world-22 Nov 20252 Dec 202522 Nov 2026
93chimney.kr-14 Oct 20141 Oct 201814 Oct 2021
94chimney.fish1&1 Internet AG28 Jan 202214 Mar 202528 Jan 2026
95chimney.fundGoogle, Inc.23 Apr 20223 Jun 202523 Apr 2026
96chimney.ltdGoDaddy.com, LLC13 Jun 202224 Aug 202313 Jun 2023
97chimney.ccBeijing Lanhai Jiye Technology Co., Ltd26 Dec 202415 Oct 202526 Dec 2025
98chimney.todayNICENIC INTERNATIONAL GROUP CO., LIMITED26 Mar 202531 Mar 202526 Mar 2026
99chimney.au--3 Oct 2025-
100chimney.aiNameCheap, Inc.28 Jan 202029 Dec 202328 Jan 2026
101chimney.one-12 Apr 202528 Oct 202512 Apr 2026
102chimney.bestGoDaddy.com, LLC31 Jan 202213 Apr 202531 Jan 2025
103chimney.appName.com, Inc.6 May 20181 Jun 20256 May 2025
104chimney.barNameCheap, Inc.25 Dec 20219 Jan 202325 Dec 2023
105chimney.by-26 Apr 201117 Apr 20256 May 2026
106chimney.cafeGoogle, Inc.23 Mar 20213 Jun 202523 Mar 2026
107chimney.ioCloudFlare, Inc.30 Mar 20185 Mar 202530 Mar 2026
108chimney.llcGoDaddy.com, LLC9 Jul 201814 Jun 20259 Jul 2026
109chimney.earthGoDaddy.com, LLC4 Jan 202014 Oct 20254 Jan 2026
110chimney.homesGoogle, Inc.21 Sep 202221 Nov 202421 Sep 2024
111chimney.inGoDaddy.com, LLC11 May 201431 May 202511 May 2026
112chimney.it-15 Mar 201916 Apr 202531 Mar 2026
113chimney.jp-30 Oct 20191 Nov 202531 Oct 2026
114chimney.liveName.com, Inc.4 May 20184 May 20254 May 2026
115chimney.me1&1 Internet AG1 Aug 202530 Sep 20251 Aug 2026
116chimney.nl-12 Oct 19993 Dec 2024-
117chimney.cfdNameCheap, Inc.25 Apr 20237 Jun 202425 Apr 2024
118chimney.lol-23 Apr 20234 Jun 202423 Apr 2024
119chimney.shopXiamen ChinaSource Internet Service Co., Ltd.13 Sep 202418 Oct 202413 Sep 2025
120chimney.placeNameCheap, Inc.15 May 20236 Jul 2024-
121chimney.contactGoogle, Inc.16 May 202318 Sep 202316 May 2024
122chimney.bostonCloudFlare, Inc.4 Jun 202314 Oct 20254 Jun 2027
123chimney.ninjaeNom, Inc.12 Jul 202317 Jul 202312 Jul 2026
124chimney.telName.com, Inc.18 Aug 202311 Aug 202518 Aug 2026
125chimney.bzGoDaddy.com, LLC24 Apr 20131 Aug 202324 Apr 2028
126chimney.us.comNameCheap, Inc.1 Nov 20251 Nov 20251 Nov 2026
127chimney.constructionGoogle, Inc.3 Nov 202324 Oct 20253 Nov 2026
128chimney.blogHostinger, UAB27 Mar 20246 Mar 202527 Mar 2026
129chimney.funGoDaddy.com, LLC18 Apr 20243 May 202518 Apr 2026
130chimney.studioXiamen ChinaSource Internet Service Co., Ltd.26 Jan 202526 Jan 202526 Jan 2026
131chimney.de--20 Apr 2011-
132chimney.fr-17 Aug 20217 Aug 202517 Aug 2026
133chimney.seGandi SAS26 Jul 199626 Jul 202531 Dec 2026
134chimney.sbsNamesilo, LLC8 Aug 20249 Aug 20258 Aug 2026
135chimney.eu----
136chimney.centerNameCheap, Inc.14 Sep 2024--
137chimney.bondKey-Systems, LLC25 Sep 202426 Nov 202425 Sep 2025
138chimney.co.nzKey-Systems GmbH9 Feb 20257 Oct 2025-
139chimney.icuDNSPod, Inc.19 Jun 202524 Jun 202519 Jun 2026
140chimney.hostHostinger, UAB10 Jul 202515 Jul 202510 Jul 2026
141chimney.at--21 Oct 2002-
142chimney.bioName.com, Inc.17 Jul 202517 Jul 202517 Jul 2026
143chimney.diyGoDaddy.com, LLC7 Sep 202512 Sep 20257 Sep 2026
144chimney.uk.comNameKing.com Inc.28 Sep 20257 Oct 202528 Sep 2026
145chimney.idReserved8 Dec 202230 Nov 20238 Dec 2026
146chimneyrockpark.comNetwork Solutions, LLC1 Nov 19961 Sep 202531 Oct 2026
147chimneyspeak.comMedia Elite Holdings Limited25 May 201027 Jun 202525 May 2026
148chimneysweeponline.comNetwork Solutions, LLC5 Jan 20006 Nov 20245 Jan 2026
149chimneychannel.comNamesilo, LLC21 Nov 202225 Dec 202321 Nov 2023
150chimneycowls.org.uk-26 Feb 201527 Feb 202526 Feb 2027
151chimneysweepacademy.co.uk-22 May 201323 May 202522 May 2026
152chimney-sweeper.comGoDaddy.com, LLC17 Jul 202517 Jul 202517 Jul 2026
153chimneytek.comGoDaddy.com, LLC12 Nov 201027 Feb 202512 Nov 2026
154chimneysealing.comNameCheap, Inc.30 Mar 202411 May 202530 Mar 2025
155chimneyfixers.netCosmotown, Inc.23 Oct 201423 Oct 201423 Oct 2015
156chimney-upstart.mobiGMO Internet Inc.23 Oct 201423 Oct 201423 Oct 2015
157chimneysweepedinburgh.comWebfusion Ltd.5 Oct 201628 Sep 20185 Oct 2019
158chimneyscan.coGoDaddy.com, LLC31 May 20135 Jun 201530 May 2015
159chimneysweepcumbria.orgAscio Technologies, Inc. Danmark - Filial af Ascio…24 Oct 201425 Oct 201624 Oct 2017
160chimneysandmore.comGoDaddy.com, LLC17 Nov 202329 Dec 202417 Nov 2024
161chimneysweephampshire.comGoDaddy.com, LLC3 Jun 20144 Jun 20153 Jun 2016
162chimneycleaningtools.comWild West Domains, LLC15 Aug 201516 Aug 201515 Aug 2016
163chimneysweeptools.comGoDaddy.com, LLC8 Jun 20168 Jun 20168 Jun 2017
164chimneycleaningexpress.com-21 Nov 202521 Nov 202521 Nov 2026
165chimneycleaningcost.comGoDaddy.com, LLC23 May 201424 May 201523 May 2016
166chimneycareinc.comKey-Systems GmbH5 Nov 202213 Nov 20225 Nov 2024
167chimneyssweep.comSquarespace Domains LLC15 Jan 202426 Feb 202515 Jan 2025
168chimneyrockhealthcenter.comGoDaddy.com, LLC6 Mar 200714 Feb 20256 Mar 2026
169chimneyspeedclean.comRegister.it SPA27 Oct 201427 Oct 201627 Oct 2017
170chimneyconnection.comGoDaddy.com, LLC21 Oct 202521 Oct 202521 Oct 2026
171chimneycorp.comeNom, Inc.4 Jan 20126 Feb 20254 Jan 2026
172chimneyexpert.comeNom, Inc.7 Mar 200913 Mar 20257 Mar 2026
173chimneyprofessionals.comeNom, Inc.5 Mar 200913 Mar 20255 Mar 2026
174chimneycleanout.comNameKing.com Inc.18 Mar 20141 May 202418 Mar 2024
175chimneymart.comGoDaddy.com, LLC11 Jul 202421 Jun 202511 Jul 2026
176chimneywraps.comGoDaddy.com, LLC14 Jun 201229 Apr 201514 Jun 2017
177chimneyrepairservice.comIServeYourDomain.com LLC5 Aug 20256 Aug 20255 Aug 2026
178chimneysweephoustontx.comNameCheap, Inc.10 Mar 202525 Mar 202510 Mar 2026
179chimneyridgecourt.comGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
180chimneycleaningandrepairwestmont.comGoDaddy.com, LLC28 Oct 201428 Oct 201428 Oct 2015
181chimneywizards.comGoDaddy.com, LLC15 Oct 202127 Oct 202515 Oct 2026
182chimneysplus.comeNom, Inc.4 Aug 20096 Aug 20254 Aug 2026
183chimneyrepairexpertmilwaukee.comGoDaddy.com, LLC2 Apr 201321 May 20252 Apr 2026
184chimneyrepairportland.comGoDaddy.com, LLC22 May 201623 May 202522 May 2026
185chimneydoktor.comGoDaddy.com, LLC11 Nov 201319 Feb 201511 Nov 2015
186chimneydocs.comGoDaddy.com, LLC13 Dec 202313 Dec 202313 Dec 2026
187chimneydoctor.comGoDaddy.com, LLC4 Jul 20015 Jul 20254 Jul 2027
188chimneysweepcostadelsol.comLCN.COM Ltd.30 Oct 201430 Oct 201430 Oct 2016
189chimneyandroofingservicesmurfreesboro.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
190chimney-sweepers.comTucows Domains Inc.30 Dec 202026 Sep 202330 Dec 2025
191chimneyrockvacations.comGoDaddy.com, LLC18 May 202418 May 202418 May 2026
192chimneysnewjersey.comGoDaddy.com, LLC6 Jul 20102 Jul 20156 Jul 2016
193chimneyfilter.comTLD Registrar Solutions Ltd.25 Aug 20215 Oct 202425 Aug 2024
194chimneycakeshop.comTurnCommerce, Inc. DBA NameBright.com24 Jul 201713 Feb 202524 Jul 2026
195chimneyrockinn.netWild West Domains, LLC18 Sep 199817 Sep 202517 Sep 2027
196chimneysweepermd.comGoDaddy.com, LLC12 Jul 200920 Apr 201512 Jul 2015
197chimneyrockland.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Aug 19976 Jul 20173 Aug 2018
198chimneys.bizPDR Ltd. d/b/a PublicDomainRegistry.com2 Jun 20172 Jun 20171 Jun 2018
199chimneycricket.comTucows Domains Inc.11 Feb 200630 Jan 202511 Feb 2026
200chimneyrepair911.orgPDR Ltd. d/b/a PublicDomainRegistry.com31 Oct 201431 Oct 201431 Oct 2015
201chimneypot.comNameCheap, Inc.2 Apr 200223 Oct 20202 Apr 2026
202chimneydirect.comTucows Domains Inc.18 Jun 200720 May 202518 Jun 2026
203chimneysupply.comTucows Domains Inc.4 Jan 20007 Dec 20234 Jan 2026
204chimney-cleaning.comGoDaddy.com, LLC22 Nov 201923 Nov 202522 Nov 2027
205chimney-repair.comHostinger, UAB22 Sep 202522 Sep 202522 Sep 2028
206chimneyprocleaning.comNameCheap, Inc.4 Jan 20195 Dec 20244 Jan 2026
207chimneysplusgutters.comregister.com, Inc.4 Mar 20056 Mar 20254 Mar 2028
208chimneybox.comMat Bao Trading & Service Company Limited d/b/a Ma…8 Oct 20219 Oct 20218 Oct 2022
209chimneyboys.comGoDaddy.com, LLC14 Oct 20229 Oct 202514 Oct 2026
210chimneycaretoledo.comTucows Domains Inc.4 Jun 20148 Jun 20154 Jun 2016
211chimneycleaningpros.comGoDaddy.com, LLC11 Jun 202312 Jun 202511 Jun 2026
212chimneydoctors.comLaunchpad, Inc.22 Jan 20007 Jan 202522 Jan 2026
213chimneysolutions.comGoDaddy.com, LLC21 Oct 199922 Oct 202521 Oct 2026
214chimneydude.comDynadot, LLC4 Dec 20254 Dec 20254 Dec 2026
215chimneyrx.comGoDaddy.com, LLC24 Oct 200725 Oct 202524 Oct 2027
216chimneyrockgemmine.comTLDs LLC dba SRSplus31 Aug 200528 Aug 202531 Aug 2026
217chimneycams.comGoDaddy.com, LLC22 Oct 201623 Oct 202522 Oct 2026
218chimneyrepairoakville.comGoDaddy.com, LLC11 Jun 201212 Jun 201511 Jun 2016
219chimneycrickettucson.comGoDaddy.com, LLC6 Dec 20102 Dec 20226 Dec 2027
220chimneyrodsdirect.co.uk-8 Jul 20136 Sep 20248 Jul 2029
221chimneysweepshop.comregister.com, Inc.23 Nov 201027 Dec 202323 Nov 2027
222chimneylinersusa.comTucows Domains Inc.7 Jul 20098 Jun 20257 Jul 2026
223chimneycornerusa.comGoDaddy.com, LLC28 Oct 201029 Oct 202528 Oct 2026
224chimneyrepairny.comWild West Domains, LLC19 Apr 201020 Apr 202419 Apr 2026
225chimneysweeping.usGoDaddy.com, LLC2 Nov 201410 Aug 20161 Nov 2018
226chimneysweeping.orgGoDaddy.com, LLC3 Nov 201418 Dec 20243 Nov 2026
227chimneyguysohio.comGoDaddy.com, LLC20 Sep 20132 Oct 202520 Sep 2026
228chimneymasters.netNameCheap, Inc.30 Sep 202411 Nov 202530 Sep 2025
229chimneykeepers.comGoDaddy.com, LLC18 May 199919 May 202518 May 2027
230chimneycleaners.comGoDaddy.com, LLC2 Mar 20004 Sep 202212 Sep 2029
231chimneycapdesign.comTucows Domains Inc.2 Oct 200317 Sep 20252 Oct 2026
232chimneysaver.comGoDaddy.com, LLC3 Feb 199930 Jul 20253 Feb 2028
233chimneysweepsmanchester.comLaunchpad, Inc.25 Jan 201925 Jan 201925 Jan 2020
234chimneypromt.comNameCheap, Inc.5 Nov 20146 Oct 20255 Nov 2026
235chimneypromontana.comNameCheap, Inc.5 Nov 20149 Jan 20185 Nov 2018
236chimneycleaningokc.comGoDaddy.com, LLC17 Mar 202517 Mar 202517 Mar 2026
237chimneyandroofingpa.comTucows Domains Inc.4 Nov 20148 Nov 20154 Nov 2016
238chimneyapp.comDropCatch.com 559 LLC18 Mar 202319 Mar 202318 Mar 2026
239chimneycleaningcollinsvilleil.comGoDaddy.com, LLC18 Aug 20143 Aug 201618 Aug 2017
240chimneycleaningedwardsvilleil.comNameCheap, Inc.1 Nov 20252 Nov 20251 Nov 2026
241chimneycleaninghighlandil.comGoDaddy.com, LLC18 Aug 20143 Aug 201618 Aug 2017
242chimneycontractorslondon.comMesh Digital Limited18 Aug 201418 Aug 201418 Aug 2015
243chimneybreadbakeshop.comeNombre Corporation20 Jun 201920 Jun 201920 Jun 2020
244chimneyrockvilla.net1&1 Internet AG19 Aug 201413 Nov 201719 Aug 2026
245chimneysbest.comTucows Domains Inc.19 Aug 201423 Aug 201519 Aug 2016
246chimneycapreplacement.comGoDaddy.com, LLC11 Dec 202211 Dec 202411 Dec 2025
247chimneyacademy.comNetwork Solutions, LLC20 Aug 201421 Jun 202420 Aug 2027
248chimneycapsphoenix.netGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
249chimneysweepsinphoenix.netGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
250chimneyinspectionguys.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…21 Jun 20227 Jul 202321 Jun 2023
251chimneyproguys.comDropCatch.com 1077 LLC1 Apr 20191 Apr 20191 Apr 2020
252chimneyservicesnaperville.comeNom, Inc.12 Jan 201512 Jan 201512 Jan 2018
253chimneysweepdenver.orgGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
254chimneysweepguys.comAbove.com Pty Ltd.1 Apr 201928 Jan 20251 Apr 2026
255chimneysweepingcompany.netNameCheap, Inc.31 Jan 202531 Jan 202531 Jan 2026
256chimneydesigner.comTucows Domains Inc.21 Aug 201425 Aug 201521 Aug 2016
257chimneymaintenanceedinburgh.mobiTucows Domains Inc.21 Aug 201421 Aug 201421 Aug 2015
258chimneymonitor.comTucows Domains Inc.21 Aug 201425 Aug 201521 Aug 2016
259chimneyspringshousevalue.comGoDaddy.com, LLC21 Aug 201422 Aug 201621 Aug 2018
260chimneylinerguides.comGoDaddy.com, LLC11 Jan 201911 Jan 201911 Jan 2020
261chimneyprofessionalsllc.comTucows Domains Inc.6 Feb 201510 Feb 20196 Feb 2019
262chimneysweepinsussex.comMesh Digital Limited6 Feb 20156 Feb 20156 Feb 2016
263chimneysweepsanantonio.comGoDaddy.com, LLC6 Feb 20158 Sep 20256 Feb 2026
264chimneywaterdamage.comGoDaddy.com, LLC6 Feb 20157 Feb 20156 Feb 2016
265chimney-roof-gutters.comGoDaddy.com, LLC6 Nov 20146 Nov 20146 Nov 2015
266chimneypro.usNameCheap, Inc.5 Nov 201411 Oct 20174 Nov 2018
267chimneydry.comNameCheap, Inc.27 Apr 20229 Jul 202327 Apr 2023
268chimneylinerinstaller.comMesh Digital Limited22 Aug 201422 Aug 201422 Aug 2015
269chimneymaintenancelondon.comMesh Digital Limited22 Aug 201422 Aug 201422 Aug 2015
270chimneyrebuildsinlondon.comMesh Digital Limited22 Aug 201422 Aug 201422 Aug 2015
271chimneyrestorationinlondon.comMesh Digital Limited22 Aug 201422 Aug 201422 Aug 2015
272chimneysweepcalgary.comGoDaddy.com, LLC28 Aug 201928 Aug 201928 Aug 2020
273chimneytraining.comKey-Systems GmbH10 Nov 202224 Jan 202410 Nov 2023
274chimneyvancouver.comGoogle, Inc.26 Sep 202027 Sep 202326 Sep 2024
275chimneyvictoria.comDropCatch.com 1485 LLC9 Nov 20179 Nov 20179 Nov 2018
276chimneycakery.comGoDaddy.com, LLC12 Jan 20229 Jan 202412 Jan 2026
277chimneycricketnh.comGoDaddy.com, LLC13 Aug 201413 Aug 201413 Aug 2017
278chimneyinspectionservices.comDomainPeople, Inc.10 Jul 202510 Jul 202510 Jul 2026
279chimneyretrofit.comGoDaddy.com, LLC25 Aug 201425 Aug 201425 Aug 2015
280chimneyhillway1156.comTucows Domains Inc.15 Jul 201719 Jul 201815 Jul 2018
281chimneysafety.usGoDaddy.com, LLC26 Aug 201426 Aug 201625 Aug 2018
282chimneysaver.usGoDaddy.com, LLC26 Aug 201426 Aug 201625 Aug 2018
283chimneysaverrva.comGoDaddy.com, LLC26 Aug 201427 Aug 201626 Aug 2018
284chimneysaversolutionsrva.comGoDaddy.com, LLC26 Aug 201427 Aug 201626 Aug 2018
285chimneysbest.neteNom, Inc.26 Aug 201426 Aug 201426 Aug 2015
286chimneyservicemilwaukee.comGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
287chimneysupplydepot.comGoDaddy.com, LLC25 Aug 201425 Aug 201425 Aug 2015
288chimneyliningslondon.comDropCatch.com 387 LLC11 Jan 201811 Jan 201811 Jan 2019
289chimneyrebuildslondon.comMesh Digital Limited13 Aug 201413 Aug 201413 Aug 2015
290chimneyserviceslondon.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Oct 20165 Dec 201724 Oct 2017
291chimneyandguttermaintenance.comNetwork Solutions, LLC9 Nov 201410 Nov 20169 Nov 2017
292chimneyhillapts.comNetwork Solutions, LLC18 Jan 20172 Apr 202518 Jan 2025
293chimneylinersinlondon.comMesh Digital Limited15 Feb 20176 Dec 201715 Feb 2018
294chimneyrepairokc.comTucows Domains Inc.24 Aug 201127 Aug 201424 Aug 2015
295chimneyplan.comRegister.it SPA28 Aug 20144 Aug 201628 Aug 2017
296chimneyhillsestates.comGoDaddy.com, LLC16 Aug 201417 Aug 202516 Aug 2026
297chimney-repair-top-notchconstruction.comGoDaddy.com, LLC11 Nov 201411 Nov 201411 Nov 2015
298chimneytech.bizGoDaddy.com, LLC12 Nov 20148 Sep 201611 Nov 2017
299chimneysweepkansascity.infoGoDaddy.com, LLC11 Sep 201418 Mar 202411 Sep 2027
300chimneysweepkansascity.netGoDaddy.com, LLC11 Sep 201418 Mar 202411 Sep 2027
301chimneysweepkansascity.orgGoDaddy.com, LLC11 Sep 20143 Sep 202411 Sep 2027
302chimneysweep-stlouis.comNameCheap, Inc.1 Nov 20252 Nov 20251 Nov 2026
303chimneyexpertsva.comDynadot, LLC25 Mar 202310 Mar 202525 Mar 2026
304chimneyrepairofoakland.comTucows Domains Inc.26 Aug 201130 Aug 201426 Aug 2015
305chimneys-ranch.comTucows Domains Inc.27 Aug 201030 Aug 201427 Aug 2015
306chimney-balloon-store.comTucows Domains Inc.10 Sep 201213 Sep 201410 Sep 2015
307chimney-cowl-store.comTucows Domains Inc.10 Sep 201213 Sep 201410 Sep 2015
308chimney-cowl.comWebfusion Ltd.29 Jan 201522 Jan 201729 Jan 2018
309chimney-removal.comTucows Domains Inc.10 Sep 201213 Sep 201410 Sep 2015
310chimneyinstallationsinlondon.comWebfusion Ltd.14 Jul 201514 Jul 201514 Jul 2016
311chimneyventing.infoGoDaddy.com, LLC15 Sep 201415 Sep 201415 Sep 2015
312chimney-installers.comMesh Digital Limited1 Sep 20141 Sep 20141 Sep 2015
313chimneyrelininginlondon.comMesh Digital Limited1 Sep 20141 Sep 20141 Sep 2015
314chimneyspecialistlondon.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Feb 201611 Feb 201811 Feb 2018
315chimneyspecialistsinlondon.comMesh Digital Limited1 Sep 20141 Sep 20141 Sep 2015
316chimneysupplycompany.comGoDaddy.com, LLC8 Jun 20239 Jun 20258 Jun 2026
317chimneysupplystore.comGoDaddy.com, LLC8 Jun 20239 Jun 20258 Jun 2026
318chimneyalert.comGoDaddy.com, LLC12 Jul 202022 Sep 202412 Jul 2024
319chimneycast.comTurnCommerce, Inc. DBA NameBright.com4 Dec 201513 Jan 20254 Dec 2024
320chimneycrete.netGoDaddy.com, LLC16 Sep 201422 Sep 201616 Sep 2017
321chimneyrockvillagejobs.comDNC Holdings, Inc.16 Sep 201416 Sep 201416 Sep 2015
322chimneycast.netGoDaddy.com, LLC16 Sep 201416 Sep 201416 Sep 2015
323chimneyalert.netGoDaddy.com, LLC16 Sep 201416 Sep 201416 Sep 2015
324chimneysweepkc.com1&1 Internet AG15 Nov 201416 Nov 202515 Nov 2026
325chimneysweepjohnsoncounty.com1&1 Internet AG15 Nov 20146 Mar 201815 Nov 2026
326chimneylogfire.comGoDaddy.com, LLC14 Nov 201414 Nov 201414 Nov 2015
327chimneycleaningdublin.comTucows Domains Inc.11 Nov 201322 Jan 202511 Nov 2024
328chimneyservicesdownersgrove.comNameCheap, Inc.2 Sep 20142 Aug 20252 Sep 2026
329chimneysafemn.comTucows Domains Inc.12 Sep 201116 Sep 201412 Sep 2015
330chimneyservicesaco.comeNom, Inc.15 Sep 201418 Sep 201715 Sep 2017
331chimneysupply2.comTucows Domains Inc.12 Sep 200815 Sep 201412 Sep 2015
332chimneyworksnj.comGoDaddy.com, LLC15 Jun 202015 Jun 202015 Jun 2021
333chimneystreet.comDynadot, LLC4 Apr 20254 Apr 20254 Apr 2026
334chimneyservicessandiego.comNameCheap, Inc.16 Sep 201428 Nov 202416 Sep 2024
335chimneyservicekansascity.com1&1 Internet AG15 Nov 20146 Mar 201815 Nov 2026
336chimneyservicejohnsoncounty.com1&1 Internet AG15 Nov 20146 Mar 201815 Nov 2026
337chimneyrepairkansascity.com1&1 Internet AG15 Nov 20146 Mar 201815 Nov 2026
338chimneyserviceslosangeles.comNameCheap, Inc.17 Sep 201429 Nov 202417 Sep 2024
339chimneyservicesorangecounty.comNameCheap, Inc.17 Sep 201417 Aug 202317 Sep 2024
340chimneysweepsedinburgh.mobiTucows Domains Inc.17 Sep 201417 Sep 201417 Sep 2015
341chimneysweepkc.net1&1 Internet AG15 Nov 201413 Nov 201715 Nov 2026
342chimneysweepjohnsoncounty.net1&1 Internet AG15 Nov 201416 Nov 201615 Nov 2017
343chimneylakes.orgGoDaddy.com, LLC14 Nov 201415 Nov 202514 Nov 2026
344chimneypotstore.com1&1 Internet AG4 Sep 201417 Nov 20254 Sep 2025
345chimneysweepsnashville.comBeijing Lanhai Jiye Technology Co., Ltd22 Nov 202324 Jan 202522 Nov 2024
346chimneyrockoutpost.comGoDaddy.com, LLC11 Aug 202125 Aug 202511 Aug 2026
347chimneysweepcarlsbad.comNameCheap, Inc.28 Oct 202529 Oct 202528 Oct 2026
348chimneysweeplondon.comTurnCommerce, Inc. DBA NameBright.com20 Apr 201722 May 202420 Apr 2024
349chimneyservicesnewhaven.comregister.com, Inc.5 Sep 20145 Sep 20145 Sep 2015
350chimneylakes.netGoDaddy.com, LLC12 Dec 200713 Dec 202412 Dec 2025
351chimneysolutionsny.mobieNom, Inc.5 Sep 201412 Aug 2025-
352chimneyservicekansascity.net1&1 Internet AG15 Nov 201416 Nov 201615 Nov 2017
353chimneyservicejohnsoncounty.net1&1 Internet AG15 Nov 201416 Nov 201615 Nov 2017
354chimneyrepairkansascity.netPDR Ltd. d/b/a PublicDomainRegistry.com30 Jun 202530 Jun 202530 Jun 2026
355chimneydata.comeNom, Inc.19 Feb 201918 Feb 201919 Feb 2020
356chimneysweep.infoTucows Domains Inc.19 Sep 201419 Sep 202319 Sep 2025
357chimneyserviceduluth.comeNom, Inc.17 Nov 201417 Nov 201417 Nov 2015
358chimneyrepairseattle.comOne.com A/S7 Mar 20257 Mar 20257 Mar 2026
359chimney-installations-london.comTucows Domains Inc.14 Nov 201318 Nov 201414 Nov 2015
360chimneylininginlondon.comMesh Digital Limited8 Sep 20148 Sep 20148 Sep 2015
361chimneyrepairschenectady.comRealtime Register B.V.25 Mar 202125 Mar 202125 Mar 2022
362chimneyrepointing.comGoDaddy.com, LLC3 May 20193 May 20253 May 2026
363chimneysweep254.comTucows Domains Inc.8 Sep 201412 Sep 20158 Sep 2016
364chimneytechservices.comTucows Domains Inc.8 Sep 201412 Sep 20158 Sep 2016
365chimneyhillsdental.mobiGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2016
366chimneyhillsdental.infoGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2016
367chimneyhillsfamilydental.comGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2016
368chimneyhillsfamilydental.infoGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2016
369chimneyhillsfamilydental.mobiGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2016
370chimneysweepcompany.net1&1 Internet AG14 Jan 20128 Oct 202514 Jan 2026
371chimneyhillsfamilydental.usGoDaddy.com, LLC1 Oct 20141 Oct 201430 Sep 2016
372chimneyservice.bizPDR Ltd. d/b/a PublicDomainRegistry.com18 Nov 201418 Nov 201417 Nov 2016
373chimneyfluelininglondon.comTucows Domains Inc.3 Oct 201413 Oct 20243 Oct 2025
374chimneyservicebohemia.comGoDaddy.com, LLC3 Oct 20143 Oct 20143 Oct 2015
375chimneysweepinc.comRegister.ca Inc.23 Mar 201617 Feb 202523 Mar 2026
376chimney-lining-london.comTucows Domains Inc.3 Oct 201414 Dec 20243 Oct 2024
377chimneysweepboulder.comTucows Domains Inc.3 Oct 20147 Oct 20193 Oct 2019
378chimneysweepsdenver.comNetwork Solutions, LLC27 Jun 202412 Jun 202527 Jun 2026
379chimneyhillsdental.comTurnCommerce, Inc. DBA NameBright.com1 Oct 201411 Nov 20251 Oct 2025
380chimneyoaksgolfclub.comGoDaddy.com, LLC1 Oct 20142 Oct 20251 Oct 2027
381chimneycleaningconshohocken.comeNom, Inc.19 Nov 201419 Nov 201419 Nov 2015
382chimney-sweep-hales.comGoDaddy.com, LLC1 Oct 20142 Oct 20241 Oct 2026
383chimneyconstructioninlondon.comMesh Digital Limited11 Sep 201411 Sep 201411 Sep 2015
384chimneyinspectionslondon.comMesh Digital Limited11 Sep 201411 Sep 201411 Sep 2015
385chimneymaintenanceinlondon.comMesh Digital Limited11 Sep 201411 Sep 201411 Sep 2015
386chimneysweepdallas.comGoDaddy.com, LLC20 May 201621 May 202520 May 2026
387chimneyhillsdental.netGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2016
388chimneyhillsfamilydental.netGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2016
389chimneyhillsfamilydental.orgGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2016
390chimneyhillsdental.orgGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2016
391chimneyhillsdental.usGoDaddy.com, LLC1 Oct 20141 Oct 201430 Sep 2016
392chimneychap.comTurnCommerce, Inc. DBA NameBright.com2 Oct 201426 Sep 20202 Oct 2026
393chimneycleaningrestorationpittsburgh.comGoDaddy.com, LLC2 Oct 20142 Oct 20142 Oct 2015
394chimneycontractornutleynj.comXin Net Technology Corporation23 Dec 20218 Dec 202223 Dec 2022
395chimneydoorsystem.comBlacknight Internet Solutions Ltd.2 Oct 201412 Sep 20162 Oct 2017
396chimneyandflues.comeNom, Inc.24 May 201917 May 202524 May 2026
397chimneyhillfarmestatehotel.comFabulous.com Pty Ltd.22 Sep 201422 Sep 201422 Sep 2015
398chimneyrepaircooperstown.comNamesilo, LLC20 Mar 201921 Mar 201920 Mar 2020
399chimneyrepairoldforge.comAscio Technologies, Inc. Danmark - Filial af Ascio…18 Dec 201718 Dec 201718 Dec 2018
400chimneyserviceswesthartford.comregister.com, Inc.23 Sep 201423 Sep 201423 Sep 2015
401chimneysweepcompanydrayden.comeNom, Inc.23 Sep 201423 Sep 201423 Sep 2015
402chimneycleaningjobs.comGoDaddy.com, LLC6 Oct 20146 Oct 20146 Oct 2015
403chimneygurus.comNameKing.com Inc.27 Nov 20242 Dec 202527 Nov 2026
404chimneyinspectionsuk.comMesh Digital Limited6 Oct 20143 Nov 20156 Oct 2017
405chimneysweepsmonterey.comGoogle, Inc.6 Oct 201421 Sep 20256 Oct 2026
406chimneynegozio.comTucows Domains Inc.24 Sep 201428 Sep 201524 Sep 2016
407chimney-outlet.comCronon AG24 Sep 201425 Sep 202524 Sep 2026
408chimneydoctorofct.neteNom, Inc.24 Sep 201424 Sep 201424 Sep 2015
409chimneyrockcolorado.comFabulous.com Pty Ltd.17 Sep 20056 Sep 201717 Sep 2018
410chimneywildliferemovaldallas.comGoDaddy.com, LLC24 Sep 201424 Sep 201424 Sep 2015
411chimneyrepairnewyork.comOnlineNIC, Inc.12 Mar 201912 Mar 201912 Mar 2020
412chimneyworkslondon.comWebfusion Ltd.7 Oct 20147 Oct 20147 Oct 2015
413chimneycornercafe.comDropCatch.com 549 LLC18 Aug 202218 Sep 202318 Aug 2023
414chimneyservicesalgonac.comeNom, Inc.8 Oct 20147 Sep 20158 Oct 2018
415chimneysweepinglayton.comNameCheap, Inc.8 Oct 20148 Sep 20258 Oct 2026
416chimneysweepjimcreegan.comGoDaddy.com, LLC31 May 201831 May 201831 May 2019
417chimneysweepjimcreeganny.comName.com, Inc.8 Oct 20148 Oct 20148 Oct 2015
418chimneyuncles.comGoDaddy.com, LLC9 Oct 20149 Oct 20149 Oct 2015
419chimneysolutionstampabay.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Nov 201422 Nov 201422 Nov 2015
420chimneylinerlondon.comDropCatch.com 1421 LLC10 Feb 201810 Feb 201810 Feb 2019
421chimneydetectives.comGoogle, Inc.1 Feb 20232 Apr 20241 Feb 2024
422chimneydoctortn.comTucows Domains Inc.24 Sep 201027 Sep 201424 Sep 2015
423chimneyrockfarm.comNordreg AB4 Mar 202511 Oct 20254 Mar 2026
424chimneysweepcleaner.comeNom, Inc.10 Oct 201410 Oct 201410 Oct 2015
425chimneycleaningdc.comNameCheap, Inc.4 Jul 20259 Jul 20254 Jul 2026
426chimneycleaningrepair.comMedia Elite Holdings Limited1 Dec 20212 Dec 20251 Dec 2025
427chimneyservicedayton.comNameCheap, Inc.16 Oct 201418 Sep 201816 Oct 2019
428chimneyrepairnashville.comGoDaddy.com, LLC11 Oct 201412 Oct 202511 Oct 2026
429chimneyplaza.comTucows Domains Inc.23 Nov 201427 Nov 201623 Nov 2016
430chimneycapsseattle.comGoDaddy.com, LLC24 Nov 201424 Nov 202424 Nov 2029
431chimneycake.usGoDaddy.com, LLC1 Nov 20176 Nov 20171 Nov 2018
432chimneyscoffee.com1&1 Internet AG12 Oct 201412 Oct 201412 Oct 2015
433chimneyscoffee.info1&1 Internet AG12 Oct 2014-12 Oct 2015
434chimneyscoffee.net1&1 Internet AG12 Oct 201412 Oct 201412 Oct 2015
435chimneyscoffee.org1&1 Internet AG12 Oct 2014-12 Oct 2015
436chimneyinstallersinlondon.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Sep 201611 Nov 201730 Sep 2017
437chimneyliningsinlondon.comMesh Digital Limited13 Oct 201413 Oct 201413 Oct 2015
438chimneysweepsofamericallc.comGoDaddy.com, LLC13 Oct 201414 Oct 201613 Oct 2017
439chimneyworksinlondon.comTucows Domains Inc.10 Oct 201314 Oct 201410 Oct 2015
440chimneyreliningsolutions.comGoDaddy.com, LLC25 Sep 201425 Oct 202425 Sep 2034
441chimneygenie.comFastDomain Inc.26 Sep 201411 Sep 202526 Sep 2026
442chimney-sweeps-sootbusters.com1&1 Internet AG27 Sep 201427 Sep 201627 Sep 2018
443chimney-sweeps-ri.com1&1 Internet AG27 Sep 201427 Sep 201627 Sep 2018
444chimneyservicelondon.comMesh Digital Limited24 Nov 201424 Nov 201424 Nov 2015
445chimneycleaningcincinnatiohio.comNameCheap, Inc.4 Nov 20256 Nov 20254 Nov 2026
446chimneysweepscotland.comGoDaddy.com, LLC22 May 201823 May 202522 May 2026
447chimneyguide.com-4 Jan 20228 Dec 20254 Jan 2025
448chimneypipepipe.com-16 Sep 201616 Sep 201616 Sep 2017
449chimneyinstallations-london.comTucows Domains Inc.22 Nov 201326 Nov 201422 Nov 2015
450chimneycleaningsananselmo.comeNom, Inc.26 Nov 201426 Nov 201426 Nov 2015
451chimneycleaningcharlottenc.comNameCheap, Inc.28 Oct 202531 Oct 202528 Oct 2026
452chimneypro254.comTucows Domains Inc.24 Nov 201328 Nov 201424 Nov 2015
453chimney-rock.netName.com, Inc.27 Nov 20141 Nov 201527 Nov 2017
454chimneysweepglasgow.comTucows Domains Inc.28 Nov 201428 Nov 202528 Nov 2026
455chimneycontractorelizabethtown.comeNom, Inc.28 Nov 201428 Nov 201428 Nov 2015
456chimney-fish.comFastDomain Inc.10 Jun 20222 Aug 202510 Jun 2027
457chimneysweepsbutton.comNameCheap, Inc.1 Dec 201412 Feb 20251 Dec 2024
458chimneysweepingva.comMedia Elite Holdings Limited4 Dec 20204 Dec 20204 Dec 2021
459chimneysweepbutton.comNameCheap, Inc.1 Dec 201730 Dec 20241 Dec 2025
460chimney-sweep-london.comBeijing Lanhai Jiye Technology Co., Ltd15 Aug 20236 Sep 202515 Aug 2026
461chimneyclean.bizTucows Domains Inc.1 Dec 20104 Dec 201430 Nov 2014
462chimneysweepssussex.comMesh Digital Limited9 Dec 20149 Dec 20149 Dec 2015
463chimneysweepsteringny.comeNom, Inc.11 Dec 201428 Jun 201711 Dec 2017
464chimneycharmer.comGoDaddy.com, LLC11 Dec 201411 Dec 201411 Dec 2016
465chimneypeakranch.comGoDaddy.com, LLC12 Dec 201412 Dec 201412 Dec 2019
466chimneypeakranch.infoGoDaddy.com, LLC12 Dec 201412 Dec 201412 Dec 2016
467chimneypeakranch.usGoDaddy.com, LLC12 Dec 201412 Dec 201411 Dec 2016
468chimneypeakranch.orgGoDaddy.com, LLC12 Dec 201412 Dec 201412 Dec 2016
469chimneypeakranch.netGoDaddy.com, LLC12 Dec 201412 Dec 201412 Dec 2016
470chimney-service.netDomainshype.com, Inc.14 Dec 201414 Dec 201414 Dec 2015
471chimneysweepportdeposit.comName.com, Inc.15 Dec 201415 Dec 201415 Dec 2015
472chimneyprocleaners.comGoDaddy.com, LLC26 Oct 201227 Oct 202526 Oct 2030
473chimneymastersbayarea.comGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2016
474chimneysweepcaernarfon.comWebfusion Ltd.17 Dec 201410 Dec 201717 Dec 2018
475chimneyhillshreveport.comGoDaddy.com, LLC19 Dec 201419 Dec 201419 Dec 2019
476chimneysweepbasingstoke.comGandi SAS10 Jan 201710 Jan 201710 Jan 2018
477chimneypublishing.comDomainestic.com Inc.19 Dec 201419 Dec 201419 Dec 2015
478chimneymusic.comKey-Systems GmbH3 Mar 20173 Mar 20173 Mar 2018
479chimneysweepsbuttons.comNameCheap, Inc.20 Dec 20143 Mar 202520 Dec 2024
480chimneysweepersbutton.comNameCheap, Inc.20 Dec 20143 Mar 202520 Dec 2024
481chimneysweeperbutton.comNameCheap, Inc.20 Dec 20143 Mar 202520 Dec 2024
482chimneymagazine.comWild West Domains, LLC21 Dec 201421 Dec 201421 Dec 2015
483chimneysweepsday.comNameCheap, Inc.22 Dec 20145 Mar 202522 Dec 2024
484chimneyrocktravel.comGoDaddy.com, LLC23 Dec 201423 Dec 201423 Dec 2015
485chimneysweepsday.orgNameCheap, Inc.22 Dec 20144 Mar 202522 Dec 2024
486chimneyninjas.comGoogle, Inc.24 Nov 20225 Jan 202524 Nov 2024
487chimneyguytc.comGoDaddy.com, LLC26 Feb 20209 Apr 202526 Feb 2025
488chimneycretecusa.comGoDaddy.com, LLC28 Dec 201428 Dec 201428 Dec 2015
489chimneycreteusa.netGoDaddy.com, LLC28 Dec 201423 Feb 201728 Dec 2017
490chimneypc.comRegional Network Information Center, JSC dba RU-CE…30 Dec 201430 Dec 201430 Dec 2015
491chimneysweepsnortheast.comEasyspace LTD30 Dec 201430 Nov 202430 Dec 2025
492chimneysweepincork.comregister.com, Inc.30 Dec 201431 Dec 202430 Dec 2025
493chimneyexpertllc.comGoDaddy.com, LLC30 Dec 201430 Dec 201430 Dec 2015
494chimneyserviceslexington.comeNom, Inc.31 Dec 201430 Nov 201531 Dec 2017
495chimneyworld.comGoDaddy.com, LLC25 Apr 201624 Apr 202525 Apr 2026
496chimneybuild.comTucows Domains Inc.30 Dec 20133 Jan 201530 Dec 2015
497chimney-balloon.comGo Montenegro Domains, LLC4 Jun 20165 Jun 20254 Jun 2026
498chimneyrockautobrokers.comGoDaddy.com, LLC5 Jan 20155 Jan 20155 Jan 2016
499chimneycreektradingcompany.comGoDaddy.com, LLC4 Jan 20154 Jan 20154 Jan 2020
500chimneysweeping.servicesTucows Domains Inc.26 Jul 201427 May 2025-
501chimneyshadows.xyzNetwork Solutions, LLC24 Jul 201424 Jul 201424 Jul 2015
502chimneyinspection.expertGoDaddy.com, LLC3 Aug 201417 Sep 20193 Aug 2020
503chimneysweep.servicesGoDaddy.com, LLC7 Mar 202421 Apr 20257 Mar 2026
504chimneypipe.supplyGoDaddy.com, LLC21 Aug 20145 Oct 202421 Aug 2026
505chimneypipe.partsGoDaddy.com, LLC21 Aug 201421 Aug 201421 Aug 2015
506chimneyliner.supplyGoDaddy.com, LLC21 Aug 20145 Oct 202421 Aug 2026
507chimneysaver.solutionsGoDaddy.com, LLC26 Aug 201429 Sep 201726 Aug 2018
508chimneysafety.guruGoDaddy.com, LLC26 Aug 201429 Sep 201726 Aug 2018
509chimneycornerscamp.campNetwork Solutions, LLC18 Sep 201418 Sep 201418 Sep 2015
510chimneycorners.campNetwork Solutions, LLC18 Sep 201418 Sep 201418 Sep 2015
511chimneys.nycGoDaddy.com, LLC24 Jan 202520 Oct 202524 Jan 2027
512chimneyrepair.nycNetwork Solutions, LLC8 Oct 20149 Aug 20167 Oct 2017
513chimneyliner.nycNetwork Solutions, LLC8 Oct 20149 Aug 20167 Oct 2017
514chimneyrepair.londonMesh Digital Limited7 Oct 20147 Oct 20147 Oct 2015
515chimneyconstruction.londonMesh Digital Limited7 Oct 20147 Oct 20147 Oct 2015
516chimney-shaft.clubGMO Internet Inc.8 Oct 20148 Oct 20147 Oct 2015
517chimneylining.scotMesh Digital Limited15 Oct 20148 Nov 201615 Oct 2017
518chimneyspecialists.londonMesh Digital Limited17 Oct 201417 Oct 201417 Oct 2015
519chimneyspecialist.londonMesh Digital Limited17 Oct 201417 Oct 201417 Oct 2015
520chimneyliners.londonMesh Digital Limited17 Oct 201417 Oct 201417 Oct 2015
521chimneyreddeer.comLaunchpad, Inc.12 Aug 201528 Jul 201712 Aug 2019
522chimneyrebuilds.londonMesh Digital Limited6 Nov 20146 Nov 20146 Nov 2015
523chimneyinstallation.londonMesh Digital Limited6 Nov 20146 Nov 20146 Nov 2015
524chimneys.repairPDR Ltd. d/b/a PublicDomainRegistry.com29 Jan 201629 Jan 201629 Jan 2017
525chimneys.expertMesh Digital Limited6 Nov 20146 Nov 20146 Nov 2015
526chimneyrestorations.londonMesh Digital Limited18 Nov 201418 Nov 201418 Nov 2015
527chimneymaintenance.londonMesh Digital Limited18 Nov 201418 Nov 201418 Nov 2015
528chimneylining.londonMesh Digital Limited18 Nov 201418 Nov 201418 Nov 2015
529chimneyliner.londonMesh Digital Limited18 Nov 201418 Nov 201418 Nov 2015
530chimneyrelining.servicesGoDaddy.com, LLC5 Jan 201516 Feb 20245 Jan 2024
531chimneyliner.servicesGoDaddy.com, LLC5 Jan 201516 Feb 20245 Jan 2024
532chimneychamps.servicesGoDaddy.com, LLC5 Jan 20156 Jan 20175 Jan 2018
533chimneys.buildersGoDaddy.com, LLC22 Jan 201522 Jan 201522 Jan 2017
534chimneyservice.companyGoDaddy.com, LLC28 Jan 201514 Mar 201728 Jan 2018
535chimneys.companyNameCheap, Inc.1 Mar 202430 Jan 2025-
536chimneys.cleaningNameKing.com Inc.19 Nov 202519 Nov 202519 Nov 2026
537chimneys.businessNameCheap, Inc.1 Mar 202430 Jan 2025-
538chimneyrock.reviewsNetwork Solutions, LLC28 Jan 201529 Nov 202428 Jan 2026
539chimneyrock.rentalsNetwork Solutions, LLC28 Jan 201529 Nov 202428 Jan 2026
540chimneyrock.guideNetwork Solutions, LLC28 Jan 201529 Nov 202428 Jan 2026
541chimneyrepair.expertGoDaddy.com, LLC28 Jan 201514 Mar 201728 Jan 2018
542chimneycleaning.companyGoDaddy.com, LLC28 Jan 201514 Mar 201728 Jan 2018
543chimneys.supplyGoDaddy.com, LLC28 Jan 201514 Mar 201728 Jan 2018
544chimneyrock.vacationsNetwork Solutions, LLC28 Jan 201529 Nov 202428 Jan 2026
545chimneyrock.propertyUniregistrar Corp31 Jan 20154 Feb 201531 Jan 2016
546chimneysweepsnh.repairGoDaddy.com, LLC25 Mar 201525 Mar 201525 Mar 2016
547chimneysweepsnh.cleaningGoDaddy.com, LLC25 Mar 201525 Mar 201525 Mar 2016
548chimneyrepairs.nycGoDaddy.com, LLC4 Apr 20159 Apr 20173 Apr 2018
549chimneyrockcabin.socialeNom, Inc.30 Mar 201530 Mar 201530 Mar 2016
550chimneyrockcabin.reviewseNom, Inc.30 Mar 201530 Mar 201530 Mar 2016
551chimneysweeping.solutionsGoDaddy.com, LLC9 Apr 20156 Jan 20179 Apr 2018
552chimneysweepyork.comGoDaddy.com, LLC13 Aug 201514 Aug 202513 Aug 2026
553chimneysweepwetherby.comGoDaddy.com, LLC13 Aug 201513 Aug 201513 Aug 2016
554chimneysweepripon.comGoDaddy.com, LLC13 Aug 201513 Aug 201513 Aug 2016
555chimneynetwork.comGoDaddy.com, LLC18 Jun 202219 Jun 202418 Jun 2026
556chimneyrepair.solutionsGoDaddy.com, LLC12 Aug 202226 Sep 202512 Aug 2026
557chimneycap.solutionsGoDaddy.com, LLC14 Apr 201514 Apr 201514 Apr 2016
558chimneyrockenrgy.comGoDaddy.com, LLC5 Jan 20155 Jan 20155 Jan 2017
559chimneyrepairteam.comBizcn.com, Inc.26 Mar 201926 Mar 201926 Mar 2020
560chimneycapproguys.comHangzhou AiMing Network Co., LTD25 Mar 201925 Mar 201925 Mar 2020
561chimneycakesa.comDomain.com, LLC6 Jan 20159 Aug 20176 Jan 2018
562chimney-sweep.orgGoDaddy.com, LLC5 Jun 202020 Jul 20255 Jun 2026
563chimneysweepsct.comWild West Domains, LLC8 Jan 20158 Jan 20158 Jan 2016
564chimneymasterco.comMarcaria.com International, Inc.8 Jan 20158 Jan 20158 Jan 2016
565chimneymaster-in.comMarcaria.com International, Inc.8 Jan 20158 Jan 20158 Jan 2016
566chimneyrockgw.comregister.com, Inc.14 Aug 201514 Aug 201514 Aug 2016
567chimneycleaningingardencityny.comeNom, Inc.14 Aug 201514 Aug 201514 Aug 2016
568chimneychoice.comTurnCommerce, Inc. DBA NameBright.com9 Jan 201515 Jan 20209 Jan 2026
569chimneycapsatweatherbeater.comeNom, Inc.9 Jan 20159 Jan 20159 Jan 2017
570chimneyrockrealty.comGoDaddy.com, LLC8 Feb 20199 Feb 20258 Feb 2026
571chimneyproexperts.comHostinger, UAB17 Oct 202517 Oct 202517 Oct 2027
572chimneysweepone.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Jan 201511 Jan 201511 Jan 2016
573chimneyrepairone.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Jan 201511 Jan 201511 Jan 2016
574chimneyrepair1.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Jan 201511 Jan 201511 Jan 2016
575chimneyone.comGoogle, Inc.29 Nov 202211 Jan 202529 Nov 2024
576chimneylabs.comNameCheap, Inc.21 Dec 20223 Mar 202421 Dec 2023
577chimneysweepingcompany.infoGoDaddy.com, LLC12 Jan 2015-12 Jan 2016
578chimneyrockstorage.comGoDaddy.com, LLC19 Sep 202219 Sep 202219 Sep 2027
579chimneymasterinc.comMelbourne IT, Ltd14 Jan 201514 Jan 201514 Jan 2016
580chimneysweepinspectfireplacecleanrepairkansascitymissouri.comGoDaddy.com, LLC15 Jan 201515 Jan 201515 Jan 2016
581chimneyrockfamilyfarm.comTucows Domains Inc.15 Jan 201519 Jan 201715 Jan 2017
582chimneyhospital.comGoDaddy.com, LLC16 Jan 201516 Jan 202516 Jan 2027
583chimneymasterllc.comGoDaddy.com, LLC16 Jan 201527 Feb 202516 Jan 2026
584chimneylife.comGoDaddy.com, LLC15 Aug 201518 Aug 202515 Aug 2026
585chimneysweepbrighton.cityGoDaddy.com, LLC13 Jul 201523 Sep 202413 Jul 2024
586chimneysweep.newseNom, Inc.28 Jul 201528 Jul 202428 Jul 2025
587chimneyfranchisor.workeNom, Inc.5 Aug 20155 Aug 20155 Aug 2016
588chimneyslondon.websiteMesh Digital Limited5 Aug 20155 Aug 20155 Aug 2016
589chimneypotts.comGoDaddy.com, LLC17 Jan 201517 Jan 201517 Jan 2017
590chimneyandstone.comGoDaddy.com, LLC17 Jan 201522 Jan 202517 Jan 2026
591chimneytownnw.com-18 Aug 201518 Aug 201518 Aug 2017
592chimneysweepslouisville.comeNom, Inc.20 Jan 201520 Jan 201520 Jan 2018
593chimneyfiresolutionsireland.comTucows Domains Inc.17 Jan 201421 Jan 201517 Jan 2016
594chimneyfiresireland.comTucows Domains Inc.17 Jan 201421 Jan 201517 Jan 2016
595chimneyfireservicesireland.comTucows Domains Inc.17 Jan 201421 Jan 201517 Jan 2016
596chimneycleaningottawa.comeNom, Inc.21 Jan 201521 Jan 201521 Jan 2016
597chimneybuildingandcleaning.comregister.com, Inc.21 Jan 201523 Feb 201721 Jan 2018
598chimneykings.comLaunchpad, Inc.24 Jan 20156 May 202524 Jan 2026
599chimneysweepacademy.comTurnCommerce, Inc. DBA NameBright.com25 Oct 20195 Dec 202525 Oct 2025
600chimneysmoker.comGoDaddy.com, LLC25 Jan 201525 Jan 201525 Jan 2016
601chimneyswiftnow.comregister.com, Inc.26 Jan 201526 Jan 201526 Jan 2016
602chimneysafereno.comTucows Domains Inc.22 Jan 201426 Jan 201522 Jan 2016
603chimneyroll.comGoDaddy.com, LLC24 Nov 202126 Nov 202524 Nov 2027
604chimneydocmd.comTucows Domains Inc.23 Jan 201427 Jan 201523 Jan 2016
605chimneycreteusa.comGoDaddy.com, LLC27 Jan 201527 Jan 202527 Jan 2026
606chimneyanddryerventservices.comGoogle, Inc.6 Mar 201819 Feb 20256 Mar 2026
607chimneysweeptacoma.comNameCheap, Inc.13 Jul 202511 Oct 202513 Jul 2026
608chimneymegastore.comTucows Domains Inc.24 Jan 200928 Jan 201524 Jan 2016
609chimneydraughtlimiter.comMesh Digital Limited28 Jan 201523 Jan 201728 Jan 2019
610chimneycreteusa.orgGoDaddy.com, LLC27 Jan 201527 Jan 201527 Jan 2016
611chimneycrete.orgGoDaddy.com, LLC27 Jan 201527 Jan 201527 Jan 2016
612chimneyfluemegastore.comTucows Domains Inc.27 Jan 200931 Jan 201527 Jan 2016
613chimneytech.orgTucows Domains Inc.11 Jan 201018 Dec 202411 Jan 2026
614chimneyjack.netGoDaddy.com, LLC30 Jan 201530 Jan 201530 Jan 2017
615chimneyjack.infoGoDaddy.com, LLC30 Jan 201531 Jan 201730 Jan 2019
616chimneysweepingwisconsin.comTucows Domains Inc.16 Aug 201020 Aug 201516 Aug 2016
617chimneyrepairinoakridgetn.comeNom, Inc.2 Feb 20152 Feb 20152 Feb 2016
618chimneycleaningnewark.comTucows Domains Inc.8 Dec 201712 Dec 20198 Dec 2019
619chimneysweepdenverco.comNameCheap, Inc.28 Oct 202529 Oct 202528 Oct 2026
620chimneyprofessionalsct.comTucows Domains Inc.4 Feb 20158 Feb 20194 Feb 2019
621chimneycleaningparkercounty.comTucows Domains Inc.1 Feb 20115 Feb 20151 Feb 2016
622chimneytopfarm.comGoDaddy.com, LLC5 Feb 20155 Feb 20155 Feb 2016
623chimneyliningslondon.mobiTucows Domains Inc.28 Jan 20131 Feb 201528 Jan 2016
624chimneylininglondon.mobiTucows Domains Inc.28 Jan 20131 Feb 201528 Jan 2016
625chimneyinstallationslondon.mobiTucows Domains Inc.28 Jan 20131 Feb 201528 Jan 2016
626chimneysweeplocalexperts.comHefei Juming Network Technology Co., Ltd3 Mar 20235 May 20243 Mar 2024
627chimneyservicelocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
628chimneyrepairlocalexperts.comHongkong Domain Name Information Management Co., L…7 Nov 202111 Nov 20227 Nov 2022
629chimneylocalexperts.comNames Stop Here LLC7 Nov 20168 Nov 20167 Nov 2017
630chimneylinerlocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
631chimneyinspectionlocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
632chimneycleaninglocalexperts.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Nov 201623 Nov 201723 Nov 2017
633chimneycaplocalexperts.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Nov 201623 Nov 201723 Nov 2017
634chimneyswiftsnj.comFastDomain Inc.8 Feb 201524 Jan 20258 Feb 2026
635chimneysweepsconnecticut.comWild West Domains, LLC9 Feb 20159 Feb 20159 Feb 2016
636chimneyrocknews.comGoDaddy.com, LLC10 Feb 201510 Feb 201510 Feb 2016
637chimneyswiftsnj.orgFastDomain Inc.8 Feb 201529 Jan 20258 Feb 2026
638chimneyswiftsnj.netFastDomain Inc.8 Feb 201524 Jan 20258 Feb 2026
639chimneyprosmi.comeNom, Inc.27 Mar 201927 Mar 201927 Mar 2020
640chimneyserviceatlanta.comGoDaddy.com, LLC13 Feb 201513 Feb 201513 Feb 2016
641chimneysweepcumbria.com1&1 Internet AG24 Aug 202524 Aug 202524 Aug 2030
642chimneysweepseattle.netName.com, Inc.21 Aug 20154 Oct 202521 Aug 2025
643chimneyservicenwi.comTucows Domains Inc.18 Aug 201022 Aug 201518 Aug 2016
644chimneycarex.comTucows Domains Inc.18 Aug 201022 Aug 201518 Aug 2016
645chimneycake.bizGoDaddy.com, LLC1 Nov 20172 Nov 20251 Nov 2026
646chimneysweepgloucester.comGoDaddy.com, LLC17 Feb 201517 Feb 201517 Feb 2016
647chimneysweeplincolnshire.comNameCheap, Inc.5 May 20153 Mar 20255 May 2026
648chimneyfacts.com-10 May 20253 Nov 202510 May 2026
649chimneys101.comGoDaddy.com, LLC20 Feb 201521 Feb 202520 Feb 2027
650chimney-tech.comRegister.it SPA20 Feb 201520 Feb 201520 Feb 2016
651chimneyrepairstore.comNameCheap, Inc.10 Mar 20239 Feb 202510 Mar 2026
652chimneycleaningindianapolis.comNameCheap, Inc.10 Nov 202510 Nov 202510 Nov 2026
653chimneyheater.comGoDaddy.com, LLC23 Feb 201523 Feb 201523 Feb 2016
654chimneyrepairhq.com1&1 Internet AG22 Dec 201622 Dec 201622 Dec 2018
655chimneyrockoutfitters.com1&1 Internet AG27 Feb 20156 Mar 201827 Feb 2026
656chimneyroommates.comGandi SAS3 Mar 20153 Mar 20153 Mar 2016
657chimneycowlsdirect.comEveryones Internet, Ltd. dba SoftLayer2 Mar 201520 Jan 20172 Mar 2018
658chimneycleaningminneapolis.comNameCheap, Inc.5 Dec 20235 Nov 20245 Dec 2025
659chimneysweephudson.comName.com, Inc.3 Mar 20153 Mar 20153 Mar 2016
660chimneysweepbirmingham.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Mar 202231 Mar 202531 Mar 2026
661chimneyimpactmarketing.comTucows Domains Inc.3 Mar 20157 Mar 20203 Mar 2020
662chimneyquestions.comGoDaddy.com, LLC5 Mar 20155 Mar 20155 Mar 2016
663chimneycoach.comGoDaddy.com, LLC25 Dec 201926 Dec 202425 Dec 2025
664chimneyrepairtips.comGoDaddy.com, LLC6 Mar 20157 Mar 20256 Mar 2027
665chimneypay.comGoDaddy.com, LLC6 Mar 20157 Mar 20256 Mar 2027
666chimneysweepcolumbusohio.comInternet Domain Services BS Corp5 Apr 202316 May 20245 Apr 2024
667chimneypub.comTucows Domains Inc.6 Mar 200628 Feb 20256 Mar 2026
668chimneyspringshomevalues.comName.com, Inc.10 Mar 201510 Feb 201710 Mar 2018
669chimneyrockinn.bizGoDaddy.com, LLC10 Mar 201521 Mar 20179 Mar 2017
670chimneyservicesleeds.comGoDaddy.com, LLC11 Mar 201511 Mar 201511 Mar 2016
671chimneykinginc.netDropCatch.com 423 LLC21 Dec 20222 Mar 202421 Dec 2023
672chimneysweepseo.comGoDaddy.com, LLC13 Mar 201524 May 202513 Mar 2025
673chimneysweeplocal.comCloudFlare, Inc.20 Sep 202527 Sep 202520 Sep 2026
674chimneyserviceseo.comGoDaddy.com, LLC13 Mar 201524 May 202513 Mar 2025
675chimneyseo.comGoDaddy.com, LLC13 Mar 201524 May 202513 Mar 2025
676chimneyinstallermidlandpark.comeNom, Inc.13 Mar 201528 Feb 201713 Mar 2018
677chimneyengineer.comGoDaddy.com, LLC10 Jul 202010 Jul 202010 Jul 2022
678chimneysweepsheffield.comeNom, Inc.17 Mar 201518 Jun 202517 Mar 2026
679chimneysweeperlondon.comGoDaddy.com, LLC18 Mar 201518 Mar 201518 Mar 2016
680chimneysweepuk.netGoDaddy.com, LLC17 Mar 201517 Mar 201517 Mar 2016
681chimneysweepsofalachua.comTucows Domains Inc.16 Mar 201121 Mar 201516 Mar 2016
682chimneytreestudios.comTucows Domains Inc.23 Aug 201027 Aug 201523 Aug 2016
683chimneycleaninginscrantonpa.comeNom, Inc.26 Aug 201526 Aug 201526 Aug 2016
684chimneyrockonline.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…1 Aug 20239 Aug 20241 Aug 2024
685chimneyrockgiftshop.comWild West Domains, LLC22 Mar 201522 Mar 201522 Mar 2016
686chimneysweepofbath.comGandi SAS20 Mar 201426 Apr 201720 Mar 2020
687chimneyservicesmanassasva.comeNom, Inc.23 Mar 201523 Mar 201523 Mar 2016
688chimneysweepchesterfield.comeNom, Inc.24 Mar 20152 Apr 202424 Mar 2026
689chimneyandstoves.comNetwork Solutions, LLC24 Mar 20153 Aug 202524 Mar 2026
690chimneysheep.usGoDaddy.com, LLC23 Mar 201515 Mar 201722 Mar 2018
691chimneyandmasonry.netTucows Domains Inc.23 Mar 201522 Feb 201723 Mar 2018
692chimneytownsweeps.comTucows Domains Inc.22 Mar 201426 Mar 201522 Mar 2016
693chimneytownsweeps.bizTucows Domains Inc.22 Mar 201425 Mar 201521 Mar 2015
694chimneytown.bizTucows Domains Inc.22 Mar 201425 Mar 201521 Mar 2015
695chimneysweepwirral.comDropCatch.com 619 LLC12 Jun 201812 Jun 201812 Jun 2019
696chimneysweepsnh.comGoDaddy.com, LLC25 Mar 201526 Mar 202425 Mar 2027
697chimneyrockvets.comWild West Domains, LLC26 Mar 201526 Mar 201526 Mar 2017
698chimneyrockvethospital.comWild West Domains, LLC26 Mar 201526 Mar 202526 Mar 2027
699chimneyrockvet.comWild West Domains, LLC26 Mar 201526 Mar 201526 Mar 2017
700chimneyrockanimalhospital.comWild West Domains, LLC26 Mar 201526 Mar 202526 Mar 2027
701chimneyrockanimalclinic.comWild West Domains, LLC26 Mar 201526 Mar 202526 Mar 2027
702chimneyrockah.comWild West Domains, LLC26 Mar 201526 Mar 201526 Mar 2017
703chimneyrepairsinchillicotheoh.comeNom, Inc.25 Mar 201524 Feb 201725 Mar 2018
704chimneyrepairkansascity.orgeNom, Inc.25 Mar 201525 Mar 201525 Mar 2016
705chimneyrepairinhaywardca.comNameCheap, Inc.26 Mar 201526 Feb 202326 Mar 2024
706chimneytownsweeps.netTucows Domains Inc.22 Mar 201426 Mar 201522 Mar 2016
707chimneytownsweeps.infoTucows Domains Inc.22 Mar 201426 Mar 201522 Mar 2016
708chimneytown.netGoogle, Inc.23 Mar 202130 Jun 202523 Mar 2026
709chimneytown.infoTucows Domains Inc.22 Mar 201426 Mar 201522 Mar 2016
710chimneymans.comTucows Domains Inc.28 Aug 20151 Sep 202428 Aug 2025
711chimneycleaninggreensboronc.comGoDaddy.com, LLC27 Aug 201527 Aug 201527 Aug 2018
712chimneybethpageny.comGoDaddy.com, LLC8 Jul 20198 Jul 20198 Jul 2020
713chimneysupplydirect.comeNom, Inc.27 Mar 201526 Feb 201727 Mar 2018
714chimneyinserts.com----
715chimneytownsweeps.orgTucows Domains Inc.22 Mar 201426 Mar 201522 Mar 2016
716chimneytownsweeps.name----
717chimneytown.orgTucows Domains Inc.22 Mar 201426 Mar 201522 Mar 2016
718chimneytown.name----
719chimneyspringshomes.comGoDaddy.com, LLC29 Mar 20153 Feb 202529 Mar 2026
720chimneysweepinginwaynenj.comeNom, Inc.30 Mar 201530 Mar 201530 Mar 2016
721chimneysweepindy.comNameCheap, Inc.10 Nov 202510 Nov 202510 Nov 2026
722chimneyrockbrewing.comGoDaddy.com, LLC30 Mar 201531 Mar 202530 Mar 2027
723chimneyrockbrewery.comGoDaddy.com, LLC30 Mar 201531 Mar 202530 Mar 2027
724chimneyrockhd.comGoDaddy.com, LLC31 Mar 20151 Apr 202531 Mar 2026
725chimneycleaningfortwayne.comTucows Domains Inc.25 Aug 201129 Aug 201525 Aug 2016
726chimneyandfireplacelowell.comName.com, Inc.28 Aug 201510 May 201728 Aug 2017
727chimneyspecialistscork.comBlacknight Internet Solutions Ltd.2 Apr 201512 Mar 20172 Apr 2019
728chimneycleancork.comBlacknight Internet Solutions Ltd.2 Apr 201512 Mar 20172 Apr 2019
729chimneysweepsonline.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Apr 20154 Apr 20154 Apr 2016
730chimneyrepairsonline.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Apr 20154 Apr 20154 Apr 2016
731chimneyrepaironline.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Apr 20154 Apr 20154 Apr 2016
732chimneyclosure.comFastDomain Inc.29 Feb 202413 Apr 202528 Feb 2025
733chimneycleanerelmira.comTucows Domains Inc.2 Apr 20146 Apr 20152 Apr 2016
734chimneycleanercorning.comTucows Domains Inc.2 Apr 20146 Apr 20152 Apr 2016
735chimneysweeper.netGabia, Inc.29 Mar 202229 May 202429 Mar 2024
736chimneysweepsmarketing.comGoDaddy.com, LLC6 Apr 201518 Jun 20256 Apr 2025
737chimneyservicemarketing.comGoDaddy.com, LLC6 Apr 201518 Jun 20256 Apr 2025
738chimneyserviceinc.comGoDaddy.com, LLC28 Jul 201628 Jul 201628 Jul 2018
739chimney-care-of-lake-charles.comNetwork Solutions, LLC6 Apr 20156 Apr 20156 Apr 2016
740chimneymaster.orgGoDaddy.com, LLC6 Apr 20156 Apr 20156 Apr 2016
741chimneyandhomerepairlawrenceks.comNetwork Solutions, LLC1 Sep 20159 Sep 20161 Sep 2017
742chimneytoronto.comGoDaddy.com, LLC14 Dec 201614 Dec 201614 Dec 2017
743chimneyservicelosangeles.comeNom, Inc.31 Aug 201530 Jul 201731 Aug 2017
744chimneysweepcincinnati.comNameCheap, Inc.4 Nov 20256 Nov 20254 Nov 2026
745chimneysdayton.comTucows Domains Inc.26 Aug 201030 Aug 201526 Aug 2016
746chimneypdx.comTucows Domains Inc.26 Aug 201030 Aug 201526 Aug 2016
747chimneywizardsweetsinc.comTucows Domains Inc.2 Sep 20156 Sep 20172 Sep 2017
748chimneytechs.netCosmotown, Inc.3 Sep 20153 Sep 20153 Sep 2016
749chimneysweepsnearme.comGoDaddy.com, LLC6 Jan 201830 Dec 20246 Jan 2026
750chimneysweepdelaware.comGoDaddy.com, LLC5 Sep 20196 Sep 20255 Sep 2027
751chimneyfredericksburg.comTucows Domains Inc.30 Aug 20123 Sep 201530 Aug 2016
752chimneyinspect.comGMO Internet Inc.17 Feb 202426 Mar 202517 Feb 2025
753chimneycornerbooks.comGoDaddy.com, LLC3 Sep 20153 Sep 20153 Sep 2016
754chimneycornerbook.comGoDaddy.com, LLC3 Sep 20153 Sep 20153 Sep 2016
755chimneysweepni.comMedia Elite Holdings Limited19 Nov 202119 Nov 202119 Nov 2022
756chimneyrock.techGoDaddy.com, LLC4 Sep 201520 Nov 20254 Sep 2026
757chimneysplusin.comGoDaddy.com, LLC13 Apr 201514 Apr 201513 Apr 2016
758chimneysweepseattle.orgGoDaddy.com, LLC19 Jul 201719 Jul 201719 Jul 2018
759chimneybreastsremoved.com1&1 Internet AG15 Apr 201516 Apr 201715 Apr 2018
760chimneyreliningingarfieldnj.comeNom, Inc.16 Apr 201516 Apr 201516 Apr 2016
761chimneycleaninginfayettevillear.comeNom, Inc.17 Apr 201517 Apr 201517 Apr 2016
762chimneyridgecabin.comFastDomain Inc.5 Sep 20155 Sep 20165 Sep 2017
763chimneycarealtoona.comTucows Domains Inc.2 Sep 20106 Sep 20152 Sep 2016
764chimneycleaningnashville.comNameCheap, Inc.10 Nov 202512 Nov 202510 Nov 2026
765chimneysweepsolutions.comHostinger, UAB3 Feb 20253 Feb 20253 Feb 2026
766chimneyspdx.comTucows Domains Inc.3 Sep 20107 Sep 20153 Sep 2016
767chimneycleaningwoodstown.comKey-Systems GmbH6 Sep 20156 Sep 20156 Sep 2016
768chimneysweepvirginia.comDynadot, LLC2 Jan 202414 Mar 20252 Jan 2025
769chimneysweepdiy.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Apr 201520 Apr 201520 Apr 2016
770chimneyserviceguys.comNordreg AB10 Jul 20258 Sep 202510 Jul 2026
771chimneyrepairdiy.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Apr 201520 Apr 201520 Apr 2016
772chimneylinerwarehouse.comTucows Domains Inc.21 Apr 201521 Apr 201521 Apr 2017
773chimneylinerguys.comBeijing Lanhai Jiye Technology Co., Ltd9 Jul 202110 Jul 20239 Jul 2024
774chimneyflueguys.comGoDaddy.com, LLC21 Apr 20153 Jul 202521 Apr 2025
775chimneyweb.comGMO Internet Inc.23 Jan 201910 Jun 202523 Jan 2029
776chimneysturrets.comGoDaddy.com, LLC24 Apr 201524 Apr 201524 Apr 2016
777chimneyservicesanmarcos.comregister.com, Inc.24 Apr 201525 Apr 202524 Apr 2026
778chimneyscafe.comGoDaddy.com, LLC31 Dec 201831 Dec 201831 Dec 2020
779chimneylinerwholesale.comTucows Domains Inc.25 Apr 201511 Jun 201525 Apr 2016
780chimneylinersuperstore.comTucows Domains Inc.25 Apr 201525 Apr 201525 Apr 2016
781chimneylinerresource.comTucows Domains Inc.26 Apr 201526 Apr 201526 Apr 2017
782chimneysweepnorthampton.comMesh Digital Limited27 Apr 201512 Sep 202427 Apr 2026
783chimneyfixers.comGoDaddy.com, LLC27 Apr 201528 Apr 202527 Apr 2026
784chimneyfranchise.name----
785chimneycretellc.comNetwork Solutions, LLC28 Apr 201528 Apr 201528 Apr 2016
786chimneysweep-oh.comregister.com, Inc.29 Apr 201529 Apr 201529 Apr 2016
787chimneysweepmeath.comeNom, Inc.8 Sep 20158 Sep 20158 Sep 2016
788chimneypotsbandb.comNetwork Solutions, LLC29 Apr 201529 Apr 201529 Apr 2018
789chimneysweepinwearenh.comeNom, Inc.1 May 20152 Apr 20161 May 2018
790chimneyclinicerie.comregister.com, Inc.1 May 20151 May 20151 May 2016
791chimneysweeper.infoNamesilo, LLC12 Apr 202212 Apr 202312 Apr 2024
792chimneymanllc.comGoogle, Inc.5 May 20156 May 20255 May 2026
793chimneydoctor-tx.com----
794chimneysweeplincolnshire.neteNom, Inc.5 May 201521 Apr 20175 May 2019
795chimneyrockdevelopment.comNetwork Solutions, LLC6 May 20156 May 20156 May 2016
796chimneyinstallandrepair.comTucows Domains Inc.3 May 20147 May 20153 May 2016
797chimneysweeplincolnshire.orgeNom, Inc.5 May 201524 Apr 20175 May 2019
798chimneybird.comGoDaddy.com, LLC4 Feb 20254 Feb 20254 Feb 2026
799chimneysweepinphiladelphiapa.comNameCheap, Inc.8 May 20158 Apr 20198 May 2020
800chimneywallofshame.comGoDaddy.com, LLC10 Sep 201510 Sep 201510 Sep 2016
801chimneyservicesspanaway.comGoDaddy.com, LLC10 Sep 201529 Aug 202510 Sep 2026
802chimneylinerslondon.comDropCatch.com 1417 LLC28 Nov 201728 Nov 201728 Nov 2018
803chimneyinstallationlondon.comDropCatch.com 1399 LLC28 Nov 201728 Nov 201728 Nov 2018
804chimneydoctorindy.comeNom, Inc.10 Sep 201510 Sep 201510 Sep 2016
805chimneyproindiana.comNamesilo, LLC21 Jun 202421 Jun 202521 Jun 2026
806chimneycleaningdesmoines.comInterweb Advertising D.B.A. Profile Builder9 May 20159 May 20159 May 2016
807chimneyrockbedandbreakfast.comGoogle, Inc.11 May 201511 May 201511 May 2016
808chimneyrockbedandbreakfast.orgGoogle, Inc.11 May 201511 May 201511 May 2016
809chimneyrockbedandbreakfast.netGoogle, Inc.11 May 201511 May 201511 May 2016
810chimneysweepknoxville.comTucows Domains Inc.8 Sep 201012 Sep 20158 Sep 2016
811chimneyrepairssussex.comMesh Digital Limited14 May 201514 May 201514 May 2016
812chimneyair.comTucows Domains Inc.10 Nov 202510 Nov 202510 Nov 2026
813chimneycleaningmobilewebsites.comFabulous.com Pty Ltd.16 May 201527 Jun 201716 May 2018
814chimneysinthed.comGoDaddy.com, LLC18 May 201518 May 201518 May 2016
815chimneyforce.comPDR Ltd. d/b/a PublicDomainRegistry.com17 May 201517 May 201517 May 2016
816chimneyairforce.comPDR Ltd. d/b/a PublicDomainRegistry.com17 May 201517 May 201517 May 2016
817chimneynductpro.comGoDaddy.com, LLC12 Sep 201512 Sep 201512 Sep 2016
818chimneys-manor.com1&1 Internet AG18 May 201518 May 201518 May 2016
819chimneycleaningpiscataway.comGoDaddy.com, LLC20 May 201520 May 202520 May 2026
820chimneyrepairinshelbytownshipmi.comeNom, Inc.22 May 201522 May 201522 May 2016
821chimneybrewing.comDropCatch.com 554 LLC9 Aug 20189 Aug 20189 Aug 2019
822chimneysweepsmatlock.comHosting Concepts B.V. dba Openprovider9 Aug 20199 Aug 20199 Aug 2020
823chimneysweepderby.comNamesilo, LLC9 Jun 20199 Jun 20199 Jun 2020
824chimneyservicecolumbus.comTucows Domains Inc.20 May 201124 May 201720 May 2017
825chimneyjoetn.comTucows Domains Inc.22 May 201226 May 201522 May 2016
826chimneycamera.com1&1 Internet AG26 May 201527 May 201626 May 2018
827chimneysweepsdorset.comNetistrar Limited27 May 201527 May 202527 May 2026
828chimneylinerservices.comGoDaddy.com, LLC27 May 201527 May 201527 May 2017
829chimneys.xyzNamesilo, LLC25 Nov 202525 Nov 202525 Nov 2026
830chimneyappt.comGoDaddy.com, LLC15 Sep 201515 Sep 202515 Sep 2026
831chimneymasterandfireplace.comTucows Domains Inc.28 May 20151 Jun 201728 May 2017
832chimneylinersdirect.comeNom, Inc.28 May 201514 May 201728 May 2018
833chimneysweepingingreenvillesc.comeNom, Inc.29 May 201528 Apr 201629 May 2018
834chimneybrewingcompany.comGoDaddy.com, LLC30 May 201530 May 201530 May 2016
835chimneysavior.comTucows Domains Inc.27 May 201431 May 201527 May 2016
836chimneyrepairchicago.comGoDaddy.com, LLC30 May 201531 May 202530 May 2027
837chimneyliners101.comTucows Domains Inc.31 May 201531 May 201531 May 2017
838chimneycleaningchicago.comGoDaddy.com, LLC30 May 201531 May 202530 May 2027
839chimneysweepinsanantoniotx.comeNom, Inc.15 Sep 201514 Aug 201615 Sep 2017
840chimneyswiftsct.comGoDaddy.com, LLC3 Jun 20153 Jun 20153 Jun 2016
841chimneyrepair.bizPDR Ltd. d/b/a PublicDomainRegistry.com19 Aug 201619 Aug 201618 Aug 2017
842chimneycleaningreality.comTucows Domains Inc.1 Jun 20125 Jun 20151 Jun 2016
843chimneyliner.netGoDaddy.com, LLC3 May 20204 May 20253 May 2026
844chimneycakes.netGoDaddy.com, LLC16 Sep 201516 Sep 201516 Sep 2016
845chimneyrockvillage.orgDNC Holdings, Inc.4 Jun 20154 Jul 20174 Jun 2018
846chimneycleaningreality.netTucows Domains Inc.1 Jun 20125 Jun 20151 Jun 2016
847chimneysweping.comTucows Domains Inc.3 Jun 20147 Jun 20153 Jun 2016
848chimneyvent.bizeNom, Inc.8 Jun 201511 Mar 20177 Jun 2017
849chimneysvce.comGoDaddy.com, LLC8 Jun 20158 Jun 20158 Jun 2016
850chimneyrockhunting.comGoDaddy.com, LLC8 Jun 20158 Jun 20158 Jun 2018
851chimneyrockgamecarts.comGoDaddy.com, LLC17 Sep 202117 Sep 202117 Sep 2022
852chimneyrockenterprises.comDropCatch.com 985 LLC26 Aug 202126 Aug 202126 Aug 2022
853chimneyswiftchimneysweeps.comWild West Domains, LLC9 Jun 20159 Jun 20159 Jun 2016
854chimneysweepingkc.comGoDaddy.com, LLC9 Jun 20159 Jun 20159 Jun 2016
855chimneycontractorwalden.comName.com, Inc.17 Sep 201517 Sep 201517 Sep 2016
856chimneysplusmn.comNameKing.com Inc.29 Aug 201617 Aug 201729 Aug 2018
857chimneyrecs.comGoDaddy.com, LLC12 Jun 201524 Jul 202412 Jun 2024
858chimneyproblems.comGoDaddy.com, LLC15 Sep 199911 Sep 202515 Sep 2026
859chimneydoctorok.comTucows Domains Inc.11 Jun 200827 May 202511 Jun 2026
860chimneybakeryonline.comGoDaddy.com, LLC14 Jun 201514 Jun 201514 Jun 2016
861chimneybakery.comGoDaddy.com, LLC14 Jun 201526 Jul 202414 Jun 2024
862chimneyserviceinprospectparknj.comeNom, Inc.15 Jun 201515 Jun 201515 Jun 2016
863chimneyrepairlondon.comMesh Digital Limited16 Jun 201524 Jun 201816 Jun 2018
864chimneylogs.comGoDaddy.com, LLC27 Oct 202424 Oct 202527 Oct 2026
865chimneycleaninglogs.comLaunchpad, Inc.13 Oct 201713 Oct 201713 Oct 2018
866chimneycleaninglog.comTucows Domains Inc.13 Jun 200217 Jun 201713 Jun 2017
867chimneyrepairhub.xyzUniregistrar Corp19 Sep 201519 Sep 201519 Sep 2016
868chimneylinersupplies.comPSI-USA, Inc. dba Domain Robot18 Jun 201519 Jun 201718 Jun 2018
869chimneyengineering.comGoDaddy.com, LLC5 Sep 20256 Sep 20255 Sep 2026
870chimneyridgecoa.comGoDaddy.com, LLC18 Jun 201518 Jun 201518 Jun 2017
871chimneygeeks.comWebfusion Ltd.18 Jun 201519 Jun 202518 Jun 2026
872chimneychasecovertoledo.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Jun 201521 Jun 201521 Jun 2016
873chimneyinstallerlongbeachny.comeNom, Inc.21 Sep 201521 Sep 201521 Sep 2016
874chimneycleaningofallonil.comGoDaddy.com, LLC21 Sep 201521 Sep 201521 Sep 2016
875chimneysofbaltimore.comeNom, Inc.23 Jun 201525 May 201723 Jun 2018
876chimneycakeexpress.comRealtime Register B.V.22 Jun 201522 Jun 201522 Jun 2016
877chimneyrepairsofmacomb.netTucows Domains Inc.23 Jun 201527 Jun 201723 Jun 2017
878chimneyprofits.comGoDaddy.com, LLC25 Jun 201525 Jun 201525 Jun 2016
879chimneymagician.comGoDaddy.com, LLC25 Jun 201525 Jun 201525 Jun 2016
880chimneycode.comGoDaddy.com, LLC26 Jan 202126 Jan 202526 Jan 2026
881chimneysweepwinchester.comGoDaddy.com, LLC22 Sep 201522 Sep 201522 Sep 2016
882chimneysweepfarnham.comCloudFlare, Inc.28 Apr 20227 Jun 202528 Apr 2025
883chimneysweepatlanta.orgGoDaddy.com, LLC22 Sep 201522 Sep 201522 Sep 2016
884chimneyservicesbelair.comTucows Domains Inc.19 Sep 201123 Sep 201519 Sep 2016
885chimneysweeptopekaks.comGoDaddy.com, LLC25 Sep 202025 Sep 202025 Sep 2021
886chimneyflashing.orgGoDaddy.com, LLC25 Jun 201525 Jun 201525 Jun 2016
887chimneylog.comGoDaddy.com, LLC2 Jul 20233 Jul 20252 Jul 2026
888chimneyheatsaver.comRegister.it SPA28 Jun 201528 Jun 201528 Jun 2016
889chimneyrockgr.orgFastDomain Inc.28 Jun 201518 Jun 202528 Jun 2026
890chimneysweptclean.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Jun 201530 Jun 201530 Jun 2016
891chimneysweepsite.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Jun 201530 Jun 201530 Jun 2016
892chimneysweepongar.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Jun 201530 Jun 201530 Jun 2016
893chimneysweepmaldon.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Jun 201530 Jun 201530 Jun 2016
894chimneysguesthouse.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Jun 201530 Jun 201530 Jun 2016
895chimneyrockrentals.comDynadot, LLC18 May 202518 May 202518 May 2026
896chimneychiefs.comNetwork Solutions, LLC23 Sep 201524 Aug 202523 Sep 2026
897chimneysweepmasonry.comWild West Domains, LLC24 Sep 201524 Sep 201524 Sep 2016
898chimneysweep-inspection.comeNom, Inc.25 Sep 201525 Sep 201525 Sep 2016
899chimneydoctorinc.comDropCatch.com 908 LLC13 Dec 201713 Dec 201713 Dec 2018
900chimneyheights.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Mar 202328 Sep 202421 Mar 2026
901chimneycleaninginparamusnj.comNameCheap, Inc.6 Jul 20156 Jun 20256 Jul 2026
902chimneyfluelining.comMesh Digital Limited4 Apr 201712 Apr 20184 Apr 2018
903chimneycleaninginramseynj.comeNom, Inc.7 Jul 201510 Jul 20177 Jul 2017
904chimneystack.orgRegister.it SPA12 Feb 202116 Feb 202512 Feb 2026
905chimneysweepnova.comTucows Domains Inc.24 Jun 202424 Jun 202424 Jun 2025
906chimneystacks.comTurnCommerce, Inc. DBA NameBright.com14 Dec 20188 Dec 202014 Dec 2025
907chimneystackmedia.comeNom, Inc.25 Sep 201531 Jul 201725 Sep 2017
908chimneystackdesign.comNameCheap, Inc.31 Aug 20201 Sep 202431 Aug 2025
909chimneystack.neteNom, Inc.25 Sep 201531 Jul 201725 Sep 2017
910chimneyservicewhitehouse.comGoDaddy.com, LLC25 Sep 201525 Sep 201525 Sep 2016
911chimneyrockcrossfit.comGoDaddy.com, LLC9 Jul 201510 Jul 20259 Jul 2027
912chimneysweephartford.comNameCheap, Inc.2 Dec 20253 Dec 20252 Dec 2026
913chimneysweepdirect.comCloudFlare, Inc.4 Oct 20244 Sep 20254 Oct 2026
914chimneyheroes.comDreamHost, LLC10 Jul 20159 Jun 202510 Jul 2026
915chimneyhero.comDreamHost, LLC10 Jul 20159 Jun 202510 Jul 2026
916chimneysmith.netTucows Domains Inc.26 Sep 201128 Aug 202526 Sep 2026
917chimney123.comGoDaddy.com, LLC12 Sep 202224 Oct 202312 Sep 2023
918chimneysweepmillionaires.comGoDaddy.com, LLC12 Jul 201523 Sep 202412 Jul 2024
919chimneysweepmillionaire.comGoDaddy.com, LLC12 Jul 201523 Sep 202412 Jul 2024
920chimneyhillestateinn.comZoomRegistrar LLC12 Jul 201513 Jul 201712 Jul 2018
921chimneykingcleaning.comGoDaddy.com, LLC13 Jul 201513 Jul 201513 Jul 2016
922chimneychina.comWest263 International Limited14 Jul 201514 Jul 201514 Jul 2018
923chimneycat.comHiChina Zhicheng Technology Limited15 Jul 201517 Jul 201715 Jul 2017
924chimneyandfireplacealachua.comeNom, Inc.15 Jul 201515 Jul 201515 Jul 2016
925chimneysbandb.comeNom, Inc.27 Sep 201527 Sep 201527 Sep 2016
926chimneysandmasoncontractors.comTucows Domains Inc.24 Sep 201128 Sep 201524 Sep 2016
927chimneysweep.usGoogle, Inc.5 Sep 201926 Aug 20255 Sep 2026
928chimneyvictoria.netLaunchpad, Inc.29 Sep 201519 Sep 201629 Sep 2017
929chimneysweepscheshire.comMesh Digital Limited21 Jul 201522 Jul 201521 Jul 2016
930chimneyrepairssurrey.comPDR Ltd. d/b/a PublicDomainRegistry.com25 May 20216 Jul 202325 May 2023
931chimneysweepersofny.comFastDomain Inc.24 Jul 20159 Jul 202524 Jul 2026
932chimneysupplycom.comGoDaddy.com, LLC24 Jul 201524 Jul 201524 Jul 2016
933chimneysweeppreston.comTucows Domains Inc.29 Sep 20156 Oct 202129 Sep 2021
934chimneyzone.com-21 Nov 202521 Nov 202521 Nov 2026
935chimneysweepersny.comGoDaddy.com, LLC25 Jul 201526 Jul 202425 Jul 2026
936chimneysweepersllc.comGoDaddy.com, LLC25 Jul 201526 Jul 202425 Jul 2026
937chimneycleaningg.comGoDaddy.com, LLC27 Jul 201527 Jul 201527 Jul 2016
938chimneysweepers.xyzNameCheap, Inc.30 Sep 201530 Sep 201530 Sep 2016
939chimneysweepssacramento.comName.com, Inc.30 Sep 20151 Oct 201530 Sep 2016
940chimneysweepsalinas.comGoogle, Inc.1 Oct 201516 Sep 20251 Oct 2026
941chimneys.newsGoDaddy.com, LLC30 Sep 201510 Jan 201730 Sep 2018
942chimneychunga.comDropCatch.com 402 LLC18 Dec 201619 Dec 201718 Dec 2017
943chimneysweepalgarve.comTucows Domains Inc.28 Jul 201513 Jul 202528 Jul 2026
944chimneysafe1.comNetwork Solutions, LLC28 Jul 201528 Jun 202428 Jul 2027
945chimney-germany.comMesh Digital Limited28 Jul 20151 Jul 201728 Jul 2018
946chimneysweepeastbourne.comWebfusion Ltd.1 Oct 201524 Sep 20171 Oct 2018
947chimneysweepcolchester.comWebfusion Ltd.1 Oct 201524 Sep 20181 Oct 2019
948chimneysweepbacup.comWebfusion Ltd.1 Oct 201524 Sep 20171 Oct 2018
949chimneysrx.comTucows Domains Inc.1 Oct 20152 Sep 20251 Oct 2026
950chimneyinspectors.netTucows Domains Inc.28 Jul 201528 Jul 202528 Jul 2026
951chimneyrepairsguildford.comTucows Domains Inc.28 Nov 20192 Dec 202128 Nov 2021
952chimneysweepandfireplacecleaning.comTucows Domains Inc.28 Jul 20141 Aug 201528 Jul 2016
953chimneyrockhemp.com-18 Oct 202518 Oct 202518 Oct 2026
954chimneydrdecatur.comTucows Domains Inc.29 Jul 20102 Aug 201529 Jul 2016
955chimneypotcowls.comGoDaddy.com, LLC2 Aug 20152 Aug 20152 Aug 2016
956chimneysweepingsussex.comMesh Digital Limited3 Aug 20153 Aug 20153 Aug 2016
957chimneyrockspa.comGoDaddy.com, LLC3 Aug 20153 Aug 20153 Aug 2017
958chimneysweepladeraranch.comName.com, Inc.2 Oct 20152 Oct 20152 Oct 2016
959chimneysweepvictoriabc.comGoDaddy.com, LLC5 Aug 20155 Aug 20155 Aug 2017
960chimneyrockmtg.comGoDaddy.com, LLC4 Aug 201527 Nov 20244 Aug 2027
961chimneytekirl.comNetwork Solutions, LLC5 Aug 20155 Aug 20155 Aug 2017
962chimneycover.orgDomain.com, LLC6 Aug 20152 Aug 20166 Aug 2017
963chimneysweeprichmond.comGoDaddy.com, LLC4 Oct 20154 Oct 20254 Oct 2035
964chimneybuilder.comGoDaddy.com, LLC6 Aug 20216 Aug 20256 Aug 2026
965chimneysaversolutions.comGoDaddy.com, LLC13 Apr 200514 Apr 202413 Apr 2026
966chimneytang.comGoDaddy.com, LLC9 Aug 20159 Aug 20159 Aug 2017
967chimneyspecialist.netTucows Domains Inc.5 Aug 20109 Aug 20155 Aug 2016
968chimneydoctorinc.netTucows Domains Inc.5 Aug 20109 Aug 20155 Aug 2016
969chimneyfactory.comGoDaddy.com, LLC15 Jan 202026 Feb 202515 Jan 2026
970chimneycleanersfentonmo.net-10 Aug 201510 Aug 201510 Aug 2017
971chimneypedia.comWebfusion Ltd.4 Oct 201527 Sep 20164 Oct 2017
972chimneysrxnj.comTucows Domains Inc.5 Oct 20156 Sep 20255 Oct 2026
973chimneycincinnati.comeNom, Inc.5 Oct 20155 Oct 20155 Oct 2016
974chimneysweepsinwaldenny.comNameCheap, Inc.6 Oct 20156 Sep 20226 Oct 2023
975chimneysweepsdelaware.comNetwork Solutions, LLC6 Oct 20154 Oct 20166 Oct 2017
976chimneypark.orgGoDaddy.com, LLC6 Oct 20157 Oct 20256 Oct 2026
977chimney-park.orgGoDaddy.com, LLC6 Oct 20157 Oct 20256 Oct 2026
978chimneysweep-inspection.orgNetwork Solutions, LLC7 Oct 20157 Oct 20157 Oct 2016
979chimneysweepkettering.comDropCatch.com 457 LLC8 Nov 20188 Nov 20188 Nov 2019
980chimneyinstallerslondon.comWebfusion Ltd.8 Oct 20151 Oct 20188 Oct 2019
981chimneywicked.comeNom, Inc.9 Oct 20159 Oct 20159 Oct 2016
982chimneysweepmayo.comTucows Domains Inc.12 Oct 201516 Oct 201912 Oct 2021
983chimney-cake.xyzHostinger, UAB14 Oct 201514 Oct 201514 Oct 2016
984chimneysweepsingrandrapidsmi.comeNom, Inc.15 Oct 201515 Oct 201515 Oct 2016
985chimneysweepboiseidaho.comTucows Domains Inc.12 Oct 201116 Oct 201512 Oct 2016
986chimneysweep.feedbackReserved for non-billable transactions where Regis…15 Oct 201516 Oct 202515 Oct 2026
987chimneyrepair.feedbackReserved for non-billable transactions where Regis…15 Oct 201516 Oct 202515 Oct 2026
988chimneyintegrity.comXiamen Nawang Technology Co., Ltd18 Jul 202329 Jun 202518 Jul 2026
989chimneycaps.feedbackReserved for non-billable transactions where Regis…15 Oct 201516 Oct 202515 Oct 2026
990chimneysofoakcreek.comDropCatch.com 1514 LLC30 Oct 202130 Oct 202130 Oct 2022
991chimneysweepmaidstone.com1&1 Internet AG16 Oct 20156 Mar 201816 Oct 2026
992chimneyhub.comGoDaddy.com, LLC14 Dec 202031 May 202514 Dec 2025
993chimneyprosco.comGoDaddy.com, LLC21 Oct 202521 Oct 202521 Oct 2026
994chimneysweeplancasterpa.comWild West Domains, LLC21 Oct 201521 Oct 201521 Oct 2016
995chimneycapnj.comeNom, Inc.21 Oct 201521 Oct 201521 Oct 2016
996chimney4santa.comGoDaddy.com, LLC21 Oct 201521 Oct 201521 Oct 2016
997chimneyinspections.infoGoDaddy.com, LLC6 Jul 20187 Jul 20196 Jul 2020
998chimneyproductsinc.comGoDaddy.com, LLC23 Oct 201512 Sep 202423 Oct 2027
999chimneyhillohio.comGoDaddy.com, LLC23 Oct 201524 Oct 202523 Oct 2027
1000chimneygroup.filmName.com, Inc.23 Oct 20155 Dec 202423 Oct 2024

Displaying 1,000 out of 16,087 domains starting with the keyword "CHIMNEY". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=chimney

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now