Our database now contains whois records of 688 Million (688,890,462) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1596 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [688 Million Domains] $10,000 Details

Keyword: BREAKFASTS

Reverse Whois » KEYWORD [breakfasts ]  { 665 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1breakfasts.nycHello Internet Corp.9 Nov 20144 Sep 20228 Nov 2023
2breakfasts.mobiGoDaddy.com, LLC1 May 20151 May 20151 May 2016
3breakfasts.infoArsys Internet, S.L. dba NICLINE.COM5 Feb 202110 Feb 20265 Feb 2027
4breakfasts.xyzGoDaddy.com, LLC27 Apr 202424 Dec 202527 Apr 2027
5breakfasts.linkUniregistrar Corp8 Dec 20158 Dec 20158 Dec 2016
6breakfasts.comNameCheap, Inc.19 Apr 199721 May 202520 Apr 2026
7breakfasts.clickGMO Internet Inc.24 Apr 20164 Jun 201724 Apr 2017
8breakfasts.vip-20 May 201620 May 201620 May 2017
9breakfasts.guruGoDaddy.com, LLC12 Feb 201428 Mar 201612 Feb 2017
10breakfasts.topWest263 International Limited26 Jan 202310 Mar 202426 Jan 2024
11breakfasts.bizGoDaddy.com, LLC4 Jan 201126 Jan 20173 Jan 2018
12breakfasts.orgGoDaddy.com, LLC5 Mar 20245 Mar 20265 Mar 2027
13breakfasts.usUniregistrar Corp20 Oct 201625 Oct 201719 Oct 2017
14breakfasts.netDropCatch.com 1379 LLC1 May 20261 May 20261 May 2027
15breakfasts.winAlpnames Limited13 Jan 201713 Jan 201812 Jan 2018
16breakfasts.co.uk-11 Feb 20001 May 202611 Feb 2027
17breakfasts.coffeeName.com, Inc.9 Mar 20182 May 20189 Mar 2019
18breakfasts.kitchenName.com, Inc.9 Mar 201823 Apr 20209 Mar 2021
19breakfasts.solutionsName.com, Inc.24 Jun 201929 Jun 201924 Jun 2020
20breakfasts.uk-14 Mar 20197 Feb 202614 Mar 2026
21breakfasts.todayGMO Internet Inc.30 Jun 202030 Jun 202030 Jun 2021
22breakfasts.siteGMO Internet Inc.9 Apr 202510 Apr 20269 Apr 2027
23breakfasts.onlineNetwork Solutions, LLC6 May 20266 May 20266 May 2027
24breakfasts.proPorkbun, LLC26 Jan 20238 Mar 202426 Jan 2024
25breakfasts.it-30 Mar 20101 May 202630 Apr 2026
26breakfasts.livePorkbun, LLC13 Nov 202216 Feb 202413 Nov 2025
27breakfasts.shopGMO Internet Inc.27 Dec 20171 Feb 202427 Dec 2024
28breakfasts.buzzNamesilo, LLC1 Feb 20247 Mar 20251 Feb 2025
29breakfasts.monsterNamesilo, LLC1 Feb 20246 Apr 20251 Feb 2025
30breakfasts.nl-2 Sep 201421 Apr 2026-
31breakfasts.worldMesh Digital Limited18 Jun 202423 Jun 202418 Jun 2026
32breakfasts.com.au--2 Nov 2025-
33breakfastsalad.comGoDaddy.com, LLC3 Jan 20186 Jan 20263 Jan 2028
34breakfaststation.comGoDaddy.com, LLC11 Apr 200913 Apr 202611 Apr 2027
35breakfastsnack.comAzdomainz LLC16 Jun 201617 Jun 202516 Jun 2026
36breakfastshoppe-hub.comGoDaddy.com, LLC28 Oct 201428 Oct 201428 Oct 2015
37breakfastsrecipes.infoGoDaddy.com, LLC27 Jul 201329 Jan 201527 Jul 2015
38breakfastsausages.comGoDaddy.com, LLC1 Nov 20071 Nov 20251 Nov 2026
39breakfaststix.comGoDaddy.com, LLC10 Jul 201026 Jun 201510 Jul 2016
40breakfastservices.comTierraNet Inc. d/b/a DomainDiscover17 Jan 201616 Jan 201717 Jan 2018
41breakfaststpetebeach.comPDR Ltd. d/b/a PublicDomainRegistry.com23 May 201226 Feb 202523 May 2026
42breakfastsandwichcookbook.comGoDaddy.com, LLC16 May 201616 May 201616 May 2017
43breakfastsmoothie.infoGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
44breakfastspots.comDropCatch.com 405 LLC26 Aug 20148 Sep 202026 Aug 2029
45breakfastsaratoga.comGoDaddy.com, LLC13 Aug 201413 Aug 201413 Aug 2015
46breakfaststories.com1&1 Internet AG15 Nov 202016 Nov 202515 Nov 2026
47breakfastshack.comGo Canada Domains, LLC10 Nov 201411 Nov 202510 Nov 2026
48breakfastspend.comeNom, Inc.15 Sep 201415 Sep 201415 Sep 2015
49breakfastshed.comPorkbun, LLC12 Sep 202428 Sep 202512 Sep 2026
50breakfaststeak.comVitalwerks Internet Solutions, LLC DBA No-IP8 Oct 201426 Sep 20189 Oct 2021
51breakfastsqueeze.comGoDaddy.com, LLC3 May 202413 Jun 20253 May 2025
52breakfastsmiles.comGoogle, Inc.2 Sep 201528 Dec 20242 Sep 2027
53breakfastsbest.comNameCheap, Inc.31 Mar 20221 Apr 202331 Mar 2024
54breakfastschaumburg.comGoDaddy.com, LLC27 Nov 201427 Nov 201427 Nov 2016
55breakfastsbeds.comGoDaddy.com, LLC23 Dec 202123 Dec 202123 Dec 2022
56breakfastsoup.comPorkbun, LLC27 Aug 202527 Aug 202527 Aug 2030
57breakfastsmaker.comGoDaddy.com, LLC11 Dec 201412 Dec 201611 Dec 2017
58breakfastsmoothies.infoeNom, Inc.30 Dec 201430 Dec 201430 Dec 2015
59breakfastsec.infoGoDaddy.com, LLC3 Jan 20154 Jan 20153 Jan 2016
60breakfastsmoothie.dietUniregistrar Corp31 Jan 201531 Jan 201531 Jan 2016
61breakfastscope.comGoDaddy.com, LLC16 Aug 201516 Aug 201516 Aug 2016
62breakfastsolution.netGoDaddy.com, LLC20 Jan 201520 Jan 201520 Jan 2016
63breakfastsolution.infoGoDaddy.com, LLC20 Jan 2015-20 Jan 2016
64breakfastsolution.orgGoDaddy.com, LLC20 Jan 201520 Jan 201520 Jan 2016
65breakfastshop.org1&1 Internet AG27 Jan 201522 Mar 201727 Jan 2018
66breakfastscout.comCloudFlare, Inc.2 Apr 20253 Mar 20262 Apr 2027
67breakfastsounds.comGoDaddy.com, LLC14 Feb 201514 Feb 201514 Feb 2016
68breakfastsandwichblog.comGoDaddy.com, LLC23 Aug 201524 Aug 202523 Aug 2026
69breakfastshanghai.comNameCheap, Inc.17 Jun 202129 Aug 202517 Jun 2025
70breakfastsandwichrecipes.comName.com, Inc.25 Aug 201526 Aug 201525 Aug 2016
71breakfastshowmasterclass.comAscio Technologies, Inc. Danmark - Filial af Ascio…17 Mar 201517 Mar 201517 Mar 2017
72breakfastspecials.comAnnulet LLC25 Feb 200710 Feb 202625 Feb 2027
73breakfastsmokies.comGoDaddy.com, LLC24 Mar 201524 Mar 201524 Mar 2016
74breakfastsociety.orgeNom, Inc.29 Mar 201513 Mar 201729 Mar 2018
75breakfastshoeco.comGoogle, Inc.1 Sep 20151 Sep 20151 Sep 2016
76breakfastsinbed.comPorkbun, LLC9 Mar 202521 Mar 20269 Mar 2027
77breakfastshoes.comGoDaddy.com, LLC22 Jul 202125 Jul 202522 Jul 2027
78breakfastscramble.comGoDaddy.com, LLC9 May 20159 May 20159 May 2016
79breakfastshake.comGoDaddy.com, LLC9 Aug 201630 Aug 20259 Aug 2026
80breakfastservedcold.comTucows Domains Inc.20 May 201024 May 201720 May 2017
81breakfastsandmore.comGoDaddy.com, LLC25 Jun 20216 Aug 202425 Jun 2024
82breakfastseries.comSquarespace Domains LLC29 Jun 202214 Jun 202529 Jun 2026
83breakfastsales.comNameCheap, Inc.5 Nov 2021-5 Nov 2022
84breakfastsmoothiesforweightloss.comFabulous.com Pty Ltd.7 Jun 20159 Jul 20177 Jun 2018
85breakfaststore53.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Jun 201521 Jun 201711 Jun 2018
86breakfastsmoothies.orgGoDaddy.com, LLC9 Jun 201510 Jun 20169 Jun 2017
87breakfastsundae.comGoDaddy.com, LLC30 Aug 20196 Feb 202530 Aug 2029
88breakfaststash.comeNom, Inc.14 Jun 201514 Jun 201514 Jun 2016
89breakfaststationpr.comFastDomain Inc.16 Jun 201516 Jun 201516 Jun 2016
90breakfastsystem.comFastDomain Inc.23 Jun 20158 Jun 201923 Jun 2020
91breakfastsoftware.comGoogle, Inc.9 Oct 20168 Nov 20179 Oct 2017
92breakfastshackny.com-4 Oct 20254 Oct 20254 Oct 2026
93breakfastsitter.com1&1 Internet AG11 Jul 201511 Jul 201511 Jul 2016
94breakfastsnaps.comGoDaddy.com, LLC23 Jul 201523 Jul 201523 Jul 2016
95breakfastsocial.comGoDaddy.com, LLC26 Jul 201519 Sep 202226 Jul 2027
96breakfastsex.comGoDaddy.com, LLC27 Jul 201515 Jan 202614 Jan 2027
97breakfastswapping.com1&1 Internet AG3 Aug 20154 Aug 20163 Aug 2017
98breakfastsuperheroes.com1&1 Internet AG6 Aug 20156 Aug 20156 Aug 2016
99breakfastsandwichnearme.comFastDomain Inc.9 Feb 202224 Apr 20269 Feb 2026
100breakfastsandwichmaker.xyzNameCheap, Inc.6 Oct 20156 Oct 20156 Oct 2016
101breakfastselector.comeNom, Inc.19 Oct 201523 Sep 201619 Oct 2017
102breakfaststudio.bizGandi SAS3 Nov 20153 Nov 20152 Nov 2016
103breakfastshot.comGoDaddy.com, LLC17 Jan 202428 Feb 202517 Jan 2025
104breakfastsancarlos.comGoDaddy.com, LLC3 Nov 20154 Nov 20253 Nov 2026
105breakfastsecond.comAscio Technologies, Inc. Danmark - Filial af Ascio…20 Nov 201520 Nov 201520 Nov 2016
106breakfastsessions.comTurnCommerce, Inc. DBA NameBright.com28 Nov 201522 Nov 202028 Nov 2026
107breakfastsnooze.comGoDaddy.com, LLC30 Nov 201530 Nov 201530 Nov 2017
108breakfastsaloon.comGoDaddy.com, LLC28 Dec 201528 Dec 201528 Dec 2016
109breakfastspoon.comDomain-It!, Inc.1 Jan 20161 Jan 20161 Jan 2017
110breakfastsbyoligarsha.comeNom, Inc.2 Jan 20161 Dec 20162 Jan 2018
111breakfaststuffnetwork.comNetwork Solutions, LLC2 Feb 20164 Dec 20252 Feb 2027
112breakfastsforbrains.orgDomainPeople, Inc.7 Feb 20167 Feb 20167 Feb 2017
113breakfastsforbrains.comDomainPeople, Inc.7 Feb 20167 Feb 20167 Feb 2017
114breakfastsantana.comGoogle, Inc.12 Feb 201628 Jan 202612 Feb 2027
115breakfastsantabarbara.comTucows Domains Inc.16 Feb 201620 Feb 201716 Feb 2017
116breakfastserum.comGoDaddy.com, LLC30 Jul 202130 Jul 202130 Jul 2022
117breakfastshed2.comGoDaddy.com, LLC16 Jul 202116 Jul 202116 Jul 2022
118breakfastshowamigos.comLaunchpad, Inc.7 Mar 201620 Feb 20177 Mar 2018
119breakfastsandwichmakerhub.comGoDaddy.com, LLC7 Mar 20167 Mar 20167 Mar 2017
120breakfastschool.comHosting Concepts B.V. dba Openprovider9 Nov 20219 Nov 20219 Nov 2022
121breakfastswithjim.comGoDaddy.com, LLC19 Mar 201619 Mar 201619 Mar 2018
122breakfaststartup.com1&1 Internet AG26 Mar 201622 Feb 201826 Mar 2027
123breakfastsandwich.scienceNameCheap, Inc.31 Mar 201631 Mar 201630 Mar 2017
124breakfastsandwich.reviewNameCheap, Inc.31 Mar 201631 Mar 201630 Mar 2017
125breakfastsandwich.clubNetwork Solutions, LLC29 Sep 202029 Sep 202029 Sep 2021
126breakfastsurprise.comAnnulet LLC2 Apr 201616 May 20252 Apr 2025
127breakfaststockclub.netGoDaddy.com, LLC6 Apr 20166 Apr 20166 Apr 2017
128breakfastskinskeletal.techNameCheap, Inc.18 Apr 201618 Apr 201618 Apr 2017
129breakfastsurreal.comGoogle, Inc.21 Aug 202327 Mar 202421 Aug 2033
130breakfastsolution.comGoDaddy.com, LLC2 Aug 202523 Aug 20252 Aug 2026
131breakfastswim.comGoDaddy.com, LLC16 May 201616 May 201616 May 2017
132breakfastsweat.comGoDaddy.com, LLC26 May 201626 May 201626 May 2018
133breakfastsausagerecipe.comGoDaddy.com, LLC31 May 201631 May 201631 May 2017
134breakfastsorbets.netGoDaddy.com, LLC3 Jun 20163 Jun 20163 Jun 2017
135breakfastsorbets.infoGoDaddy.com, LLC3 Jun 20163 Jun 20163 Jun 2017
136breakfastsorbets.comGoDaddy.com, LLC3 Jun 20163 Jun 20163 Jun 2017
137breakfastsorbet.comGoDaddy.com, LLC3 Jun 20163 Jun 20163 Jun 2017
138breakfastsorbets.orgGoDaddy.com, LLC3 Jun 20163 Jun 20163 Jun 2017
139breakfastsmoothiesforkids.xyzUniregistrar Corp1 Jun 201623 Sep 20161 Jun 2017
140breakfastspotgo.comGoDaddy.com, LLC10 Jun 201610 Jun 201610 Jun 2017
141breakfastsandwichsettlement.comGoDaddy.com, LLC30 Sep 201930 Sep 201930 Sep 2020
142breakfastsf.comWild West Domains, LLC23 Feb 202623 Feb 202623 Feb 2027
143breakfastsupplement.comGoDaddy.com, LLC29 Jun 201630 Jun 201729 Jun 2018
144breakfastsoft.com-9 Mar 202311 May 20249 Mar 2024
145breakfaststartup.info1&1 Internet AG5 Jul 201622 Aug 20175 Jul 2018
146breakfastshote.xyzGMO Internet Inc.7 Jun 201629 Jul 20167 Jun 2017
147breakfastsdaba.xyzGMO Internet Inc.7 Jun 201629 Jul 20167 Jun 2017
148breakfastservedallday.bizGoDaddy.com, LLC29 Jan 200720 Jun 201728 Jan 2018
149breakfastsalads.comNameCheap, Inc.12 Oct 202012 Sep 202512 Oct 2026
150breakfaststore.comCSC Corporate Domains, Inc.10 Dec 19996 Dec 202510 Dec 2027
151breakfaststout.comUniregistrar Corp---
152breakfaststory.comGoDaddy.com, LLC5 Aug 20135 Aug 20255 Aug 2026
153breakfastseattle.comGoDaddy.com, LLC11 Sep 202511 Sep 202511 Sep 2026
154breakfastsquad.comGoDaddy.com, LLC23 Aug 199924 Aug 202523 Aug 2027
155breakfastsmoothierecipes.comNameCheap, Inc.17 Jan 202627 Jan 202617 Jan 2027
156breakfastsushi.comTurnCommerce, Inc. DBA NameBright.com20 Jun 201414 Jun 202020 Jun 2026
157breakfastspecial.comGoDaddy.com, LLC14 Jan 200014 Jul 202513 Jul 2026
158breakfastsnob.comGoDaddy.com, LLC19 Nov 200619 Nov 202519 Nov 2026
159breakfastsyrups.comGoDaddy.com, LLC7 Nov 20168 Nov 20257 Nov 2026
160breakfastshop.comCSC Corporate Domains, Inc.10 Dec 19996 Dec 202510 Dec 2027
161breakfastsineden.comeNom, Inc.19 Nov 20095 Nov 201519 Nov 2016
162breakfastsolutions.comregister.com, Inc.30 Aug 200031 Jul 202530 Aug 2026
163breakfaststudio.comTucows Domains Inc.24 Jun 20093 Nov 202524 Jun 2026
164breakfastshows.comDot Holding Inc.16 Apr 200821 Aug 202416 Apr 2028
165breakfaststicks.comeNom, Inc.8 Aug 200824 Jun 20168 Aug 2018
166breakfastshowmusic.comGoDaddy.com, LLC2 Sep 200918 Aug 20152 Sep 2017
167breakfastsearch.comTurnCommerce, Inc. DBA NameBright.com7 Jun 20191 Jun 20207 Jun 2026
168breakfastsandwichmakerreviews.comGoDaddy.com, LLC21 Dec 201321 Dec 201521 Dec 2016
169breakfastshakesfordogs.comGoDaddy.com, LLC3 Apr 20144 Apr 20163 Apr 2017
170breakfastsanclementedanapointlagunaniguellagunabeachbest.comGoDaddy.com, LLC1 Sep 201031 Aug 20151 Sep 2016
171breakfastsandwichmakerrecipes.comGoDaddy.com, LLC7 Dec 20138 Dec 20157 Dec 2016
172breakfaststockclub.com-22 Jun 201122 Jul 202522 Jun 2026
173breakfastshowseries.comMarkMonitor Inc.8 Nov 201213 Apr 20268 Nov 2026
174breakfastsingles.com1&1 Internet AG9 Apr 200810 Apr 20179 Apr 2018
175breakfaststartshere.comNamespro Solutions Inc.22 Nov 201219 Sep 201722 Nov 2019
176breakfastservedallday.comGoDaddy.com, LLC29 Jan 200730 Jan 202629 Jan 2027
177breakfastsandwiches.comDot Holding Inc.15 Mar 200515 Mar 202615 Mar 2027
178breakfastsmoothie.comDomainAdministration.com, LLC18 Oct 201119 Oct 202518 Oct 2026
179breakfaststay.comCloudFlare, Inc.6 Apr 200716 Mar 20266 Apr 2027
180breakfaststof.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Nov 201516 Jan 201616 Nov 2016
181breakfastskippers.comeNom, Inc.24 Jul 20125 Sep 201724 Jul 2017
182breakfastspot.comTurnCommerce, Inc. DBA NameBright.com14 Apr 20094 Nov 202514 Apr 2026
183breakfastservice.comGoDaddy.com, LLC10 Apr 20077 Apr 202610 Apr 2027
184breakfastshops.comGoDaddy.com, LLC1 Oct 20071 Oct 20151 Oct 2016
185breakfastsmoothiedrink.comWebfusion Ltd.4 Jun 201328 May 20174 Jun 2019
186breakfastswithbuster.com-24 Jan 202626 Jan 202624 Jan 2027
187breakfastspanish.comCronon AG8 Sep 20138 Sep 20138 Sep 2017
188breakfastsandwich.comGoDaddy.com, LLC20 Jan 20222 Jan 202620 Jan 2027
189breakfastsolved.comGoDaddy.com, LLC29 Dec 202415 Dec 202529 Dec 2026
190breakfastsociety.comGoogle, Inc.16 Dec 200516 Dec 202516 Dec 2026
191breakfastspotz.comGoDaddy.com, LLC15 Jan 201416 Jan 201615 Jan 2017
192breakfastsausage.com-2 May 200327 Feb 20262 May 2027
193breakfastshakes.comRabbitsfoot.com LLC d/b/a Oxygen.nyc8 May 200725 Nov 20258 May 2026
194breakfastsandwichmakers.comeNom, Inc.22 Jan 201418 Mar 202622 Jan 2027
195breakfaststop.comGoDaddy.com, LLC19 May 200914 May 202519 May 2026
196breakfastsubs.comregister.com, Inc.21 May 202021 May 202521 May 2026
197breakfastsmoothieshake.comWebfusion Ltd.17 May 201310 May 201717 May 2019
198breakfastshow.comKey-Systems GmbH25 Nov 199830 Nov 202524 Nov 2026
199breakfastsantafestyle.comGoDaddy.com, LLC24 Aug 202124 Aug 202124 Aug 2022
200breakfastsquare.comNamesilo, LLC1 Sep 20082 Sep 20251 Sep 2026
201breakfastshift.comTurnCommerce, Inc. DBA NameBright.com10 Apr 20134 Apr 202110 Apr 2026
202breakfastsaltlakecity.comWild West Domains, LLC14 Oct 201015 Oct 201514 Oct 2016
203breakfastsupplystore.comName.com, Inc.22 Jan 201324 Dec 201522 Jan 2017
204breakfastserial.comNetwork Solutions, LLC31 Mar 200030 Jan 202531 Mar 2028
205breakfastshoppe.comCSC Corporate Domains, Inc.10 Dec 19996 Dec 202510 Dec 2027
206breakfastseminar.comeNom, Inc.1 Sep 20023 Aug 20171 Sep 2018
207breakfastsprinkles.comGoDaddy.com, LLC17 Jan 201018 Jan 202617 Jan 2027
208breakfastsmart.comDomainAdministration.com, LLC6 Nov 201031 Oct 20256 Nov 2026
209breakfastsandwichmaker.comeNom, Inc.7 Feb 202030 Apr 20267 Feb 2027
210breakfastshakesforanimals.comGoDaddy.com, LLC2 Apr 20142 Apr 20162 Apr 2017
211breakfastsforbetterdays.comCSC Corporate Domains, Inc.12 Feb 20138 Feb 202612 Feb 2027
212breakfastseminars.comAnnulet LLC17 Nov 20247 Oct 202517 Nov 2026
213breakfastsupport.comGoDaddy.com, LLC11 Jun 201012 Jun 202511 Jun 2026
214breakfastshortcuts.comName.com, Inc.20 Aug 200831 Jul 201720 Aug 2018
215breakfastserved.comGoogle, Inc.15 Mar 201928 Feb 202615 Mar 2027
216breakfaststrainz.comGoDaddy.com, LLC24 Apr 20145 Jun 202524 Apr 2025
217breakfastsquares.comGoDaddy.com, LLC24 Aug 20091 Nov 20256 Nov 2026
218breakfastsmoothies.comDot Holding Inc.17 Dec 200428 Aug 202417 Dec 2026
219breakfastsanclemente.com-19 Nov 202421 Jan 202619 Nov 2025
220breakfastsammy.com1&1 Internet AG29 Sep 200822 Feb 201829 Sep 2026
221breakfastsnacks.comUniregistrar Corp15 Oct 20071 Nov 202515 Oct 2026
222breakfastsupply.comTurnCommerce, Inc. DBA NameBright.com20 Sep 202320 Sep 202320 Sep 2026
223breakfastset.com-10 Mar 202519 Mar 202610 Mar 2026
224breakfastsyrup.comGoDaddy.com, LLC30 Jul 201431 Jul 202530 Jul 2026
225breakfastshowatnight.comGoDaddy.com, LLC25 Sep 200726 Sep 202425 Sep 2026
226breakfastsunnyside.comNetwork Solutions, LLC17 Feb 201314 Feb 201617 Feb 2017
227breakfastscoop.comGoDaddy.com, LLC9 Nov 20136 Dec 20159 Nov 2017
228breakfastsport.comNameCheap, Inc.10 Mar 200431 Mar 20269 Mar 2027
229breakfaststudios.comGoDaddy.com, LLC23 Apr 202118 Apr 202423 Apr 2033
230breakfastsets.comDynadot, LLC24 Jun 202524 Jun 202524 Jun 2026
231breakfastsauce.comGoDaddy.com, LLC1 Apr 20212 Apr 20261 Apr 2027
232breakfaststobanquets.comTucows Domains Inc.4 Jul 200113 Sep 20244 Jul 2030
233breakfastsampler.comGoDaddy.com, LLC12 Nov 200912 Nov 202512 Nov 2028
234breakfastserials.comNetwork Solutions, LLC31 Mar 200030 Jan 202531 Mar 2028
235breakfastspokane.comNameCheap, Inc.6 May 200818 Jul 20256 May 2025
236breakfastsurfing.comGoDaddy.com, LLC6 Jul 20117 Jul 20166 Jul 2017
237breakfastsandiego.comGoDaddy.com, LLC22 Jan 202522 Jan 202622 Jan 2027
238breakfastsurvey.comTurnCommerce, Inc. DBA NameBright.com13 Jul 20125 Feb 202613 Jul 2026
239breakfaststools.comTurnCommerce, Inc. DBA NameBright.com30 May 20059 Aug 202530 May 2025
240breakfastscienceboard.comGoDaddy.com, LLC6 Jul 20206 Jul 20206 Jul 2021
241breakfaststationcentral.comGoDaddy.com, LLC12 Aug 201618 May 202512 Aug 2031
242breakfastslut.comNameCheap, Inc.23 Jan 202124 Dec 202423 Jan 2026
243breakfastskates.comWeb Commerce Communications Limited dba WebNic.cc11 Nov 202222 Jan 202411 Nov 2023
244breakfastsophy.comTucows Domains Inc.4 Sep 20168 Sep 20184 Sep 2018
245breakfastsophia.comOldTownDomains.com LLC16 Jul 202217 Jul 202216 Jul 2023
246breakfaststock.comBrandsight, Inc.13 Sep 201627 Apr 202613 Sep 2027
247breakfastsc.com-13 Sep 201613 Sep 201613 Sep 2017
248breakfastsbytory.comeNom, Inc.17 Sep 201616 Aug 201717 Sep 2018
249breakfastsettle.comeNom, Inc.19 Sep 20161 Nov 201719 Sep 2017
250breakfaststuff.com-20 Sep 201620 Sep 201620 Sep 2017
251breakfastsandwich.techNameCheap, Inc.21 Sep 201627 Oct 201721 Sep 2017
252breakfastsandwichssettlement.com-23 Sep 201623 Sep 201623 Sep 2017
253breakfastspotter.com-22 Sep 201622 Sep 201622 Sep 2017
254breakfastsauce.rockseNom, Inc.26 Sep 20169 Oct 201726 Sep 2018
255breakfastshake.net-6 Oct 20166 Oct 20166 Oct 2017
256breakfaststyle.us-4 Oct 20164 Oct 20163 Oct 2017
257breakfastsnap.usUniregistrar Corp4 Oct 20164 Oct 20163 Oct 2017
258breakfastsum.us-4 Oct 20164 Oct 20163 Oct 2017
259breakfastscary.us-5 Oct 20165 Oct 20164 Oct 2017
260breakfastseat.usUniregistrar Corp5 Oct 20165 Oct 20164 Oct 2017
261breakfastshort.us-7 Oct 20167 Oct 20166 Oct 2017
262breakfastsprinkles.infoGoDaddy.com, LLC17 Jan 20103 Mar 202617 Jan 2027
263breakfastshakesforanimals.infoGoDaddy.com, LLC2 Apr 20143 Apr 20172 Apr 2018
264breakfastservedallday.infoGoDaddy.com, LLC29 Jan 200720 Jun 201729 Jan 2018
265breakfastshakesfordogs.infoGoDaddy.com, LLC3 Apr 201415 May 20203 Apr 2021
266breakfastsandwich.netWix.com Ltd.24 Oct 20204 Dec 202424 Oct 2024
267breakfastservedallday.netGoDaddy.com, LLC29 Jan 200717 May 201629 Jan 2017
268breakfastsmoothierecipes.netGoDaddy.com, LLC1 Mar 20121 Mar 20151 Mar 2018
269breakfastshakesforanimals.netGoDaddy.com, LLC2 Apr 20142 Apr 20162 Apr 2017
270breakfastshakesfordogs.netGoDaddy.com, LLC3 Apr 20144 Apr 20163 Apr 2017
271breakfastsingles.net1&1 Internet AG9 Apr 20083 Nov 20179 Apr 2018
272breakfastsprinkles.netGoDaddy.com, LLC17 Jan 201018 Jan 202617 Jan 2027
273breakfastskin.com-16 Oct 201616 Oct 201616 Oct 2017
274breakfastshake.orgGoDaddy.com, LLC17 Oct 201628 Nov 201717 Oct 2018
275breakfastsensitive.usNameCheap, Inc.15 Oct 201615 Oct 201714 Oct 2017
276breakfastserials.orgNetwork Solutions, LLC10 Nov 199815 Sep 20259 Nov 2027
277breakfastshakesfordogs.orgGoDaddy.com, LLC3 Apr 20144 Apr 20173 Apr 2018
278breakfastsandwich.orgDynadot, LLC25 Oct 20087 Oct 202525 Oct 2026
279breakfastsprinkles.orgGoDaddy.com, LLC17 Jan 20103 Mar 202617 Jan 2027
280breakfastservedallday.orgGoDaddy.com, LLC29 Jan 200720 Jun 201729 Jan 2018
281breakfastshakesforanimals.orgGoDaddy.com, LLC2 Apr 20143 Apr 20172 Apr 2018
282breakfastsforbetterdays.orgCSC Corporate Domains, Inc.12 Feb 201313 Feb 202612 Feb 2027
283breakfastsandwhichsettlement.com-28 Oct 201628 Oct 201628 Oct 2017
284breakfastsos.comGoDaddy.com, LLC7 Nov 20167 Nov 20167 Nov 2017
285breakfastschool.bizGoogle, Inc.19 Nov 2016-18 Nov 2017
286breakfastscience.comGoDaddy.com, LLC1 Dec 20161 Dec 20161 Dec 2017
287breakfastswimwear.comeNom, Inc.11 Dec 201614 Dec 201711 Dec 2017
288breakfastspot.xyzName.com, Inc.13 Dec 201629 Dec 201713 Dec 2018
289breakfastsnews.spaceGoDaddy.com, LLC28 Dec 20169 Jan 201828 Dec 2018
290breakfastscrambler.comGoDaddy.com, LLC5 Jan 20175 Jan 20175 Jan 2018
291breakfastsandwichmoments.comGoDaddy.com, LLC9 Jan 20179 Jan 20179 Jan 2019
292breakfastsweets.comGoDaddy.com, LLC21 Jan 201722 Jan 202621 Jan 2027
293breakfasts-recipes.comNameCheap, Inc.16 Oct 201816 Oct 201816 Oct 2019
294breakfastsandwich.xyzGoDaddy.com, LLC8 Feb 201728 Apr 20178 Feb 2018
295breakfastsquaresurvey.comWild West Domains, LLC7 Feb 20177 Feb 20177 Feb 2018
296breakfastspreads.comGoDaddy.com, LLC17 Feb 201717 Feb 201717 Feb 2018
297breakfaststpetebeach.netGoDaddy.com, LLC16 Feb 20171 Oct 202216 Feb 2027
298breakfastspread.comGoDaddy.com, LLC17 Feb 201717 Feb 201717 Feb 2018
299breakfastsmarter.comGoDaddy.com, LLC27 Feb 201727 Feb 201727 Feb 2019
300breakfastsouthington.comNamesilo, LLC16 Apr 202424 Apr 202616 Apr 2028
301breakfastsoftheworld.comGoDaddy.com, LLC23 Mar 201724 Mar 202623 Mar 2027
302breakfastsnackstick.comGoDaddy.com, LLC31 Mar 20174 Apr 202531 Mar 2027
303breakfastsecrets.comNameCheap, Inc.2 Apr 201712 Mar 20262 Apr 2027
304breakfaststation.co.uk-10 Jan 20167 Jan 201710 Jan 2018
305breakfastsearch.co.uk-6 Jan 20063 Jan 20186 Jan 2020
306breakfastsilogs.comGoogle, Inc.19 Apr 20174 Apr 202619 Apr 2027
307breakfastsuccess.technologyUniregistrar Corp26 Apr 201729 Sep 201726 Apr 2018
308breakfastsettlement.comDropCatch.com 681 LLC27 Jul 201827 Jul 201827 Jul 2019
309breakfaststeakhouse.comWild West Domains, LLC15 May 20173 Oct 202215 May 2027
310breakfastsammies.comAnnulet LLC10 Aug 201811 Aug 202510 Aug 2026
311breakfaststation.netInternet Domain Services BS Corp25 May 201723 Oct 201725 May 2018
312breakfaststoop.comTucows Domains Inc.29 May 20172 Jun 201929 May 2019
313breakfastsinnewyork.comGoDaddy.com, LLC4 Jun 20174 Jun 20174 Jun 2018
314breakfastsotogrande.com1&1 Internet AG4 Jun 20174 Jun 20174 Jun 2018
315breakfastshirts.storeGoDaddy.com, LLC18 Jun 201726 Jul 201718 Jun 2018
316breakfastshirts.techGoDaddy.com, LLC18 Jun 201718 Jun 201718 Jun 2018
317breakfastshirt.comGoDaddy.com, LLC18 Jun 201719 Jun 202518 Jun 2026
318breakfastshow.winNameCheap, Inc.29 Jun 20174 Jul 201729 Jun 2018
319breakfastsocks.comGoogle, Inc.14 Jul 201714 Jul 201714 Jul 2018
320breakfastsoups.comMoniker Online Services LLC18 Jul 201718 Jul 201718 Jul 2018
321breakfastshakeshack.comOmnis Network, LLC23 Sep 201723 Sep 201723 Sep 2018
322breakfaststorybkk.comNetwork Solutions, LLC16 Oct 201716 Sep 202516 Oct 2027
323breakfastsyndicate.comNetwork Solutions, LLC19 Oct 201719 Oct 201719 Oct 2027
324breakfastsheep.comDNC Holdings, Inc.26 Oct 201711 Sep 202526 Oct 2026
325breakfastsandwichescambridge.comTucows Domains Inc.21 Nov 201725 Nov 201821 Nov 2018
326breakfastsandwichesfederalsburg.comTucows Domains Inc.21 Nov 201725 Nov 201821 Nov 2018
327breakfastsalad.infoGoDaddy.com, LLC3 Jan 201814 Feb 20253 Jan 2025
328breakfastsofbristol.co.ukHello Internet Corp.27 May 201627 May 201627 May 2018
329breakfasts2u.co.uk-25 Sep 201727 Aug 202525 Sep 2026
330breakfastsmoothierecipes.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…17 May 201310 May 201717 May 2019
331breakfastsmoothiedrink.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…4 Jun 201328 May 20174 Jun 2019
332breakfastshow.co.ukunited-domains AG2 Dec 19981 Dec 20172 Dec 2018
333breakfastsurvey.co.ukNameWeb BVBA24 Apr 201722 Aug 201724 Apr 2018
334breakfastsandwichmaker.co.uk-18 Aug 201618 Aug 201618 Aug 2018
335breakfastsandwichmakers.co.uk-18 Aug 201618 Aug 201618 Aug 2018
336breakfastsushi.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…28 Jul 201728 Jul 201728 Jul 2018
337breakfastscotland.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 Feb 201616 Feb 201616 Feb 2018
338breakfastsmoothie.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…17 May 201310 May 201717 May 2019
339breakfastsauce.co.ukClick Registrar, Inc. d/b/a publicdomainregistry.c…6 Feb 20176 Feb 20176 Feb 2020
340breakfastsanity1602.co.uk-16 Feb 201616 Feb 201616 Feb 2018
341breakfaststudios.co.ukDynadot, LLC8 Nov 20235 Mar 20258 Nov 2025
342breakfastsmoothieshake.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…17 May 201310 May 201717 May 2019
343breakfastsandcornersnacks.co.uk-15 Jan 201511 Jan 201815 Jan 2019
344breakfaststoolsdirect.co.ukLCN.COM Ltd.27 Jan 201229 Oct 201327 Jan 2019
345breakfastshake.co.uk-15 Jul 201715 Jul 201715 Jul 2019
346breakfastsunshine.comGoDaddy.com, LLC25 Nov 202525 Nov 202525 Nov 2026
347breakfastsocks.netAutomattic Inc.2 Mar 20182 Mar 20182 Mar 2019
348breakfastsoda.comNameCheap, Inc.12 Oct 202412 Sep 202512 Oct 2026
349breakfastsurvey.netGoogle, Inc.8 Mar 20188 Mar 20188 Mar 2019
350breakfaststack.comDropCatch.com 972 LLC23 Jun 202524 Jun 202523 Jun 2026
351breakfastslot.siteNameCheap, Inc.24 Apr 201824 Apr 201824 Apr 2019
352breakfastscent.infoNameCheap, Inc.3 May 20183 May 20183 May 2019
353breakfastshots.comName.com, Inc.23 May 201828 Oct 202423 May 2026
354breakfastsnacks.bizGoDaddy.com, LLC27 May 201827 May 201827 May 2019
355breakfastsandbuds.comGoDaddy.com, LLC15 Jun 201815 Jun 201815 Jun 2019
356breakfaststaugustine.comGoDaddy.com, LLC29 Jun 201829 Jun 201829 Jun 2020
357breakfastslim.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Jul 201825 Jul 201825 Jul 2019
358breakfastspace.comDropCatch.com 381 LLC11 Apr 202412 Apr 202411 Apr 2026
359breakfastsalon.comGoDaddy.com, LLC7 Sep 20188 Sep 20237 Sep 2028
360breakfastsurprise100.comGoDaddy.com, LLC2 Oct 201813 Dec 20232 Oct 2023
361breakfastsurprise100.netGoDaddy.com, LLC2 Oct 20182 Oct 20182 Oct 2020
362breakfaststrong.comGoDaddy.com, LLC23 Oct 201823 Oct 201823 Oct 2019
363breakfastsb.comGoDaddy.com, LLC29 Oct 201829 Oct 201829 Oct 2019
364breakfastshakeclub.uk-3 Nov 20183 Nov 20183 Nov 2019
365breakfastsepal.comTucows Domains Inc.31 Jan 201931 Jan 201931 Jan 2020
366breakfastslip.comNamesilo, LLC4 Dec 20184 Dec 20194 Dec 2019
367breakfaststation.clubNameCheap, Inc.7 Dec 20188 Dec 20187 Dec 2019
368breakfastspy.comGoDaddy.com, LLC11 Dec 201811 Dec 201811 Dec 2020
369breakfastsforbreaks.comGoDaddy.com, LLC21 Dec 201821 Dec 201821 Dec 2020
370breakfastsantacruz.comNetwork Solutions, LLC20 Jan 20194 Apr 202520 Jan 2025
371breakfastsbz.comNamesilo, LLC29 Jan 201930 Jan 201929 Jan 2020
372breakfastsbeans.comGoDaddy.com, LLC7 Feb 20197 Feb 20197 Feb 2020
373breakfastsofchampions.comGoDaddy.com, LLC2 Sep 202214 Nov 20232 Sep 2023
374breakfastservicemallorca.comWix.com Ltd.22 Feb 201922 Feb 201922 Feb 2021
375breakfastskillet.comDomainAdministration.com, LLC30 May 202031 May 202530 May 2026
376breakfastsbz.worldNamesilo, LLC30 Jan 20194 Feb 201930 Jan 2020
377breakfastscrub.comDynadot, LLC8 Mar 20218 Mar 20218 Mar 2022
378breakfastshop.netTucows Domains Inc.25 Mar 201829 Mar 201925 Mar 2019
379breakfastswithseneca.comNameCheap, Inc.9 Apr 20199 Apr 20199 Apr 2020
380breakfastsoupcomics.comGoDaddy.com, LLC27 May 201927 May 201927 May 2020
381breakfastsandlunch.comNameCheap, Inc.28 May 201928 May 201928 May 2020
382breakfastserviceuk.comGoDaddy.com, LLC30 May 201930 May 201930 May 2020
383breakfastsupreme.proNameCheap, Inc.3 Jun 201915 Jul 20203 Jun 2021
384breakfastsweetmoments.comGoDaddy.com, LLC11 Jun 201911 Jun 201911 Jun 2020
385breakfaststonemountain.comGoDaddy.com, LLC10 Jul 201921 Aug 202410 Jul 2024
386breakfaststreet.comGoDaddy.com, LLC11 Jul 201911 Jul 201911 Jul 2020
387breakfastsandwhichbitch.comTucows Domains Inc.26 Jul 20196 Oct 202426 Jul 2024
388breakfastswerved.comTucows Domains Inc.30 Jul 20193 Aug 202430 Jul 2025
389breakfastsuperhero.comWebfusion Ltd.16 Aug 201916 Aug 201916 Aug 2020
390breakfastshop.lifeDynadot, LLC8 Nov 20208 Nov 20208 Nov 2021
391breakfastselfie.comDNC Holdings, Inc.1 Sep 20191 Sep 20191 Sep 2020
392breakfaststand.comCloudFlare, Inc.18 Sep 202528 Sep 202518 Sep 2026
393breakfastsoul.comAutomattic Inc.29 Sep 201923 Nov 202529 Sep 2026
394breakfaststar.comGoDaddy.com, LLC5 Nov 20195 Dec 20255 Nov 2026
395breakfastsocials.comGoDaddy.com, LLC24 Nov 201924 Nov 201924 Nov 2020
396breakfastsammys.comGoogle, Inc.6 Jan 202022 Dec 20256 Jan 2027
397breakfaststlouis.comGoDaddy.com, LLC8 Jan 20208 Jan 20208 Jan 2021
398breakfastswithchampions.comCrazy Domains FZ-LLC10 Jan 20205 Feb 202610 Jan 2027
399breakfaststart.comWild West Domains, LLC24 Feb 202025 Feb 202624 Feb 2027
400breakfastskateco.comGoogle, Inc.5 Mar 202018 Feb 20265 Mar 2027
401breakfastseltzer.comOmnis Network, LLC27 Mar 202027 May 202327 Mar 2023
402breakfastsausageboy.comGoDaddy.com, LLC15 Apr 202015 Apr 202015 Apr 2021
403breakfastsanfernando.comGoDaddy.com, LLC15 May 202015 May 202015 May 2021
404breakfastsanfernandovalley.comGoDaddy.com, LLC15 May 202015 May 202015 May 2021
405breakfastsandwiches.infoNameCheap, Inc.29 May 201928 Jul 201929 May 2020
406breakfaststakeout.comGoDaddy.com, LLC30 May 202030 May 202030 May 2021
407breakfastsandwichclub.comGoogle, Inc.1 Jun 20201 Jun 20201 Jun 2021
408breakfastsinamerica.comDomain.com, LLC9 Jun 202024 Jun 20259 Jun 2026
409breakfastsiue.comGoDaddy.com, LLC10 Jun 202010 Jun 202010 Jun 2021
410breakfastspices.comGoDaddy.com, LLC20 Jun 202020 Jun 202020 Jun 2021
411breakfastsnobs.comGoDaddy.com, LLC4 Jul 202015 Sep 20244 Jul 2024
412breakfastspirits.comGoDaddy.com, LLC6 Jul 20207 Jul 20256 Jul 2026
413breakfastsanfrancisco.com-5 Apr 20265 Apr 20265 Apr 2027
414breakfaststudiosco.comTucows Domains Inc.24 Aug 202026 Jul 202524 Aug 2026
415breakfastsomewhere.comGoDaddy.com, LLC26 Sep 202020 Jan 202626 Sep 2026
416breakfastsinew.comeNom, Inc.7 Oct 202013 Mar 20267 Oct 2026
417breakfastsuspend.comNamesilo, LLC24 Oct 202025 Oct 202024 Oct 2021
418breakfaststarbucks.comGoDaddy.com, LLC27 Oct 202029 Oct 202527 Oct 2026
419breakfastspice.comTucows Domains Inc.30 Dec 202312 Mar 202530 Dec 2024
420breakfastsinamerica.netDomain.com, LLC12 Nov 202029 Oct 202512 Nov 2026
421breakfastsource.comHostinger, UAB11 May 202423 Jun 202511 May 2025
422breakfastserial.xyzGoDaddy.com, LLC4 Dec 202020 Feb 20264 Dec 2026
423breakfaststrategy.comSquarespace Domains LLC12 Mar 202425 Feb 202612 Mar 2027
424breakfastsmoothies.siteDynadot, LLC6 Sep 202029 Oct 20206 Sep 2021
425breakfastserved24hours.comSquarespace Domains LLC1 Jan 202117 Dec 20251 Jan 2027
426breakfastsbff.comEpik Inc.6 Jun 202430 Jun 20256 Jun 2026
427breakfastsouls.comGoDaddy.com, LLC11 Jan 202111 Jan 202111 Jan 2022
428breakfaststromboli.comDomain.com, LLC31 Jan 202131 Jan 202131 Jan 2022
429breakfastsouth.comGoDaddy.com, LLC13 Feb 202113 Feb 202113 Feb 2022
430breakfaststuffy.comNetwork Solutions, LLC21 Feb 202123 Dec 202321 Feb 2027
431breakfaststuffie.comNetwork Solutions, LLC21 Feb 202123 Dec 202321 Feb 2027
432breakfaststudios.netGoogle, Inc.5 Jul 20224 Aug 20245 Jul 2024
433breakfastshotgolf.comGoogle, Inc.3 Apr 202119 Mar 20263 Apr 2027
434breakfastspot.netGoogle, Inc.27 Apr 202127 Apr 202127 Apr 2022
435breakfastsoup.mediaGoogle, Inc.9 May 20218 May 20229 May 2022
436breakfastsurprise.proNameCheap, Inc.11 May 202111 May 202111 May 2022
437breakfastsalzburg.comWorld4You Internet Services GmbH21 May 202121 May 202421 May 2024
438breakfastsommelier.comTucows Domains Inc.29 May 202130 Apr 202629 May 2027
439breakfastservedallnight.comDomain.com, LLC1 Jun 20213 May 20251 Jun 2026
440breakfastspotdairieslg.comGoDaddy.com, LLC20 Jun 202120 Jun 202120 Jun 2022
441breakfastsams.comGoDaddy.com, LLC26 Jun 20216 Aug 202326 Jun 2023
442breakfaststrategymeeting.comGoDaddy.com, LLC28 Jun 202128 Jun 202128 Jun 2022
443breakfaststrategymeetings.comGoDaddy.com, LLC28 Jun 202128 Jun 202128 Jun 2022
444breakfastspotdiaries.comGoDaddy.com, LLC2 Jul 20212 Jul 20212 Jul 2022
445breakfaststarsd.comGoDaddy.com, LLC22 Jul 20212 Sep 202322 Jul 2023
446breakfastserve.comTurnCommerce, Inc. DBA NameBright.com5 Oct 202216 Dec 20255 Oct 2025
447breakfastsbythebay.comGoogle, Inc.1 Aug 202131 Aug 20241 Aug 2024
448breakfastshop.bizNameKing.com Inc.14 Aug 202114 Aug 202114 Aug 2022
449breakfastsorcialtime.comOVH sas15 Aug 202115 Aug 202115 Aug 2022
450breakfastserver.comGoogle, Inc.25 Aug 202110 Aug 202525 Aug 2026
451breakfastsnugs.comGoogle, Inc.29 Aug 202114 Aug 202529 Aug 2026
452breakfastspecials.websiteGoDaddy.com, LLC1 Sep 20211 Sep 20211 Sep 2022
453breakfastspecials.infoGoDaddy.com, LLC1 Sep 20211 Sep 20211 Sep 2022
454breakfastspecials.onlineGoDaddy.com, LLC1 Sep 20211 Sep 20211 Sep 2022
455breakfastsnob.storeGoDaddy.com, LLC14 Sep 202125 Nov 202414 Sep 2024
456breakfastsnob.netGoDaddy.com, LLC14 Sep 202126 Nov 202414 Sep 2024
457breakfastsuniquebeauty.comGoDaddy.com, LLC14 Sep 202114 Sep 202114 Sep 2022
458breakfastseason.oneName.com, Inc.20 Sep 20214 Jun 202220 Sep 2022
459breakfastsolvd.comDynadot, LLC30 Sep 202130 Sep 202130 Sep 2022
460breakfaststorming.comGoDaddy.com, LLC7 Oct 202111 Oct 20227 Oct 2026
461breakfastsdelivered.comEpik Inc.9 Oct 20219 Oct 20219 Oct 2022
462breakfastsingapore.comNameCheap, Inc.17 Nov 202129 Jan 202517 Nov 2024
463breakfastsale.comNameCheap, Inc.17 Nov 202129 Jan 202517 Nov 2024
464breakfastshowlive.com1&1 Internet AG13 Dec 202113 Dec 202113 Dec 2022
465breakfaststudio.onlinePDR Ltd. d/b/a PublicDomainRegistry.com17 Dec 202117 Dec 202117 Dec 2022
466breakfastsugar.comNameCheap, Inc.25 Dec 20217 Mar 202425 Dec 2023
467breakfastsnearme.comGoDaddy.com, LLC27 Dec 202113 Jan 202627 Dec 2026
468breakfastsandwich.usGoDaddy.com, LLC14 Mar 201419 Mar 202413 Mar 2029
469breakfaststocks.comTucows Domains Inc.4 Feb 20218 Feb 20224 Feb 2022
470breakfaststable.comGoDaddy.com, LLC9 Feb 20229 Feb 20229 Feb 2023
471breakfaststunning.xyzNameCheap, Inc.26 Feb 20229 May 202326 Feb 2023
472breakfastsmokeclub.comNameCheap, Inc.15 Mar 202227 May 202315 Mar 2023
473breakfastsydney.comNameCheap, Inc.30 Mar 202231 Mar 202530 Mar 2026
474breakfastsantamonica.comNameCheap, Inc.30 Mar 202231 Mar 202530 Mar 2026
475breakfastsanta.comNameCheap, Inc.30 Mar 202231 Mar 202530 Mar 2026
476breakfastsbest.netNameCheap, Inc.31 Mar 202212 Jun 202331 Mar 2023
477breakfaststation10.clubNameCheap, Inc.16 Apr 20221 May 202316 Apr 2023
478breakfastsoymilk.xyzGMO Internet Inc.18 Jul 202223 Jul 202218 Jul 2023
479breakfastsconesnherbs.comSquarespace Domains LLC27 Jul 202226 Sep 202327 Jul 2023
480breakfastspecialnearme.comPorkbun, LLC5 Aug 202221 Aug 20255 Aug 2026
481breakfastspecialsnearme.comPorkbun, LLC5 Aug 202221 Aug 20255 Aug 2026
482breakfastsandwichstudio.comAmazon Registrar, Inc.7 Aug 202218 Feb 20267 Aug 2026
483breakfastsantorini.comPapaki Ltd.16 Aug 202226 Sep 202316 Aug 2023
484breakfastsurprisela.comNameCheap, Inc.20 Aug 20221 Nov 202320 Aug 2023
485breakfaststop1.comGoDaddy.com, LLC8 Sep 202220 Oct 20248 Sep 2024
486breakfastsuitcase.comTucows Domains Inc.27 Sep 20228 Dec 202427 Sep 2024
487breakfasts-burn.comCosmotown, Inc.28 Sep 20228 Nov 202328 Sep 2023
488breakfaststudy.comTurnCommerce, Inc. DBA NameBright.com11 Dec 202220 Jan 202511 Dec 2024
489breakfastsperu.storeDattatec.com SRL7 Oct 2022-7 Oct 2023
490breakfastsperu.comDattatec.com SRL7 Oct 202224 Oct 20237 Oct 2023
491breakfaststop.orgeNom, Inc.11 Oct 202223 Dec 202311 Oct 2023
492breakfaststudy.orgNameCheap, Inc.20 Oct 202214 May 202520 Oct 2027
493breakfastsurfers.comGoDaddy.com, LLC20 Oct 20221 Jan 202420 Oct 2023
494breakfastsurfers.co.uk-21 Oct 20228 Aug 202321 Oct 2023
495breakfastsleepiness.comHefei Juming Network Technology Co., Ltd31 Oct 202231 Oct 202331 Oct 2024
496breakfastsausagerecipe.siteDOTSERVE INC.3 Nov 20224 Nov 20253 Nov 2026
497breakfastsendmail.xyzNetowl, Inc.9 Nov 202222 Jan 20249 Nov 2023
498breakfaststation319.comGoogle, Inc.12 Nov 202228 Oct 202512 Nov 2026
499breakfastsandwichsanfrancisco.comGoDaddy.com, LLC17 Nov 20223 Nov 202517 Nov 2026
500breakfastsistas.comGoDaddy.com, LLC21 Nov 20222 Feb 202421 Nov 2023
501breakfastsaladclub.comGoDaddy.com, LLC26 Nov 20227 Jan 202526 Nov 2024
502breakfastspiral.cyouChengdu West Dimension Digital Technology Co., Ltd…28 Nov 202229 Nov 202328 Nov 2024
503breakfastscotch.comGoDaddy.com, LLC19 Dec 201720 Dec 202519 Dec 2026
504breakfastsburn.comNameCheap, Inc.13 Feb 202314 Feb 202513 Feb 2026
505breakfastsesh.comWix.com Ltd.20 Dec 202229 Feb 202420 Dec 2023
506breakfastspotlg.comGoDaddy.com, LLC8 Jan 202319 Feb 20258 Jan 2025
507breakfastsg.comNameCheap, Inc.8 Jan 202319 Feb 20258 Jan 2025
508breakfastsanjuancapistrano.comGoDaddy.com, LLC12 Jan 20232 Jan 202612 Jan 2027
509breakfastsandwichguy.comAutomattic Inc.15 Jan 202326 Dec 202515 Jan 2027
510breakfastswap.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Jan 202310 Mar 202428 Jan 2024
511breakfastsandwich.ca-29 Mar 201928 Mar 202629 Mar 2027
512breakfastsandwichsociety.comGoDaddy.com, LLC6 Apr 20216 Apr 20256 Apr 2027
513breakfastshacksd.comregister.com, Inc.2 Feb 202317 Mar 20262 Feb 2026
514breakfastswallow.liveDynadot, LLC4 Feb 202315 Mar 20244 Feb 2024
515breakfaststation.coGoDaddy.com, LLC12 Jun 202124 Jul 202312 Jun 2023
516breakfastshirts.comGoDaddy.com, LLC18 Apr 201720 Apr 202618 Apr 2027
517breakfastsalsa.comGoDaddy.com, LLC10 Jul 201711 Jul 202510 Jul 2026
518breakfastsketches.comNetwork Solutions, LLC16 Nov 201729 Dec 202316 Nov 2023
519breakfaststogo.comGoDaddy.com, LLC18 Nov 201719 Nov 202418 Nov 2026
520breakfastshorts.comGoDaddy.com, LLC23 Jan 20186 Mar 202623 Jan 2026
521breakfastsmoke.comregister.com, Inc.11 Mar 202324 Apr 202611 Mar 2026
522breakfastshackredlands.comGoDaddy.com, LLC27 Apr 201828 Apr 202627 Apr 2027
523breakfaststoptogo.comGoDaddy.com, LLC13 Mar 202325 May 202413 Mar 2024
524breakfastsdiva.comGoDaddy.com, LLC16 Mar 202328 May 202416 Mar 2024
525breakfastsmartstart.comWild West Domains, LLC24 Feb 202025 Feb 202624 Feb 2027
526breakfaststarter.comNameKing.com Inc.16 May 202230 Jul 202316 May 2023
527breakfastsunday.comNameCheap, Inc.17 Mar 202028 Apr 202317 Mar 2023
528breakfastsorted.comProtocol Internet Technology Limited T/A Hosting I…28 Mar 20208 Apr 202628 Mar 2027
529breakfasts2go.com101domain, Inc.21 May 202030 Jun 202421 May 2024
530breakfastservicehoreca.comGoDaddy.com, LLC20 Mar 20231 Apr 202620 Mar 2027
531breakfastseasoning.comNameCheap, Inc.28 Jan 202129 Dec 202528 Jan 2027
532breakfastsocialmedia.comGoDaddy.com, LLC5 Mar 202116 Apr 20235 Mar 2023
533breakfaststrippers.comGoDaddy.com, LLC23 May 202123 May 202523 May 2026
534breakfaststadium.comGoDaddy.com, LLC3 Jun 20214 Jun 20253 Jun 2026
535breakfastspotpk.comWix.com Ltd.26 Jul 20215 Oct 202426 Jul 2024
536breakfastsandwichexpress.comGoDaddy.com, LLC20 Aug 202121 Aug 202520 Aug 2026
537breakfastsnakeclub.comWix.com Ltd.4 Oct 202114 Dec 20244 Oct 2024
538breakfastsalgados.comGoDaddy.com, LLC14 Nov 202126 Dec 202314 Nov 2023
539breakfaststpetersburg.comGoDaddy.com, LLC18 Jan 20221 Mar 202518 Jan 2025
540breakfastsk8club.comGoDaddy.com, LLC10 Feb 202221 Feb 202610 Feb 2027
541breakfastsanjose.comNameCheap, Inc.30 Mar 202231 Mar 202530 Mar 2026
542breakfastsocialclub.comGoDaddy.com, LLC3 May 202217 Mar 20253 May 2026
543breakfastsongs.comNameCheap, Inc.29 May 202210 Jul 202329 May 2023
544breakfastspuds.comAnnulet LLC6 Sep 20237 Sep 20256 Sep 2026
545breakfastshowdown.comGoDaddy.com, LLC13 Jul 202214 Jul 202413 Jul 2026
546breakfastsmackdown.comGoDaddy.com, LLC13 Jul 202214 Jul 202413 Jul 2026
547breakfastsolutions.in-9 Mar 20229 Mar 20239 Mar 2023
548breakfastsupply.shopGoDaddy.com, LLC16 Apr 202328 Apr 202416 Apr 2025
549breakfastservedallday.it-4 Nov 20122 Feb 202628 Nov 2026
550breakfastservice.it-14 Oct 202030 Oct 202514 Oct 2026
551breakfastsalad.netGoDaddy.com, LLC3 Jan 201814 Feb 20253 Jan 2025
552breakfastsalad.orgGoDaddy.com, LLC3 Jan 201814 Feb 20253 Jan 2025
553breakfastsinamerica.orgDomain.com, LLC12 Nov 20203 Nov 202512 Nov 2026
554breakfastserial.orgGoDaddy.com, LLC27 May 20248 Jul 202527 May 2025
555breakfaststories.org-12 Mar 202325 May 202412 Mar 2024
556breakfastsniffanys.orgGoogle, Inc.19 Apr 202219 Apr 202419 Apr 2025
557breakfaststudio.pe1API GmbH---
558breakfastsandbrunches.comTucows Domains Inc.10 May 202310 May 202510 May 2026
559breakfastsandbrunches.co.uk-10 May 202310 May 202510 May 2026
560breakfastsyrup.co.uk-22 Jun 202213 Jun 202422 Jun 2026
561breakfastsocietyonline.co.uk-31 Aug 20203 Jun 202531 Aug 2026
562breakfastsquared.comGoogle, Inc.12 Jun 202324 Jul 202512 Jun 2025
563breakfastsalinakansas.comGoDaddy.com, LLC30 Jul 202330 Jul 202530 Jul 2027
564breakfastsalinaks.comGoDaddy.com, LLC30 Jul 202330 Jul 202530 Jul 2027
565breakfastsilverdale.comGoDaddy.com, LLC4 Aug 20231 Aug 20254 Aug 2026
566breakfastshow.armyPorkbun, LLC19 Aug 20231 Nov 202419 Aug 2024
567breakfastsend.comNameCheap, Inc.22 Aug 20233 Oct 202422 Aug 2024
568breakfastsliders.comFastDomain Inc.27 Aug 20239 Oct 202427 Aug 2024
569breakfastsuperfast.comGoDaddy.com, LLC31 Aug 202312 Nov 202431 Aug 2024
570breakfastsociety.xyzNameCheap, Inc.23 Sep 20238 Oct 202423 Sep 2025
571breakfastsandwichbite.comGoDaddy.com, LLC22 Oct 202323 Oct 202522 Oct 2026
572breakfaststrings.comNamesilo, LLC22 Nov 202322 Jan 202522 Nov 2024
573breakfasts-burn.usNameCheap, Inc.21 Dec 202221 Dec 202321 Dec 2023
574breakfastsball.comGoDaddy.com, LLC11 Dec 20233 Nov 202411 Dec 2024
575breakfastspray.comGoDaddy.com, LLC12 Dec 202312 Dec 202512 Dec 2026
576breakfastsclub.comGoDaddy.com, LLC18 Jan 202419 Jan 202618 Jan 2027
577breakfaststrategist.comPorkbun, LLC30 Jan 202415 Apr 202630 Jan 2026
578breakfastsmysweetdream.comWix.com Ltd.6 Feb 202418 Apr 20256 Feb 2025
579breakfastsavvy.comCSC Corporate Domains, Inc.20 Feb 202416 Feb 202620 Feb 2027
580breakfastsoup.club1API GmbH22 Feb 202430 Mar 202522 Feb 2025
581breakfaststar.netGoDaddy.com, LLC21 Feb 202422 Feb 202621 Feb 2028
582breakfastsol.siteNameCheap, Inc.21 Feb 20244 May 202521 Feb 2025
583breakfastsocietygbg.comGoDaddy.com, LLC28 Feb 20245 Mar 202628 Feb 2027
584breakfastsneartiffanys.comTucows Domains Inc.19 Mar 202416 Feb 202619 Mar 2027
585breakfastspine.latDynadot, LLC12 Apr 202423 May 202512 Apr 2025
586breakfastshow.liveGoDaddy.com, LLC12 Apr 202424 May 202512 Apr 2025
587breakfastshirts.com.au--2 Mar 2026-
588breakfastsodium.topChengdu West Dimension Digital Technology Co., Ltd…29 Jun 202312 Aug 202429 Jun 2024
589breakfaststab.topChengdu West Dimension Digital Technology Co., Ltd…29 Nov 202312 Jan 202529 Nov 2024
590breakfastshirts.shopWeb Commerce Communications Limited dba WebNic.cc29 Jan 202419 Mar 202429 Jan 2025
591breakfaststudio.coNameCheap, Inc.27 Apr 202129 Apr 202327 Apr 2027
592breakfastsocial.co.uk-3 May 202227 Feb 20243 May 2024
593breakfastskiclub.comRegister.ca Inc.29 Apr 20243 May 202629 Apr 2026
594breakfastservicewaldshut.de--3 Dec 2019-
595breakfastsocietygbg.se-13 Mar 202523 Mar 202613 Mar 2026
596breakfastshow.se-23 Sep 20213 Oct 202423 Sep 2024
597breakfastsplay.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…10 May 202418 Jul 202510 May 2025
598breakfaststick.comGoDaddy.com, LLC16 May 202416 May 202416 May 2027
599breakfastsearch.xyzGMO Internet Inc.7 Aug 202514 Aug 20257 Aug 2026
600breakfastsummit.comGoDaddy.com, LLC20 May 202421 May 202520 May 2026
601breakfastserial.infoGoDaddy.com, LLC27 May 20248 Jul 202527 May 2025
602breakfastserial.proGoDaddy.com, LLC27 May 20248 Jul 202527 May 2025
603breakfastserial.storeDynadot, LLC11 Sep 202515 Feb 202611 Sep 2026
604breakfastscafe.comCloudFlare, Inc.4 Jun 202431 May 20254 Jun 2026
605breakfastservice.hu-4 Jul 2023--
606breakfastshowtime.comWix.com Ltd.18 Jun 202419 May 202518 Jun 2026
607breakfastshack.siteNameCheap, Inc.22 Jun 20242 Sep 202522 Jun 2025
608breakfastsnmore.comGoDaddy.com, LLC24 Jun 202425 Jun 202524 Jun 2026
609breakfastsco.shopGoDaddy.com, LLC2 Jul 20248 Aug 20242 Jul 2025
610breakfastsbuddies.infoGoDaddy.com, LLC1 Aug 202414 Aug 20251 Aug 2026
611breakfastsbuddies.orgGoDaddy.com, LLC1 Aug 202414 Aug 20251 Aug 2026
612breakfastsbuddies.xyzGoDaddy.com, LLC1 Aug 202414 Aug 20251 Aug 2026
613breakfastsbuddies.comGoDaddy.com, LLC1 Aug 20241 Aug 20241 Aug 2027
614breakfaststation.org1&1 Internet AG10 Aug 202418 Sep 202410 Aug 2025
615breakfastsando.comGoDaddy.com, LLC18 Aug 202418 Aug 202518 Aug 2026
616breakfastsxm.comGoDaddy.com, LLC24 Aug 202426 Aug 202524 Aug 2026
617breakfastst-martin.comGoDaddy.com, LLC24 Aug 202426 Aug 202524 Aug 2026
618breakfastst-maarten.comGoDaddy.com, LLC24 Aug 202426 Aug 202524 Aug 2026
619breakfastsurmer.comCronon AG11 Sep 202431 Oct 202511 Sep 2026
620breakfastspeakeasy.comGoDaddy.com, LLC18 Sep 202418 Sep 202418 Sep 2027
621breakfastsalt.onlineGoDaddy.com, LLC9 Oct 202421 Oct 20259 Oct 2026
622breakfastsolstice.blogAutomattic Inc.8 Nov 202424 Dec 20258 Nov 2026
623breakfastsol.xyzNameCheap, Inc.14 Nov 202426 Dec 202514 Nov 2025
624breakfastsapphire.comNameCheap, Inc.15 Nov 202427 Dec 202515 Nov 2025
625breakfastsandwich.partyPorkbun, LLC25 Nov 20248 Jan 202625 Nov 2025
626breakfaststars.comHetzner Online AG29 Nov 202429 Nov 202529 Nov 2026
627breakfastsandwich4u.comGoDaddy.com, LLC15 Dec 202426 Mar 202515 Dec 2025
628breakfastsuggestions.comRegister.it SPA4 Jan 20256 Feb 20264 Jan 2027
629breakfastsociety.netNameCheap, Inc.12 Jan 202513 Dec 202512 Jan 2027
630breakfastscotchnational.comNameCheap, Inc.18 Feb 20251 Feb 202618 Feb 2027
631breakfastsmokeandspray.comDynadot, LLC19 Feb 20253 Feb 202619 Feb 2031
632breakfaststays.comGoDaddy.com, LLC20 Feb 202521 Feb 202620 Feb 2027
633breakfaststops.comWild West Domains, LLC28 Feb 202528 Feb 202628 Feb 2027
634breakfastsociety.se-5 Mar 202519 Mar 20265 Mar 2027
635breakfastshow.netMedia Elite Holdings Limited17 Mar 202529 Jun 202517 Mar 2027
636breakfastshortbread.comNameCheap, Inc.21 Mar 20252 May 202621 Mar 2026
637breakfastsearch.clubAmazon Registrar, Inc.24 Mar 202522 Feb 202624 Mar 2027
638breakfasts-peroration.clickNameCheap, Inc.22 Apr 202522 Apr 202622 Apr 2027
639breakfastsportsclub.comNetowl, Inc.14 May 202514 Apr 202614 May 2027
640breakfaststore.com.br-17 Nov 202426 Nov 202517 Nov 2027
641breakfastspf.comGoDaddy.com, LLC29 May 202529 May 202529 May 2026
642breakfastseek.comCosmotown, Inc.31 May 20258 Jun 202531 May 2026
643breakfastseek.netCosmotown, Inc.31 May 20258 Jun 202531 May 2026
644breakfaststtropez.comHostinger, UAB27 Jun 202527 Jun 202527 Jun 2026
645breakfastsex.xyzGMO Internet Inc.21 Jul 20258 Aug 202521 Jul 2026
646breakfastsocial.xyzGMO Internet Inc.21 Jul 20258 Aug 202521 Jul 2026
647breakfastshack313.comGoogle, Inc.24 Jul 202524 Jul 202524 Jul 2026
648breakfastsammie.comGoDaddy.com, LLC27 Aug 202527 Aug 202527 Aug 2028
649breakfastsolver.xyzGMO Internet Inc.11 Sep 202516 Sep 202511 Sep 2026
650breakfaststorieslights.comNameCheap, Inc.3 Nov 20253 Nov 20253 Nov 2026
651breakfaststablecoin.xyzGMO Internet Inc.13 Nov 202518 Nov 202513 Nov 2026
652breakfaststaking.xyzGMO Internet Inc.17 Nov 202522 Nov 202517 Nov 2026
653breakfastswap.xyzGMO Internet Inc.23 Nov 202528 Nov 202523 Nov 2026
654breakfastspotoftheyear.comGoDaddy.com, LLC22 Nov 202523 Jan 202622 Nov 2026
655breakfastsandwichscorecard.comGoDaddy.com, LLC14 Dec 202514 Dec 202514 Dec 2030
656breakfastslackperch.digitalPDR Ltd. d/b/a PublicDomainRegistry.com15 Dec 202514 Feb 2026-
657breakfaststatistics.comAscio Technologies, Inc. Danmark - Filial af Ascio…27 Dec 202527 Dec 202527 Dec 2026
658breakfastsattiffinyskalamazoo.storeGoDaddy.com, LLC29 Dec 202519 Mar 202629 Dec 2026
659breakfastsattiffinyskalamazoo.infoGoDaddy.com, LLC29 Dec 20253 Jan 202629 Dec 2026
660breakfastsattiffinyskalamazoo.shopGoDaddy.com, LLC29 Dec 20256 Feb 202629 Dec 2026
661breakfastsattiffinyskalamazoo.comGoDaddy.com, LLC29 Dec 202529 Dec 202529 Dec 2030
662breakfastsattiffinyskalamazoo.netGoDaddy.com, LLC29 Dec 202529 Dec 202529 Dec 2026
663breakfastsoupmag.comNameCheap, Inc.9 Feb 20269 Feb 20269 Feb 2027
664breakfastshrimp.comGoDaddy.com, LLC18 Feb 202618 Feb 202618 Feb 2027
665breakfastslive.comGoDaddy.com, LLC6 Apr 20266 Apr 20266 Apr 2027

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=breakfasts

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now