Our database now contains whois records of 704 Million (704,851,256) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1596 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [704 Million Domains] $10,000 Details

Keyword: BLUEWAY

Reverse Whois » KEYWORD [blueway ]  { 773 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1blueway.photoseNom, Inc.24 Sep 201424 Sep 201424 Sep 2015
2blueway.gurueNom, Inc.24 Sep 201424 Sep 201424 Sep 2015
3blueway.emaileNom, Inc.24 Sep 201424 Sep 201424 Sep 2015
4blueway.agencyCSL Computer Service Langenbach GmbH d/b/a joker.c…25 Dec 202125 Dec 202125 Dec 2022
5blueway.blueGoDaddy.com, LLC11 May 202125 Jun 202511 May 2027
6blueway.digitalCronon AG3 Aug 20152 Sep 20243 Aug 2024
7blueway.systems-18 Dec 2024-18 Dec 2025
8blueway.comMegazone Corp., dba HOSTING.KR28 Jan 201510 Feb 202628 Jan 2027
9blueway.bizWhois Networks Co., Ltd.27 Feb 201524 Oct 202526 Feb 2027
10blueway.siteGoDaddy.com, LLC11 May 202123 May 202611 May 2027
11blueway.clubDynadot, LLC1 Nov 20221 Nov 20221 Nov 2023
12blueway.techMetaregistrar BV Applications28 Jul 202227 Jul 202428 Jul 2024
13blueway.oneGandi SAS29 Jan 201615 May 201729 Jan 2021
14blueway.topDynadot, LLC10 Mar 202617 Apr 202610 Mar 2027
15blueway.tradingKey-Systems GmbH15 Jun 20168 Jun 202615 Jun 2027
16blueway.usDynadot, LLC3 Jul 20263 Jul 20263 Jul 2027
17blueway.infoAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…30 Dec 20244 Jun 202530 Dec 2025
18blueway.netGandi SAS31 Oct 20041 Sep 202531 Oct 2026
19blueway.orgNetwork Solutions, LLC30 Dec 200413 Mar 202630 Dec 2026
20blueway.xyzDynadot, LLC1 Feb 202627 Feb 20261 Feb 2027
21blueway.fr-17 Sep 200922 Aug 202517 Sep 2026
22blueway.it-9 Nov 20132 Feb 20268 Dec 2026
23blueway.co.ukLCN.COM Ltd.2 Jul 20021 Aug 20242 Jul 2026
24blueway.dk-22 Sep 2008-30 Sep 2018
25blueway.co.inKey-Systems GmbH25 Oct 202130 Oct 202425 Oct 2025
26blueway.onlinePDR Ltd. d/b/a PublicDomainRegistry.com24 Aug 20251 Oct 202524 Aug 2026
27blueway.photographyGoDaddy.com, LLC23 Mar 201831 Jul 202423 Mar 2028
28blueway.designGoDaddy.com, LLC22 Jun 201823 Jun 202622 Jun 2027
29blueway.ltdAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…11 Dec 201912 Dec 202311 Dec 2024
30blueway.proNameCheap, Inc.1 May 202312 Jun 20251 May 2025
31blueway.icuChengdu West Dimension Digital Technology Co., Ltd…23 Jan 202224 Jan 202223 Jan 2023
32blueway.storeGoDaddy.com, LLC24 Sep 202519 Mar 202624 Sep 2026
33blueway.space-26 Nov 2020-26 Nov 2021
34blueway.companyNameCheap, Inc.16 May 202427 Jul 202516 May 2025
35blueway.solutionsGandi SAS30 Nov 2022--
36blueway.venturesName.com, Inc.17 Aug 202129 Oct 202417 Aug 2024
37blueway.instituteNameCheap, Inc.6 Sep 20216 Sep 20216 Sep 2022
38blueway.toursAutomattic Inc.29 Jan 202229 Jan 202229 Jan 2023
39blueway.questNameCheap, Inc.27 Nov 20237 Feb 202527 Nov 2024
40blueway.ma-20 Dec 201219 Jan 202620 Dec 2026
41blueway.cloudGandi SAS8 Sep 202213 Aug 20258 Sep 2026
42blueway.technologyGandi SAS30 Nov 2022--
43blueway.softwareGandi SAS30 Nov 2022--
44blueway.linkAmazon Registrar, Inc.1 Mar 202214 Apr 20241 Mar 2024
45blueway.co.kr-19 Mar 20079 Apr 202119 Mar 2023
46blueway.taipeiNet-Chinese Co., Ltd.26 Dec 20223 Jan 202426 Dec 2023
47blueway.appCloudFlare, Inc.19 Apr 202024 May 202619 Apr 2027
48blueway.ca-8 Jan 201022 Feb 20268 Jan 2027
49blueway.capitalGoDaddy.com, LLC11 May 202125 Jun 202511 May 2027
50blueway.cl-8 Sep 2005-6 Oct 2026
51blueway.pl-17 Oct 20069 Dec 202317 Oct 2027
52blueway.funOVH sas24 Sep 202025 Sep 202324 Sep 2024
53blueway.ie-20 Nov 201330 Dec 202520 Nov 2026
54blueway.ae----
55blueway.co.jp--1 Jan 2026-
56blueway.jp-22 Apr 20171 May 202630 Apr 2027
57blueway.vipAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…1 Mar 20212 Mar 20241 Mar 2024
58blueway.ro-12 Jan 2026--
59blueway.clickNameCheap, Inc.17 Sep 202522 Sep 202517 Sep 2026
60blueway.meCSC Corporate Domains, Inc.30 Jan 20141 Jun 202530 Jan 2030
61blueway.nl-3 Aug 201423 May 2025-
62blueway.org.cn-3 Aug 2007-3 Aug 2026
63blueway.shopALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED28 Mar 202530 Mar 202628 Mar 2026
64blueway.ru-14 Jul 2010-14 Jul 2026
65blueway.eu----
66blueway.hu-30 Sep 2014--
67blueway.au--2 Jun 2024-
68blueway.cfdNameCheap, Inc.1 Sep 20242 Sep 20251 Sep 2026
69blueway.se-20 Sep 201215 Sep 202520 Sep 2026
70blueway.travelGoDaddy.com, LLC12 Dec 202423 Jan 202612 Dec 2025
71blueway.lolDynadot, LLC30 Jan 202511 Apr 202630 Jan 2026
72blueway.latGoDaddy.com, LLC10 Apr 202511 Apr 202610 Apr 2027
73blueway.inDynadot, LLC6 Oct 202121 Aug 20256 Oct 2028
74blueway.servicesGoDaddy.com, LLC26 Oct 202531 Oct 202526 Oct 2026
75blueway.ccOVH sas4 Nov 20254 Nov 20254 Nov 2028
76blueway.cz-14 Oct 20239 Jun 202614 Oct 2026
77blueway.uk-23 Jan 202624 Jan 202623 Jan 2027
78blueway.be-1 Sep 2003--
79blueway.xinAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…8 May 20268 May 20268 May 2027
80blueway.com.au--2 Jun 2024-
81blueway.aiGandi SAS30 Nov 202220 Jun 202530 Nov 2026
82blueway.pt-11 Oct 2021-11 Oct 2026
83bluewayinvestment.comeNom, Inc.21 Sep 201228 Sep 201221 Sep 2013
84bluewayit.com1&1 Internet AG22 Oct 201420 Feb 201822 Oct 2026
85bluewaytech.comDOMAIN NAME NETWORK PTY LTD23 Jun 202623 Jun 202623 Jun 2027
86bluewaysolutions.comGoDaddy.com, LLC10 Jan 20161 Jan 202610 Jan 2028
87bluewaytech.netName.com, Inc.30 Oct 20146 Oct 201630 Oct 2017
88bluewaysofstclair.orgNetwork Solutions, LLC14 Feb 201130 Sep 202314 Feb 2028
89bluewaystechnology.comGoDaddy.com, LLC8 Jun 20149 Jun 20158 Jun 2016
90bluewayadventures.comGoDaddy.com, LLC15 Apr 201016 Apr 202615 Apr 2027
91bluewaylogistics.netNamesilo, LLC19 Mar 202420 Mar 202519 Mar 2026
92bluewayspa.comNetwork Solutions, LLC12 Jan 201512 Jan 201512 Jan 2016
93bluewaysireland.comRegister.it SPA12 Apr 201828 Aug 202528 Aug 2027
94bluewaye.infoGoDaddy.com, LLC17 Aug 201417 Aug 201417 Aug 2015
95bluewaysireland.orgRegister.it SPA28 Aug 20142 Sep 202528 Aug 2027
96bluewayireland.comRegister.it SPA12 Apr 201812 Sep 202512 Sep 2027
97bluewayireland.netRegister.it SPA12 Apr 201812 Sep 202512 Sep 2027
98bluewayireland.orgRegister.it SPA12 Sep 20142 Jan 202612 Sep 2027
99bluewaysireland.netRegister.it SPA12 Apr 201812 Sep 202512 Sep 2027
100bluewaymedia.comTurnCommerce, Inc. DBA NameBright.com22 Mar 20252 May 202622 Mar 2027
101blueway-search.comOVH sas8 Nov 20129 Nov 20168 Nov 2018
102bluewayracing.comTucows Domains Inc.15 Nov 201319 Nov 201415 Nov 2015
103blueway-jeans.comWeb Commerce Communications Limited dba WebNic.cc6 Oct 20147 Oct 20196 Oct 2029
104bluewayleitrim.comRegister.it SPA24 Sep 201424 Sep 201424 Sep 2015
105bluewayphotography.comGoDaddy.com, LLC24 Aug 201924 Aug 201924 Aug 2021
106blueways.orgGoogle, Inc.2 Jan 202223 Dec 20252 Jan 2027
107bluewaysdrive.comGoDaddy.com, LLC28 Nov 201428 Nov 201428 Nov 2015
108bluewayresidences.comIHS Telekom, Inc.16 Dec 20149 Dec 201516 Dec 2018
109bluewayresidence.comIHS Telekom, Inc.16 Dec 20149 Dec 201516 Dec 2018
110bluewayitsolution.comBigRock Solutions Ltd.16 Dec 201416 Dec 201416 Dec 2015
111bluewayhotels.comGoDaddy.com, LLC4 Dec 20204 Dec 20204 Dec 2021
112bluewayhotel.comTurnCommerce, Inc. DBA NameBright.com3 Mar 202513 Jun 20263 Mar 2027
113bluewayaparts.comIHS Telekom, Inc.16 Dec 20149 Dec 201516 Dec 2018
114bluewayapart.comIHS Telekom, Inc.16 Dec 20149 Dec 201516 Dec 2018
115bluewaymediagroup.comLCN.COM Ltd.17 Dec 20141 Nov 201617 Dec 2017
116bluewayfreight.comGoDaddy.com, LLC23 Nov 20218 Oct 202223 Nov 2026
117bluewaygui.comBizcn.com, Inc.22 Dec 201324 Dec 201422 Dec 2015
118bluewaysearch.parisOVH sas10 Dec 201410 Nov 201610 Dec 2018
119bluewaycosmetics.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Jan 20156 Jan 20156 Jan 2016
120bluewaysolarpower.orgGoDaddy.com, LLC5 May 201016 Jul 20255 May 2025
121bluewaytransport.comGoDaddy.com, LLC17 Dec 202317 Dec 202317 Dec 2026
122bluewaydistribution.comTucows Domains Inc.1 Feb 20155 Feb 20191 Feb 2019
123bluewayyachting.comBeijing Lanhai Jiye Technology Co., Ltd24 Apr 202225 Apr 202424 Apr 2025
124bluewaystravelsbd.comPDR Ltd. d/b/a PublicDomainRegistry.com31 May 20166 Sep 201631 May 2017
125bluewaycanoemarathon.comTucows Domains Inc.22 Feb 201526 Feb 201622 Feb 2017
126bluewayads.comGoDaddy.com, LLC22 Aug 201522 Aug 201522 Aug 2016
127bluewayartalliance.orgGoDaddy.com, LLC4 Mar 201518 Apr 20264 Mar 2028
128bluewayartalliance.netGoDaddy.com, LLC4 Mar 20154 Mar 20154 Mar 2017
129bluewayartalliance.infoGoDaddy.com, LLC4 Mar 2015-4 Mar 2017
130bluewaysport.comOnlineNIC, Inc.10 Mar 201520 May 202310 Mar 2023
131bluewaylogisticsinc.comNameCheap, Inc.18 Mar 201516 Feb 202618 Mar 2029
132bluewaypartners.comMarkMonitor Inc.19 Mar 201515 Feb 202619 Mar 2027
133bluewayfinancial.comMarkMonitor Inc.19 Mar 201519 Sep 202519 Mar 2027
134blueway-manihi.comOVH sas26 Aug 201527 Aug 202526 Aug 2026
135bluewaytools.com----
136bluewayartalliance.comNameCheap, Inc.25 Mar 201523 Feb 201925 Mar 2020
137bluewaytravel.comGoDaddy.com, LLC11 Jun 202613 Jun 202611 Jun 2027
138bluewaymanagement.comOVH sas31 Aug 20157 Jul 201731 Aug 2018
139bluewaydriving.comLaunchpad, Inc.9 Apr 20159 Apr 20159 Apr 2017
140bluewaysgroup.comGoDaddy.com, LLC14 Apr 201514 Apr 202514 Apr 2027
141bluewaydc.comP.A. Viet Nam Company Limited20 Apr 201520 Apr 201520 Apr 2016
142bluewayoflife.netOVH sas6 Sep 20156 Sep 20156 Sep 2016
143bluewayoflife.comOVH sas6 Sep 20156 Sep 20156 Sep 2016
144bluewaysm.comGMO Internet Inc.24 Sep 201924 Sep 201924 Sep 2020
145bluewaynewenergy.comHello Internet Corp.22 Jun 20253 Jul 202522 Jun 2026
146bluewaywatertrails.comGoDaddy.com, LLC24 Aug 202128 Nov 202524 Aug 2026
147bluewayllc.comDomain.com, LLC1 Mar 202114 Feb 20261 Mar 2027
148bluewaywatertrails.orgGoDaddy.com, LLC24 Aug 20218 Oct 202524 Aug 2026
149bluewaywatertrails.netGoDaddy.com, LLC24 Aug 202125 Aug 202524 Aug 2026
150bluewaywatertrails.infoGoDaddy.com, LLC24 Aug 20218 Oct 202524 Aug 2026
151bluewayhix.comCSL Computer Service Langenbach GmbH d/b/a joker.c…18 May 201518 May 201518 May 2016
152bluewayexchange.comCSL Computer Service Langenbach GmbH d/b/a joker.c…18 May 201518 May 201518 May 2016
153bluewayshipping.comGoDaddy.com, LLC13 Oct 202513 Oct 202513 Oct 2030
154bluewaytravelta.comOnlineNIC, Inc.21 May 201521 May 201521 May 2016
155bluewayau.comGoDaddy.com, LLC16 Sep 201516 Sep 201516 Sep 2016
156bluewaymediagroup2.comLCN.COM Ltd.16 Sep 201519 Jun 201716 Sep 2017
157blueway-2016.winChengdu West Dimension Digital Technology Co., Ltd…22 Sep 2015-21 Sep 2016
158blueway888.comBizcn.com, Inc.6 Apr 20207 Apr 20206 Apr 2021
159bluewayhistorical.comIHS Telekom, Inc.2 Jul 20152 Jul 20172 Jul 2017
160bluewaycity.comIHS Telekom, Inc.2 Jul 20152 Jul 20172 Jul 2017
161bluewaydrivingschool.comGoDaddy.com, LLC12 Jul 201512 Jul 201512 Jul 2016
162bluewaymassages.comeNom, Inc.4 Nov 201514 Mar 20174 Nov 2017
163bluewaypowerbank.comGoDaddy.com, LLC4 Nov 20154 Nov 20154 Nov 2016
164bluewaypromosyon.comGoDaddy.com, LLC4 Nov 20154 Nov 20154 Nov 2016
165bluewayoutdoors.comNameCheap, Inc.6 Jul 20236 Jul 20236 Jul 2026
166bluewaywatersports.usNameCheap, Inc.24 Nov 20158 Dec 201623 Nov 2017
167bluewaywatersports.bizNameCheap, Inc.24 Nov 201524 Oct 201623 Nov 2017
168bluewaywatersports.neteNom, Inc.24 Nov 201523 Oct 201624 Nov 2017
169bluewaywatersports.comTurnCommerce, Inc. DBA NameBright.com10 Feb 201923 Apr 202510 Feb 2025
170bluewaysky.comBigRock Solutions Ltd.24 Nov 201529 Nov 202524 Nov 2027
171bluewaytrail.orgGoDaddy.com, LLC29 Dec 201512 Feb 202629 Dec 2027
172bluewaytrail.netGoDaddy.com, LLC29 Dec 201529 Dec 201529 Dec 2016
173bluewaytrail.infoGoDaddy.com, LLC29 Dec 201512 Feb 202629 Dec 2027
174bluewaytrail.comGoDaddy.com, LLC29 Dec 201513 Apr 202429 Dec 2026
175bluewaydrive.comNamecatch Zone LLC14 Oct 202014 Oct 202014 Oct 2021
176bluewaypaddlesurf.comNameCheap, Inc.16 Jun 201417 May 201916 Jun 2020
177bluewayssoft.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Jan 20164 Jan 201720 Jan 2018
178blueway-boat.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Feb 201627 Mar 202313 Feb 2023
179bluewaync.orgGoDaddy.com, LLC15 Feb 20161 Apr 202615 Feb 2027
180bluewaync.netGoDaddy.com, LLC15 Feb 201616 Feb 202615 Feb 2027
181bluewaync.infoGoDaddy.com, LLC15 Feb 20161 Apr 202615 Feb 2027
182bluewaync.comGoDaddy.com, LLC15 Feb 201616 Feb 202615 Feb 2028
183bluewaytours.comBlacknight Internet Solutions Ltd.3 Feb 20193 Feb 20193 Feb 2020
184bluewayatlanta.comeNom, Inc.3 Mar 20163 Mar 20163 Mar 2017
185bluewayticketmayunedr.infoGoDaddy.com, LLC5 Mar 20165 Mar 20165 Mar 2017
186bluewayhomes.comSquarespace Domains LLC24 Apr 20255 Jun 202624 Apr 2026
187bluewaysaat.comGoDaddy.com, LLC4 Apr 20164 Apr 20164 Apr 2017
188bluewaykamera.comDropCatch.com 1545 LLC22 Jun 201722 Jun 201722 Jun 2018
189bluewaynegraphics.comLaunchpad, Inc.18 Apr 20163 Apr 201718 Apr 2018
190bluewaymarketing.comWix.com Ltd.7 Nov 202417 Jan 20267 Nov 2025
191blueway-search.parisOVH sas10 Dec 20149 Nov 201610 Dec 2018
192bluewayad.com-27 Apr 201627 Apr 201627 Apr 2017
193bluewaylogistics.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…27 Apr 20057 Apr 202627 Apr 2027
194bluewaychurch.netGoDaddy.com, LLC2 May 20162 May 20162 May 2017
195bluewaychurch.infoGoDaddy.com, LLC2 May 20163 May 20172 May 2018
196bluewaychurch.comGoDaddy.com, LLC2 May 20162 May 20162 May 2017
197bluewaychurch.orgGoDaddy.com, LLC2 May 20163 May 20172 May 2018
198bluewayguvenlik.comGoDaddy.com, LLC5 May 20165 May 20165 May 2017
199bluewaypressurewashing.comGoDaddy.com, LLC6 May 20167 May 20256 May 2027
200bluewayapps.comDreamHost, LLC7 Apr 20257 Mar 20267 Apr 2027
201bluewayapp.comDropCatch.com 1066 LLC3 Jan 20264 Jan 20263 Jan 2027
202bluewaytransportation.comNeubox Internet S.A. de C.V.4 Mar 202510 Mar 20264 Mar 2027
203bluewayairlines.com----
204bluewaykamera.netGoDaddy.com, LLC24 May 201624 May 201624 May 2017
205bluewaykamera-tr.comPDR Ltd. d/b/a PublicDomainRegistry.com26 May 201626 May 201626 May 2017
206bluewaygroup.netName.com, Inc.31 Aug 202231 Jul 202531 Aug 2026
207bluewaygroup.comTurnCommerce, Inc. DBA NameBright.com31 May 20164 Nov 202531 May 2026
208bluewaytechs.comeNom, Inc.3 Jun 20163 Jun 20163 Jun 2017
209bluewayseskamera.comGoDaddy.com, LLC13 Jun 201613 Jun 201613 Jun 2017
210bluewayworld.com-16 Jun 201616 Jun 201616 Jun 2017
211bluewayvisa.comeNom, Inc.18 Jun 201618 Jun 201618 Jun 2017
212bluewaysbluegrass.comGoDaddy.com, LLC11 Sep 201911 Sep 201911 Sep 2020
213bluewaystechnology.xyzHostinger, UAB16 Jun 201621 Jun 201616 Jun 2017
214bluewayoutfitters.usNameCheap, Inc.12 Jul 201612 Jul 201711 Jul 2018
215bluewayoutfitters.neteNom, Inc.12 Jul 201612 Jul 201712 Jul 2018
216bluewayoutfitters.comNameJolt.com LLC18 Dec 202228 Feb 202418 Dec 2023
217blueway-eg.comeNom, Inc.12 Jul 201624 Aug 202512 Jul 2025
218bluewayoutfitters.bizNameCheap, Inc.12 Jul 201612 Jul 201711 Jul 2018
219bluewayadventures.bizGoDaddy.com, LLC24 Apr 201217 Apr 201723 Apr 2018
220blueways.bizeNom, Inc.8 Feb 20086 Feb 20267 Feb 2027
221bluewayne.comOnlineNIC, Inc.14 Dec 202014 Dec 202014 Dec 2021
222bluewayseskayit.comRealtime Register B.V.13 Aug 202224 Sep 202313 Aug 2023
223bluewaylive.comGoDaddy.com, LLC13 Jan 201014 Jan 202613 Jan 2027
224bluewaysoft.comNETIM SARL7 Apr 201411 Apr 20227 Apr 2027
225blueway-marketing.comELB Group Inc.7 May 201328 Apr 20167 May 2018
226bluewaytravels.comNameCheap, Inc.31 Aug 20231 Sep 202531 Aug 2026
227bluewayportal.comCSL Computer Service Langenbach GmbH d/b/a joker.c…2 Aug 201325 Jul 20252 Aug 2026
228bluewaysolarpanels.comGoDaddy.com, LLC5 May 201017 Jul 20255 May 2025
229bluewaysintl.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Sep 200311 Sep 202525 Sep 2026
230bluewaysinternational.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Dec 200715 Sep 20175 Dec 2017
231bluewaycarrental.comGoDaddy.com, LLC22 May 200923 May 202622 May 2027
232bluewaywellness.comWild West Domains, LLC13 Feb 201330 Apr 201513 Feb 2018
233blueway-cm.comOne.com A/S16 Dec 20128 Apr 202616 Dec 2026
234bluewayadventure.comTurnCommerce, Inc. DBA NameBright.com2 Sep 201212 Oct 20242 Sep 2024
235bluewaystours.comTucows Domains Inc.14 Aug 202424 Sep 202514 Aug 2025
236bluewaycreativemedia.comLCN.COM Ltd.19 May 201114 Jun 201719 May 2019
237bluewayer.comHefei Juming Network Technology Co., Ltd21 Mar 202122 Apr 202421 Mar 2024
238bluewayz.comTurnCommerce, Inc. DBA NameBright.com6 Apr 20214 Nov 20256 Apr 2027
239bluewaydevelopers.com1&1 Internet AG27 Oct 20059 Jan 202627 Oct 2025
240bluewayonline.comGoDaddy.com, LLC13 Jan 201014 Jan 202613 Jan 2027
241bluewaypaddle.comTurnCommerce, Inc. DBA NameBright.com16 Jun 201428 Aug 202416 Jun 2024
242bluewaysolarpower.comGoDaddy.com, LLC5 May 201017 Jul 20255 May 2025
243bluewaysmarine.comGoDaddy.com, LLC2 Feb 20132 Feb 20262 Feb 2027
244blueway-transport.comWild West Domains, LLC18 May 202519 May 202618 May 2027
245bluewaycompanies.comNameKing.com Inc.14 Aug 20252 Dec 202514 Aug 2026
246bluewayguide.comGoDaddy.com, LLC14 Aug 202215 Aug 202414 Aug 2026
247bluewaynews.comGoDaddy.com, LLC3 Feb 20104 Feb 20263 Feb 2027
248bluewaysoutfitters.comGoDaddy.com, LLC27 Nov 201828 Nov 202527 Nov 2026
249bluewayinc.comGoDaddy.com, LLC31 Jan 20131 Feb 202631 Jan 2028
250bluewayweb.comRegistryGate GmbH30 Nov 20121 Dec 202530 Nov 2026
251bluewaymusic.comTucows Domains Inc.13 Dec 20121 May 202613 Dec 2026
252bluewaysolar.comGoDaddy.com, LLC5 May 20108 Apr 20265 May 2027
253bluewayhost.comExclusive Domain Find LLC12 Feb 201713 Feb 201712 Feb 2018
254bluewaypools.comGoDaddy.com, LLC9 Jan 201215 Jan 20259 Jan 2027
255bluewaycanoe.comeNom, Inc.12 Feb 201213 Feb 202012 Feb 2020
256blueway1.comAlantron BiliÅŸim Ltd Åžti.12 Nov 20151 Aug 201619 Nov 2016
257bluewayclub.comTucows Domains Inc.2 Apr 20096 Apr 20232 Apr 2024
258bluewayrecycling.comSafeNames Ltd.5 Nov 200731 Dec 202429 Dec 2026
259bluewaytour.comWild West Domains, LLC13 Jul 202018 Jul 202513 Jul 2026
260blueway-lebanon.comGoDaddy.com, LLC2 Feb 201030 Jan 20262 Feb 2027
261bluewayadventuretours.comGoDaddy.com, LLC21 Feb 201413 Jun 201521 Feb 2017
262bluewaydesign.comGoDaddy.com, LLC1 Mar 20242 Mar 20261 Mar 2027
263blueway-heatpump.comXin Net Technology Corporation1 Jun 20215 May 20261 Jun 2027
264bluewaystudies.comTucows Domains Inc.8 Jan 20131 May 20268 Jan 2027
265bluewaycare.comLaunchpad, Inc.20 Dec 201018 Dec 201620 Dec 2017
266blueway-software.comGandi SAS12 Feb 201312 Jan 202612 Feb 2027
267bluewaydesigns.comGoDaddy.com, LLC1 Nov 20134 Sep 20251 Nov 2026
268bluewayconnect.comCSL Computer Service Langenbach GmbH d/b/a joker.c…2 Aug 201325 Jul 20252 Aug 2026
269bluewaykayak.comeNom, Inc.2 Sep 20127 Aug 20172 Sep 2018
270bluewayaviation.comeNom, Inc.21 Feb 20132 Jun 202621 Feb 2028
271bluewaycompany.comMijn InternetOplossing B.V.22 Jul 201022 Jul 201622 Jul 2016
272blueway-streaming.comPSI-USA, Inc. dba Domain Robot4 Feb 201015 Apr 20164 Feb 2017
273bluewaydrives.comGoDaddy.com, LLC19 Jul 201420 Jul 202419 Jul 2026
274bluewaystars.comDomaininfo AB, aka domaininfo.com24 Jul 201217 Jul 201724 Jul 2018
275bluewayrealty.comGoDaddy.com, LLC29 Jun 201030 Jun 201529 Jun 2020
276bluewaysoftware.comMarkMonitor Inc.7 Nov 200215 Apr 202517 May 2027
277bluewaylimo.comCosmotown, Inc.30 Mar 20231 Apr 202430 Mar 2024
278bluewaystudio.comFastDomain Inc.31 Dec 200516 Dec 202531 Dec 2026
279bluewaykorea.comHANGANG Systems, Inc. d/b/a doregi.com20 Dec 200217 Dec 202420 Dec 2027
280blueway-technology.comNames On The Drop LLC21 Feb 20247 May 202521 Feb 2025
281blueway-safari.comHetzner Online AG14 Dec 201013 Dec 201614 Dec 2017
282blueways.com-5 Nov 19987 Nov 20254 Nov 2027
283blueway-as.comAscio Technologies, Inc. Danmark - Filial af Ascio…6 Dec 200718 Dec 20156 Dec 2016
284bluewayhp.comHiChina Zhicheng Technology Limited4 Oct 20127 Oct 20234 Oct 2026
285blueway7shop.comGoDaddy.com, LLC12 Oct 201813 Oct 201812 Oct 2019
286bluewaykameratv.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Aug 201620 Sep 20179 Aug 2017
287bluewaykameralar.com-11 Aug 201611 Aug 201611 Aug 2017
288bluewaykameralar.net-11 Aug 201611 Aug 201611 Aug 2017
289bluewaykameradunyasi.com-16 Aug 201616 Aug 201616 Aug 2017
290bluewaykameramarket.com-16 Aug 201616 Aug 201616 Aug 2017
291bluewaykameradunyasi.net-16 Aug 201616 Aug 201616 Aug 2017
292bluewaykameramarket.net-16 Aug 201616 Aug 201616 Aug 2017
293bluewayseskayit.net-16 Aug 201616 Aug 201616 Aug 2017
294bluewayassociates.comGoDaddy.com, LLC25 Aug 201625 Aug 201625 Aug 2017
295blueway-og.comGandi SAS18 Sep 201618 Aug 201718 Sep 2018
296bluewaytoeverest.com-21 Sep 201621 Sep 201621 Sep 2017
297bluewaytrade.comGoDaddy.com, LLC20 Feb 202620 Feb 202620 Feb 2027
298bluewaytothemountains.com-6 Oct 20166 Oct 20166 Oct 2017
299bluewayadventures.infoGoDaddy.com, LLC24 Apr 201225 Apr 202624 Apr 2027
300bluewaysolar.infoGoDaddy.com, LLC5 May 201016 Jul 20255 May 2025
301bluewayseskamera.netPDR Ltd. d/b/a PublicDomainRegistry.com11 Oct 201622 Nov 201711 Oct 2017
302bluewayrentals.comTucows Domains Inc.12 Oct 201616 Oct 201912 Oct 2019
303bluewayoutfiters.comTucows Domains Inc.12 Oct 201616 Oct 201712 Oct 2017
304bluewayoutfitter.comTucows Domains Inc.12 Oct 201616 Oct 201912 Oct 2019
305bluewaykameratv.netPDR Ltd. d/b/a PublicDomainRegistry.com11 Oct 201622 Nov 201711 Oct 2017
306bluewaykameratr.netPDR Ltd. d/b/a PublicDomainRegistry.com11 Oct 201622 Nov 201711 Oct 2017
307bluewayoutfiter.comTucows Domains Inc.12 Oct 201616 Oct 201712 Oct 2017
308bluewayrental.comAutomattic Inc.17 Feb 20221 May 202417 Feb 2024
309bluewayclub.netTucows Domains Inc.2 Apr 200913 Jun 20232 Apr 2023
310bluewayco.netCrazy Domains FZ-LLC16 Jan 201216 Jan 202616 Jan 2027
311bluewaypaddlesurf.neteNom, Inc.16 Jun 201419 Jun 201716 Jun 2018
312bluewaysolarpower.netGoDaddy.com, LLC5 May 201017 Jul 20255 May 2025
313bluewaypaddle.neteNom, Inc.16 Jun 201419 Jun 201716 Jun 2018
314blueway-search.netOVH sas8 Nov 20129 Nov 20168 Nov 2018
315blueways.netRegistryGate GmbH23 Aug 200521 Nov 202523 Aug 2026
316bluewayadventures.netGoDaddy.com, LLC24 Apr 201225 Apr 202624 Apr 2027
317bluewaycorp.netFastDomain Inc.13 Jul 200827 Jul 201727 Jul 2018
318bluewayonline.netGoDaddy.com, LLC13 Jan 201014 Jan 202613 Jan 2027
319bluewaysolar.netGoDaddy.com, LLC5 May 201017 Jul 20255 May 2025
320bluewaysolarpanels.netGoDaddy.com, LLC5 May 201017 Jul 20255 May 2025
321bluewaylive.netGoDaddy.com, LLC13 Jan 201014 Jan 202613 Jan 2027
322bluewaysolar.orgGoDaddy.com, LLC5 May 201016 Jul 20255 May 2025
323bluewayadventures.orgGoDaddy.com, LLC24 Apr 201225 Apr 202624 Apr 2027
324blueway-as.orgAscio Technologies, Inc. Danmark - Filial af Ascio…6 Dec 200718 Dec 20156 Dec 2016
325bluewayguvenlik.netPDR Ltd. d/b/a PublicDomainRegistry.com26 Oct 20167 Dec 201726 Oct 2017
326blueways.de--25 Jul 2015-
327bluewayakillisaat.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Oct 201612 Dec 201731 Oct 2017
328bluewaycamera.net-1 Nov 20161 Nov 20161 Nov 2017
329bluewayotoaksesuar.net-1 Nov 20161 Nov 20161 Nov 2017
330bluewayakillisaat.net-1 Nov 20161 Nov 20161 Nov 2017
331bluewayavize.net-1 Nov 20161 Nov 20161 Nov 2017
332bluewayelfeneri.net-1 Nov 20161 Nov 20161 Nov 2017
333bluewayphone.net-1 Nov 20161 Nov 20161 Nov 2017
334bluewayoyuncak.net-1 Nov 20161 Nov 20161 Nov 2017
335bluewayotoaksesuar.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Nov 201614 Dec 20172 Nov 2017
336bluewayphone.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Nov 201614 Dec 20172 Nov 2017
337bluewayelfeneri.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Nov 201614 Dec 20172 Nov 2017
338bluewayavize.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Nov 201614 Dec 20172 Nov 2017
339bluewayoyuncak.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Nov 201614 Dec 20172 Nov 2017
340bluewayaksesuear.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Nov 201614 Dec 20172 Nov 2017
341blueway2013.com-17 Oct 201217 Oct 201217 Oct 2017
342bluewaykamerases.comDomain.com, LLC8 Nov 201611 Nov 20178 Nov 2017
343bluewaysaat.netDomain.com, LLC8 Nov 201611 Nov 20178 Nov 2017
344bluewaykameramerkezi.netDomain.com, LLC8 Nov 201611 Nov 20178 Nov 2017
345bluewaykameramerkezi.comDomain.com, LLC8 Nov 201611 Nov 20178 Nov 2017
346bluewayfoods.comGoDaddy.com, LLC15 Nov 201615 Nov 201615 Nov 2017
347bluewaykamera.orgFBS Inc.28 Nov 201629 Nov 201728 Nov 2018
348bluewayminikamera.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Dec 20163 Dec 20173 Dec 2017
349bluewayco.comGoDaddy.com, LLC28 Dec 201629 Dec 202428 Dec 2026
350bluewayexports.comGoDaddy.com, LLC8 Jan 20178 Jan 20178 Jan 2018
351bluewaysgruop.comeNom, Inc.4 Feb 20179 Jan 20184 Feb 2018
352bluewaysecuritysystem.comGoDaddy.com, LLC5 Feb 20175 Feb 20175 Feb 2018
353bluewayminikamera.netRegister.it SPA14 Feb 201714 Feb 201714 Feb 2018
354bluewaymotion.comGransy s.r.o. d/b/a subreg.cz14 Mar 2017-14 Mar 2018
355bluewaystrescarki.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.29 Mar 201729 May 201729 Mar 2018
356bluewaymikrokamera.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.4 Apr 20174 Jun 20174 Apr 2018
357bluewayusa.comTierraNet Inc. d/b/a DomainDiscover22 Oct 20204 Aug 202422 Oct 2026
358bluewaywater.comTucows Domains Inc.5 Jul 20176 Jun 20255 Jul 2026
359bluewaysconservation.comAmazon Registrar, Inc.24 Oct 202213 Nov 202524 Oct 2025
360bluewaysconservation.orgAmazon Registrar, Inc.24 Oct 202225 Oct 202524 Oct 2026
361bluewaymarine.comGMO Internet Inc.17 Sep 202318 Sep 202317 Sep 2024
362bluewayholding.comGoDaddy.com, LLC29 Sep 202230 Sep 202429 Sep 2026
363bluewaytech.de--8 Sep 2015-
364bluewayweb.co.ukRegistryGate GmbH30 Nov 201229 Nov 201730 Nov 2018
365bluewaycreativemedia.co.ukLCN.COM Ltd.19 May 201128 Apr 201719 May 2019
366bluewayscommercials.co.ukReserved1 Jul 200530 Jun 20171 Jul 2019
367bluewayscommercial.co.ukReserved1 Jul 200530 Jun 20171 Jul 2019
368blueways.co.uk-28 Mar 202226 Feb 202628 Mar 2027
369bluewaysguidline.co.uk-7 Nov 200028 Oct 20177 Nov 2018
370blueway-services.co.uk-13 Jan 201130 Dec 201713 Jan 2019
371bluewaysconsulting.co.uk-12 Dec 201515 Dec 201512 Dec 2017
372bluewaysguideline.co.uk-12 Jan 20002 Jan 201812 Jan 2019
373bluewayaccommodation.comTucows Domains Inc.12 Jan 20185 Jan 202612 Jan 2027
374bluewaystore.comGoogle, Inc.19 Mar 20254 Mar 202619 Mar 2027
375bluewaytraining.comFastDomain Inc.15 Feb 201815 Feb 201815 Feb 2019
376bluewayinfotech.comBigRock Solutions Ltd.30 May 201830 May 201830 May 2019
377bluewaydenim.comInterNetworX Ltd. & Co. KG10 Sep 202416 Dec 202510 Sep 2026
378bluewayhealth.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.2 Jul 20182 Jul 20182 Jul 2019
379bluewayondisplay.comDreamHost, LLC10 Jul 201810 Jul 201810 Jul 2019
380bluewayvn.comP.A. Viet Nam Company Limited23 Jul 201828 May 202623 Jul 2027
381bluewayvision.comBlacknight Internet Solutions Ltd.1 Aug 201814 Oct 20231 Aug 2023
382bluewayaqua.comGoDaddy.com, LLC3 Aug 20183 Aug 20183 Aug 2020
383bluewaytrucking.comGoogle, Inc.7 Aug 20187 Aug 20187 Aug 2019
384bluewaylands.comGoDaddy.com, LLC8 Aug 20189 Aug 20258 Aug 2026
385bluewayland.comGoDaddy.com, LLC8 Aug 20189 Aug 20258 Aug 2026
386bluewaytracker.comCSL Computer Service Langenbach GmbH d/b/a joker.c…24 Aug 201825 Jul 202524 Aug 2026
387bluewaydefender.comCSL Computer Service Langenbach GmbH d/b/a joker.c…24 Aug 201825 Jul 202524 Aug 2026
388bluewayaudit.comCSL Computer Service Langenbach GmbH d/b/a joker.c…24 Aug 201825 Jul 202524 Aug 2026
389bluewayreview.comWild West Domains, LLC11 Sep 201812 Sep 202511 Sep 2026
390bluewaymarmaris.comİsimtescil Bilişim A.Ş.28 Mar 202310 May 202428 Mar 2024
391bluewayyachtingmarmaris.comName.com, Inc.25 Oct 201825 Oct 201825 Oct 2019
392bluewaysbooking.comNetwork Solutions, LLC27 Oct 201827 Oct 201827 Oct 2019
393bluewayisbetter.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…20 Nov 201828 Sep 202520 Nov 2026
394blueway-saude-boa-forma.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Nov 201829 Nov 201829 Nov 2019
395bluewaysaude.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Dec 202416 Feb 20262 Dec 2026
396bluewayeducation.comNamePal.com #802325 Mar 202125 Mar 202125 Mar 2022
397bluewayedu.comGoDaddy.com, LLC5 Jan 20195 Jan 20195 Jan 2021
398bluewaypropertyservices.comBlacknight Internet Solutions Ltd.3 Feb 20193 Feb 20193 Feb 2020
399bluewaystraders.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Jun 202416 Jun 202528 Jun 2026
400bluewaysglobal.comGoDaddy.com, LLC7 Nov 20227 Nov 20257 Nov 2026
401blueways.devunited-domains AG28 Feb 201914 Apr 202628 Feb 2027
402bluewaycorp.comGoogle, Inc.21 Jun 20206 Jun 202521 Jun 2026
403bluewayproducts.comTucows Domains Inc.18 Mar 201922 Mar 202018 Mar 2020
404bluewaywaterford.comTucows Domains Inc.25 Jan 202319 Jan 202625 Jan 2027
405bluewaybbq.comDomain.com, LLC9 Apr 201922 Jun 20269 Apr 2026
406bluewayus.comGoDaddy.com, LLC12 Apr 201912 Apr 201912 Apr 2020
407bluewayfinder.comGoDaddy.com, LLC15 Dec 202015 Dec 202015 Dec 2021
408bluewayshop.comGoDaddy.com, LLC5 May 201917 Jul 20245 May 2024
409bluewayve.comGoDaddy.com, LLC17 Oct 202514 Nov 202517 Oct 2028
410bluewaybikehire.comProtocol Internet Technology Limited T/A Hosting I…18 May 201919 Apr 202618 May 2027
411bluewaybikehireclonmel.comProtocol Internet Technology Limited T/A Hosting I…18 May 201918 May 201918 May 2020
412bluewaysforyou.comRegister.it SPA21 May 201921 May 201921 May 2020
413bluewaybikehire.netRegister.it SPA26 May 201928 Jul 202526 May 2025
414blueway-play.comHiChina Zhicheng Technology Limited30 May 201930 May 201930 May 2020
415bluewayholidays.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Nov 202230 Dec 202318 Nov 2023
416bluewayclonmel.comGandi SAS25 Jun 201925 Jun 201925 Jun 2020
417bluewaysolution.comGoDaddy.com, LLC27 Jun 201927 Jun 201927 Jun 2021
418blueway2015.comNamesilo, LLC30 Jun 20191 Jul 201930 Jun 2020
419blueway2012.comPSI-USA, Inc. dba Domain Robot20 Sep 202021 Sep 202020 Sep 2021
420bluewaytechnology.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Jul 201926 Jul 202523 Jul 2026
421bluewaytrading.comGoDaddy.com, LLC31 Jul 20197 Feb 202431 Jul 2029
422bluewaycoat.comWeb Commerce Communications Limited dba WebNic.cc14 Aug 201914 Aug 201914 Aug 2020
423bluewaysphotography.comGoDaddy.com, LLC24 Aug 201924 Aug 201924 Aug 2021
424bluewaytravels.netWix.com Ltd.5 Sep 20195 Sep 20195 Sep 2020
425blueway-trading.comGoDaddy.com, LLC9 Sep 20199 Sep 20199 Sep 2020
426bluewaysstaffing.comGoDaddy.com, LLC12 Sep 201912 Sep 201912 Sep 2022
427bluewaystaffing.comGoDaddy.com, LLC12 Sep 201931 Aug 202512 Sep 2026
428blueway-qatar.comDomain.com, LLC5 Oct 20196 Oct 20255 Oct 2026
429bluewayrentacar.comRealtime Register B.V.15 Oct 201915 Oct 201915 Oct 2020
430bluewaytw.comJiangsu Bangning Science and technology Co. Ltd.16 Oct 201916 Oct 201916 Oct 2020
431bluewaydefence.comWeb Commerce Communications Limited dba WebNic.cc20 Oct 201920 Oct 201920 Oct 2020
432bluewayy.comDynadot16 LLC3 Jan 20224 Jan 20223 Jan 2023
433bluewayengineering.comGoogle, Inc.29 Oct 201914 Oct 202529 Oct 2026
434blueway1g.comNamesilo, LLC4 Sep 20224 Nov 20234 Sep 2023
435bluewaypoetryfestival.comBlacknight Internet Solutions Ltd.1 Nov 20191 Nov 20191 Nov 2020
436bluewaybusinesssolutions.comGoogle, Inc.6 Nov 20196 Nov 20196 Nov 2020
437bluewaycg2012.comAtak Domain Hosting Internet d/b/a Atak Teknoloji23 May 202223 May 202223 May 2023
438blueway-tp.comGMO Internet Inc.12 Jun 202223 Aug 202312 Jun 2023
439bluewayseuropetravel.comAscio Technologies, Inc. Danmark - Filial af Ascio…23 Nov 201923 Nov 201923 Nov 2020
440bluewaysystem.comGoDaddy.com, LLC8 Apr 20268 Apr 20268 Apr 2027
441bluewayb.comGMO Internet Inc.29 Nov 201929 Nov 201929 Nov 2020
442bluewaycapital.comGoDaddy.com, LLC5 Dec 20196 Dec 20255 Dec 2026
443bluewayturkey.comGoDaddy.com, LLC8 Dec 20198 Dec 20198 Dec 2020
444blueway-e.comChengdu West Dimension Digital Technology Co., Ltd…26 Dec 201926 Dec 201926 Dec 2027
445bluewayconsulting.comName.com, Inc.31 Aug 202231 Jul 202531 Aug 2026
446bluewaysgreekislands.comAscio Technologies, Inc. Danmark - Filial af Ascio…5 Jan 20205 Jan 20205 Jan 2021
447bluewayboats.comDomain.com, LLC6 Jan 20206 Jan 20206 Jan 2022
448bluewayboatworks.comDomain.com, LLC6 Jan 20206 Jan 20206 Jan 2022
449bluewaya.comGMO Internet Inc.9 Jan 20209 Jan 20209 Jan 2021
450bluewayv.comTucows Domains Inc.24 Apr 202429 May 202624 Apr 2027
451bluewayneinvt.comNameCheap, Inc.24 Jan 2020-24 Jan 2021
452bluewayhk.comBeijing Lanhai Jiye Technology Co., Ltd29 Jan 20202 Jun 202629 Jan 2027
453blueway-tw.comNamesilo, LLC31 Aug 20224 Nov 202331 Aug 2023
454blueway-igo.com-22 Jun 202223 Jun 202322 Jun 2024
455blueway-t.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED1 May 20212 May 20231 May 2024
456bluewayme.comKey-Systems GmbH8 Feb 202019 Jan 20268 Feb 2027
457blueway-solutions.comOne.com A/S---
458bluewaybags.comGoDaddy.com, LLC17 Feb 202017 Feb 202017 Feb 2021
459blueways.clubGoDaddy.com, LLC22 Feb 202023 Feb 202022 Feb 2021
460bluewaycoweta.comGoDaddy.com, LLC24 Feb 20207 Apr 202324 Feb 2023
461bluewaymotors.comeNom, Inc.14 Jun 20232 Jun 202614 Jun 2027
462bluewayresidency.comGoDaddy.com, LLC13 Jun 20214 Jun 202613 Jun 2027
463bluewaypoint.com-15 Jan 202616 Jan 202615 Jan 2027
464bluewayfitness.comTucows Domains Inc.23 Mar 202027 Mar 202123 Mar 2021
465bluewaycourier.comGransy s.r.o. d/b/a subreg.cz6 Apr 20206 Apr 20206 Apr 2021
466bluewayproduction.comNameCheap, Inc.14 Apr 2020-14 Apr 2021
467bluewaytechnologies.comGoDaddy.com, LLC1 May 202024 Jul 20251 May 2027
468bluewaybank.comDropCatch.com 390 LLC12 May 202613 May 202612 May 2027
469bluewaydevices.comGoServeYourDomain.com LLC26 Jul 202329 Jul 202426 Jul 2025
470bluewaymart.comGoDaddy.com, LLC5 Jun 20205 Jun 20205 Jun 2021
471bluewayltd.com1&1 Internet AG26 May 202026 May 202026 May 2021
472bluewaydigitial.comNamesilo, LLC2 Jul 20203 Jul 20202 Jul 2021
473bluewaymarkets.comNameKing.com Inc.26 Jun 20209 Sep 202426 Jun 2024
474bluewayventures.comGoDaddy.com, LLC13 Jul 202013 Jul 202013 Jul 2021
475bluewaybusiness.comProtocol Internet Technology Limited T/A Hosting I…15 Jul 202020 Sep 202415 Jul 2024
476bluewaydigital.comNetwork Solutions, LLC26 Apr 202527 Apr 202626 Apr 2027
477bluewayaquaworld.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Jul 202027 Jul 202027 Jul 2021
478bluewaytransfer.xyzFBS Inc.26 Aug 201931 Aug 201926 Aug 2020
479bluewayscruises.comDomain.com, LLC6 Sep 20206 Sep 20206 Sep 2022
480blueways.info1&1 Internet AG26 Jan 202631 Jan 202626 Jan 2027
481bluewaytrip.comGoDaddy.com, LLC31 Jul 202422 Jul 202531 Jul 2026
482bluewaysakura.comMelbourne IT, Ltd27 Sep 202027 Sep 202027 Sep 2021
483bluewaypay.comGoDaddy.com, LLC1 Oct 20201 Oct 20201 Oct 2021
484bluewayelivery.comNameCheap, Inc.21 Nov 2020-21 Nov 2021
485bluewaybrands.com1&1 Internet AG24 Nov 20206 Feb 202524 Nov 2024
486bluewaybydcw.comKey-Systems GmbH1 Dec 202030 Nov 20251 Dec 2026
487bluewayinn.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Dec 202021 Nov 20258 Dec 2026
488bluewaycarrecovery.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Mar 20253 May 202622 Mar 2026
489bluewaycargoexpress.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Dec 202024 Dec 202024 Dec 2021
490bluewaypark.comGoogle, Inc.3 Jan 202114 Feb 20263 Jan 2026
491bluewayglass.comCSL Computer Service Langenbach GmbH d/b/a joker.c…12 Jan 202112 Jan 202112 Jan 2022
492bluewaycapital.financeName.com, Inc.23 Jan 202123 Jan 202123 Jan 2022
493bluewayinsurance.comGoDaddy.com, LLC10 Feb 20219 Jan 202510 Feb 2027
494bluewaylodge.comOVH sas22 Feb 202122 Feb 202122 Feb 2022
495bluewaymarketing.lifeNamesilo, LLC22 Mar 202122 Mar 202122 Mar 2022
496blueways.techPDR Ltd. d/b/a PublicDomainRegistry.com14 Apr 202115 Apr 202614 Apr 2027
497bluewaywest.comGoDaddy.com, LLC1 May 202113 Jul 20241 May 2024
498bluewaybasketryandbeyond.comGoDaddy.com, LLC10 May 202111 May 202610 May 2027
499bluewayleisureboats.comProtocol Internet Technology Limited T/A Hosting I…14 May 202120 Jun 202514 May 2025
500bluewaywaterrentals.comGoDaddy.com, LLC12 Oct 202212 Oct 202212 Oct 2023
501bluewayvillage.infoGoDaddy.com, LLC25 May 20219 Jul 202525 May 2027
502bluewayrvvillage.infoGoDaddy.com, LLC25 May 20219 Jul 202525 May 2027
503bluewayvillage.comGoDaddy.com, LLC25 May 202126 May 202525 May 2027
504bluewayrvvillage.comGoDaddy.com, LLC25 May 202126 May 202525 May 2027
505blueway-media.comGoogle, Inc.18 Oct 20233 Oct 202518 Oct 2026
506bluewayb2b.comeNom, Inc.5 Jun 202122 Jun 20265 Jun 2026
507bluewaywaterrentals.netTucows Domains Inc.10 Jun 202121 Aug 202410 Jun 2024
508bluewayglobalexim.comHostinger, UAB25 May 202625 May 202625 May 2027
509bluewayhotelresidence.comGoogle, Inc.12 Jul 20212 Jul 202512 Jul 2026
510bluewayaquaservices.infoWild West Domains, LLC16 Jul 202116 Jul 202116 Jul 2022
511bluewayblogs.comHosting Concepts B.V. dba Openprovider13 Aug 202113 Aug 202113 Aug 2022
512bluewayscarhire.comNameCheap, Inc.15 Aug 202127 Sep 202315 Aug 2023
513bluewaysads.comNameCheap, Inc.26 Aug 2021-26 Aug 2022
514bluewayenterprises.comGoDaddy.com, LLC8 Sep 202125 Apr 20268 Sep 2029
515bluewaytrans.comGoDaddy.com, LLC17 Sep 202111 Jan 202617 Sep 2026
516bluewayinnsuiteswichitaeast.comGoDaddy.com, LLC19 Sep 202119 Sep 202119 Sep 2022
517bluewaytrans.netNameCheap, Inc.21 Sep 20212 Nov 202421 Sep 2024
518bluewaycamino.comTucows Domains Inc.14 Oct 202118 Oct 202214 Oct 2023
519bluewaytransportsystem.comGoDaddy.com, LLC1 Nov 20211 Nov 20211 Nov 2022
520bluewayconstructions.comFabulous.com Pty Ltd.15 Nov 202128 Jan 202515 Nov 2024
521bluewaytw.xyzGoDaddy.com, LLC22 Nov 202123 Nov 202322 Nov 2024
522bluewayagency.comName.com, Inc.19 Mar 202624 Apr 202619 Mar 2027
523bluewayz-tct.comGoogle, Inc.12 Jan 202229 Dec 202512 Jan 2027
524bluewayz.techGoogle, Inc.12 Jan 20223 Feb 202612 Jan 2027
525bluewayrealestate.comGoDaddy.com, LLC13 Dec 202412 Dec 202513 Dec 2026
526bluewaystagline.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…29 Jan 20229 Apr 202429 Jan 2024
527bluewayagro-allied.comGMO Internet Inc.24 Feb 20242 Apr 202524 Feb 2025
528bluewayscargo.onlineNameCheap, Inc.21 Feb 20224 Apr 202321 Feb 2023
529bluewaycn.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…16 Mar 202223 Apr 202316 Mar 2023
530bluewayartstudio.comRegister.it SPA23 Mar 202228 Mar 202623 Mar 2028
531bluewaytyresuae.comGoogle, Inc.20 Apr 202221 Apr 202420 Apr 2025
532bluewaychile.comTucows Domains Inc.6 May 202217 Jul 20236 May 2023
533bluewayanimaltransport.comPDR Ltd. d/b/a PublicDomainRegistry.com7 May 202218 Jun 20237 May 2023
534blueways-tourism.comPSI-USA, Inc. dba Domain Robot13 May 202213 Jul 202413 May 2024
535bluewayrent.comNameKing.com Inc.19 Aug 20221 Nov 202319 Aug 2023
536bluewaycycles.comGoDaddy.com, LLC1 Jun 20221 Jun 20221 Jun 2023
537bluewaycapital.netName.com, Inc.15 Dec 202328 Jan 202515 Dec 2024
538bluewaymovingca.comWix.com Ltd.4 Jun 20218 Jun 20224 Jun 2022
539bluewaycommerce.xyzAmazon Registrar, Inc.13 Jun 202227 Jul 202313 Jun 2023
540bluewaylogisticsandexpresscargo.comGoDaddy.com, LLC4 Apr 202216 Apr 20244 Apr 2025
541bluewaylogistics.in-19 Jul 20182 Sep 202519 Jul 2026
542bluewaysstudios.comGoogle, Inc.21 Jul 20221 Sep 202521 Jul 2025
543blueway-rp.comGoDaddy.com, LLC28 Jul 20229 Oct 202328 Jul 2023
544bluewaytransfer.onlineİsimtescil Bilişim A.Ş.5 Aug 20225 Aug 20225 Aug 2023
545bluewaylimpeza.com.br-27 Dec 201810 Jan 202527 Dec 2024
546bluewaysshippingandfreightservices.comWix.com Ltd.9 Aug 202219 Sep 20239 Aug 2023
547bluewayaquaservice.infoWild West Domains, LLC9 Sep 202221 Oct 20249 Sep 2024
548bluewaythecollective.comGoDaddy.com, LLC3 Oct 20224 Oct 20253 Oct 2026
549bluewayfestival.comGoDaddy.com, LLC1 Feb 20182 Feb 20261 Feb 2028
550blueways-investment.comNamesilo, LLC24 Oct 202227 Dec 202324 Oct 2023
551bluewaysystem.siteNameCheap, Inc.31 Oct 202211 Jan 202531 Oct 2024
552blueway-export.comWeb Commerce Communications Limited dba WebNic.cc5 Nov 20225 Nov 20225 Nov 2024
553bluewaylogistic.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…19 Sep 202519 Sep 202519 Sep 2026
554bluewayexpress.comSquarespace Domains LLC23 Apr 20248 Apr 202623 Apr 2027
555bluewayexim.comGoDaddy.com, LLC21 Mar 202621 Mar 202621 Mar 2027
556bluewayrv.comGoDaddy.com, LLC17 Nov 202218 Nov 202517 Nov 2026
557blueway-travel.comGoDaddy.com, LLC17 Nov 202229 Jan 202517 Nov 2024
558bluewaydelivery.comNamesilo, LLC3 Jul 20257 May 20263 Jul 2026
559blueways.coGoDaddy.com, LLC23 Nov 202223 Nov 202223 Nov 2023
560bluewaymaps.comGoDaddy.com, LLC15 Dec 202216 Dec 202515 Dec 2026
561bluewaytradingcompany.comGoDaddy.com, LLC16 Dec 202227 Jan 202416 Dec 2023
562bluewaytrails.comGoDaddy.com, LLC23 Dec 202224 Dec 202523 Dec 2026
563bluewayxpress.comNamesilo, LLC5 Jan 20236 Mar 20245 Jan 2024
564bluewayenterprise.comDomain.com, LLC25 Jan 202310 Mar 202525 Jan 2025
565bluewayconsultoria.com.br-14 Mar 20161 Mar 202514 Mar 2027
566bluewaysuites.comNics Telekomünikasyon Ticaret Ltd. Şti.1 Feb 202314 Mar 20251 Feb 2025
567bluewaybarges.comWix.com Ltd.2 Feb 20233 Jan 20252 Feb 2027
568bluewaystudios.comGoDaddy.com, LLC7 Feb 202320 Mar 20247 Feb 2024
569bluewaybookkeeping.comDreamHost, LLC13 Feb 202328 Apr 202613 Feb 2026
570bluewayinternational.comenom409, Incorporated21 Feb 20236 May 202421 Feb 2024
571bluewaypower.comDynadot, LLC30 Oct 20249 Jan 202630 Oct 2025
572bluewayconcrete.comGoDaddy.com, LLC17 Sep 201717 Sep 202517 Sep 2026
573bluewaynow.comCloudFlare, Inc.9 Oct 201719 Mar 20269 Oct 2026
574bluewaycommons.comGoDaddy.com, LLC3 May 20213 May 20253 May 2027
575bluewayecochallenge.comGoDaddy.com, LLC6 Apr 201818 Apr 20236 Apr 2024
576bluewayservices.comGoDaddy.com, LLC9 May 201910 May 20259 May 2027
577bluewaytransfer.comİsimtescil Bilişim A.Ş.26 Aug 201922 Aug 202526 Aug 2026
578blueway-eai.comName.com, Inc.10 Jan 202022 Dec 202510 Jan 2027
579bluewayfood.comCSL Computer Service Langenbach GmbH d/b/a joker.c…24 Jun 202324 Jul 202524 Jun 2025
580bluewayoasis.comGoDaddy.com, LLC17 Jun 202118 Jun 202417 Jun 2027
581bluewayrosystems.comGoDaddy.com, LLC20 Jul 202124 Jul 202520 Jul 2026
582bluewaystores.comGoDaddy.com, LLC26 Aug 20217 Nov 202326 Aug 2023
583bluewaycollective.comGoDaddy.com, LLC2 Dec 202113 Feb 20242 Dec 2023
584bluewaytrvl.comGoDaddy.com, LLC28 Feb 202228 Feb 202628 Feb 2027
585bluewayconstruction.comGoDaddy.com, LLC5 Apr 202213 Apr 20265 Apr 2027
586bluewayliguria.comTucows Domains Inc.16 Jun 202217 Jun 202416 Jun 2025
587bluewaywaterpark.ie-18 Jan 20244 Mar 202518 Jan 2025
588bluewaybranding.ieProtocol Internet Technology Limited T/A Hosting I…6 May 20203 May 20266 May 2027
589bluewaybikehire.ieProtocol Internet Technology Limited T/A Hosting I…20 May 201920 May 202620 May 2027
590bluewaylodge.ie-20 May 202115 Jun 202520 May 2030
591bluewayartstudio.ie-23 Mar 20227 May 202623 Mar 2027
592bluewaystore.infoGoDaddy.com, LLC4 Jun 20214 Jun 20234 Jun 2024
593bluewayventures.orgName.com, Inc.18 Apr 20231 Jul 202518 Apr 2025
594blueways.it-13 Nov 20163 Feb 202614 Nov 2026
595bluewayhomedesign.comNics Telekomünikasyon Ticaret Ltd. Şti.18 Apr 202329 May 202518 Apr 2025
596bluewayhome.comNics Telekomünikasyon Ticaret Ltd. Şti.18 Apr 202329 May 202518 Apr 2025
597blueways.proNameCheap, Inc.21 Apr 20232 Jun 202421 Apr 2024
598blueways.nl-17 Jun 201318 Sep 2020-
599bluewayrenovationslimited.comGoogle, Inc.26 Apr 202327 Apr 202426 Apr 2025
600bluewaydevelopment.orgTucows Domains Inc.6 Jun 201930 May 20266 Jun 2027
601bluewayusa.orgTierraNet Inc. d/b/a DomainDiscover22 Oct 20209 Aug 202422 Oct 2026
602bluewayoasis.orgGoDaddy.com, LLC17 Jun 202111 Aug 202417 Jun 2027
603bluewayex.comNameCheap, Inc.8 May 202319 Jun 20258 May 2025
604blueway789.linkAmazon Registrar, Inc.9 May 202322 Jul 20249 May 2024
605bluewaysmedia.comNetwork Solutions, LLC27 May 20239 Jul 202427 May 2024
606bluewayoffshore.comGoDaddy.com, LLC30 May 20232 Jun 202630 May 2029
607bluewayrobot.comAbove.com Pty Ltd.10 Jan 202522 Mar 202610 Jan 2026
608bluewaytrucksales.comCosmotown, Inc.16 Jun 202326 Aug 202416 Jun 2024
609bluewayfx.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…21 Jun 202326 Jun 202421 Jun 2025
610bluewayhub.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…24 Jun 202324 Jun 202324 Jun 2024
611bluewaynews.ca-3 Feb 201020 Mar 20263 Feb 2027
612bluewayrecruitment.co.uk-15 Jul 20234 Jul 202515 Jul 2026
613bluewaysailing.com1API GmbH2 Aug 202314 Sep 20252 Aug 2025
614bluewaydigital.onlineDomain.com, LLC4 Aug 202317 Sep 20244 Aug 2024
615bluewayconect.comDomain.com, LLC4 Aug 202317 Sep 20244 Aug 2024
616bluewaysignature.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…10 Aug 202325 Jun 202510 Aug 2026
617bluewaysshipping.comCosmotown, Inc.24 Aug 20234 Oct 202424 Aug 2024
618bluewayisbetter.onlinePDR Ltd. d/b/a PublicDomainRegistry.com1 Sep 20237 Nov 20241 Sep 2024
619bluewayconnects.comNameCheap, Inc.10 Sep 202322 Nov 202410 Sep 2024
620bluewaymarine.siteGMO Internet Inc.17 Sep 202317 Sep 202317 Sep 2024
621bluewayai.comDynadot, LLC30 Apr 20251 May 202630 Apr 2027
622bluewayllc.ae----
623bluewaysmarketing.comHostinger, UAB20 Oct 202321 Oct 202420 Oct 2025
624blueways888.comNetowl, Inc.30 Oct 202331 Oct 202530 Oct 2025
625blueway-agency.com1&1 Internet AG5 Nov 202317 Jan 20265 Nov 2025
626bluewayorganics.comGoDaddy.com, LLC29 Nov 202330 Nov 202529 Nov 2026
627bluewaytherapy.comGoDaddy.com, LLC30 Nov 20231 Dec 202530 Nov 2026
628blueway-design.com1&1 Internet AG22 Dec 20231 Jan 202622 Dec 2026
629blueway-digital.com1&1 Internet AG22 Dec 20231 Jan 202622 Dec 2026
630bluewaymarketing.onlineGoDaddy.com, LLC23 Dec 20234 Jan 202623 Dec 2026
631bluewaypro.comDreamHost, LLC10 Jan 202411 Feb 202610 Jan 2027
632blueway-hvac.comXin Net Technology Corporation20 Jan 202415 Jan 202620 Jan 2027
633bluewaytradingcompany.infoGoDaddy.com, LLC24 Jan 20247 Mar 202524 Jan 2025
634bluewayprinter.siteGoDaddy.com, LLC24 Jan 20247 Mar 202524 Jan 2025
635bluewayshire.comNameCheap, Inc.15 Feb 202429 Mar 202515 Feb 2025
636bluewayhydroponics.comGoDaddy.com, LLC2 Mar 20242 Mar 20242 Mar 2027
637bluewaytechnologies.inHostinger, UAB7 Mar 202414 Feb 20257 Mar 2026
638bluewaywaterford.ie-25 Jan 20235 Mar 202625 Jan 2027
639bluewayslogistics.comNordreg AB11 Jun 202512 Jun 202611 Jun 2027
640bluewayjeans.comİsimtescil Bilişim A.Ş.4 Jul 20254 Jul 20254 Jul 2027
641blueway-co.netHostinger, UAB3 Apr 20244 Apr 20253 Apr 2026
642bluewayshop.onlineHostinger, UAB9 Apr 202423 May 20259 Apr 2025
643bluewaymediagroup.co.ukYour Domain LLC23 Jun 202124 May 202523 Jun 2027
644bluewaylogistics.coGoDaddy.com, LLC16 May 201527 May 202515 May 2026
645bluewaycom.pl-5 Apr 20266 Apr 20265 Apr 2027
646bluewaysgroup.com.au--2 Jun 2024-
647bluewaystechnology.co.uk-8 Apr 20238 Apr 20238 Apr 2024
648bluewayv.netTucows Domains Inc.24 Apr 202425 Apr 202624 Apr 2027
649bluewaycell.shopNameCheap, Inc.14 Mar 202325 Apr 202414 Mar 2024
650blueways.ru-20 Jan 2012-20 Jan 2027
651bluewayhost.hu-4 May 2016--
652bluewaysoft.hu-6 Jun 2016--
653bluewaylogisticsllc.com1&1 Internet AG7 May 202419 Jun 20257 May 2025
654bluewaybikerental.comProtocol Internet Technology Limited T/A Hosting I…3 Jun 20249 Aug 20253 Jun 2025
655bluewayl0gisticsinc.comNameCheap, Inc.5 Jun 202417 Jul 20255 Jun 2025
656bluewayidiomasincompany.comSquarespace Domains LLC6 Jun 20249 Apr 20266 Jun 2029
657blueway-rdc.comGoogle, Inc.19 Jun 20244 Jun 202519 Jun 2026
658bluewayservices.netWix.com Ltd.19 Jun 202420 May 202519 Jun 2026
659bluewayenergy.comGoDaddy.com, LLC6 Jul 202429 Jun 20256 Jul 2026
660bluewayorganictherapy.comGoDaddy.com, LLC10 Jul 202411 Jul 202510 Jul 2026
661bluewaymobiles.comHostinger, UAB20 Jul 202420 Jul 202420 Jul 2027
662blueway789.comAmazon Registrar, Inc.30 Jul 202416 Jul 202530 Jul 2026
663bluewayliguria.it-6 Nov 202322 Nov 20256 Nov 2026
664bluewaydigi.siteNameCheap, Inc.6 Aug 202417 Sep 20256 Aug 2025
665bluewaydigi.comNameCheap, Inc.6 Aug 202417 Sep 20256 Aug 2025
666bluewayse.euKey-Systems GmbH---
667blueway-labs.com1&1 Internet AG25 Aug 202425 Aug 202425 Aug 2026
668bluewaylabs.com1&1 Internet AG25 Aug 202425 Aug 202425 Aug 2026
669bluewaysliving.comSquarespace Domains LLC26 Aug 202411 Aug 202526 Aug 2026
670bluewayterminal.comNamesilo, LLC3 Sep 20243 Nov 20253 Sep 2025
671bluewayvn.orgNamesilo, LLC9 Oct 202411 Nov 20259 Oct 2025
672bluewayjv.comSquarespace Domains LLC10 Oct 202410 Oct 202410 Oct 2026
673bluewayva.comGoogle, Inc.11 Oct 202426 Sep 202511 Oct 2026
674bluewaysandbyways.comGoDaddy.com, LLC23 Oct 202423 Oct 202423 Oct 2027
675bluewaypremierecourier.onlinePDR Ltd. d/b/a PublicDomainRegistry.com26 Oct 202427 Oct 202526 Oct 2026
676bluewayairline.comeNom, Inc.27 Oct 20248 Jan 202627 Oct 2025
677bluewaytrade.usGoDaddy.com, LLC10 Mar 202116 Mar 202610 Mar 2031
678bluewaystourandtravels.comCosmotown, Inc.31 Oct 202411 Dec 202531 Oct 2025
679bluewaysfinancials.comNamesilo, LLC3 Nov 20244 Jan 20263 Nov 2025
680bluewayforward.comSquarespace Domains LLC15 Nov 202431 Oct 202515 Nov 2026
681bluewaygroup.useNom, Inc.29 Jan 202413 Jan 202529 Jan 2027
682blueway-ed.orgHostinger, UAB21 Nov 202430 Oct 202521 Nov 2026
683blueway-ed.comHostinger, UAB21 Nov 202425 Oct 202521 Nov 2026
684blueways.co.inKey-Systems GmbH19 Aug 20239 Aug 202419 Aug 2025
685blueways.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…18 Mar 20261 Apr 202618 Mar 2027
686bluewaycoverages.netWix.com Ltd.13 Dec 202413 Nov 202513 Dec 2026
687bluewaypoints.com1&1 Internet AG18 Dec 20242 Mar 202618 Dec 2025
688bluewaysconsulting.comNameCheap, Inc.4 Jan 20256 Dec 20254 Jan 2027
689bluewayireland.ie-11 Sep 201427 Oct 202412 Sep 2026
690bluewayhvac.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…24 Jan 202524 Jan 202524 Jan 2028
691bluewaytruckrepair.comNameCheap, Inc.2 Feb 202516 Apr 20262 Feb 2026
692bluewaysuit.comHostinger, UAB10 Feb 202529 Apr 202610 Feb 2027
693bluewaycreative.comGoDaddy.com, LLC15 Feb 202529 Apr 202615 Feb 2026
694bluewaynewenergy.cn-21 Nov 2024-21 Nov 2026
695bluewaylandhub.mediaNamesilo, LLC28 Feb 20255 Mar 202528 Feb 2026
696blueway-europ.comDomain.com, LLC30 Apr 202520 Sep 202530 Apr 2027
697bluewaytransportationtowing.comHostinger, UAB2 May 20252 May 20252 May 2027
698bluewaylogistics.uk-12 May 202511 May 202612 May 2027
699blueway-logistics.comWild West Domains, LLC18 May 202519 May 202618 May 2027
700bluewayocean.orgPDR Ltd. d/b/a PublicDomainRegistry.com26 May 202526 May 202626 May 2027
701blueway-energy.comWeb Commerce Communications Limited dba WebNic.cc1 Jun 20252 Jun 20261 Jun 2027
702bluewaybm.comWix.com Ltd.3 Jun 20253 Jun 20253 Jun 2027
703bluewayveenterprises.comTucows Domains Inc.5 Jun 20259 Jun 20265 Jun 2027
704bluewaystn.orgGoDaddy.com, LLC27 Jun 20252 Jul 202527 Jun 2027
705bluewaypath.comPorkbun, LLC27 Jun 20259 Jul 202627 Jun 2027
706bluewaystn.comGoDaddy.com, LLC27 Jun 202510 Dec 202527 Jun 2026
707blueway-usa.comGoDaddy.com, LLC5 Jul 20255 Jul 20255 Jul 2026
708bluewayrd.comDreamHost, LLC11 Jul 202511 Jul 202511 Jul 2026
709bluewayconnections.comGoDaddy.com, LLC16 Jul 202516 Jul 202516 Jul 2026
710bluewayone.comGoDaddy.com, LLC16 Jul 20259 Mar 202616 Jul 2026
711blueway-corp.comNordreg AB12 Aug 202512 Aug 202512 Aug 2026
712blueway-labs.fr-25 Aug 202430 Sep 202525 Aug 2026
713blueway-gul.comNetwork Solutions, LLC18 Sep 202520 Sep 202518 Sep 2027
714blueway-gulf.comNetwork Solutions, LLC18 Sep 202520 Sep 202518 Sep 2027
715bluewayinvestments.com-21 Sep 202521 Sep 202521 Sep 2026
716bluewayocean.comGoDaddy.com, LLC24 Sep 202524 Sep 202524 Sep 2026
717bluewayslogistic.comNamesilo, LLC13 Oct 202530 May 202613 Oct 2026
718bluewaydeliveryint.comDynadot, LLC16 Oct 202516 Oct 202516 Oct 2026
719bluewayhorizon.comHostinger, UAB27 Oct 202527 Oct 202527 Oct 2026
720bluewaytours.com.br-2 Mar 201827 Feb 20262 Mar 2027
721bluewaystays.comGoDaddy.com, LLC10 Nov 202516 Mar 202610 Nov 2026
722bluewaylimited.comGoDaddy.com, LLC13 Nov 202514 Nov 202513 Nov 2026
723blueways.onlineCrazy Domains FZ-LLC17 Nov 202522 Nov 202517 Nov 2026
724bluewayceylon.comTucows Domains Inc.22 Nov 202522 Nov 202522 Nov 2026
725bluewaytourzanzibar.com-5 Dec 20255 Dec 20255 Dec 2026
726blueway-co.comGabia, Inc.8 Dec 20258 Dec 20258 Dec 2028
727bluewayaba.comGoDaddy.com, LLC10 Dec 202510 Dec 202510 Dec 2026
728bluewayoman.comHostinger, UAB11 Dec 202511 Dec 202511 Dec 2026
729bluewayint.comGoDaddy.com, LLC13 Dec 202513 Dec 202513 Dec 2026
730bluewayadvance.spaceHostinger, UAB19 Dec 202524 Dec 202519 Dec 2028
731bluewayadvance.systemsHostinger, UAB19 Dec 2025--
732bluewayfoundry.comNameCheap, Inc.28 Dec 202528 Dec 202528 Dec 2026
733bluewayaifoundry.comNameCheap, Inc.28 Dec 202528 Dec 202528 Dec 2026
734bluewaytransportllc.comGoogle, Inc.2 Jan 20262 Jan 20262 Jan 2027
735bluewayz.netWix.com Ltd.7 Jan 20267 Jan 20267 Jan 2027
736blueway-technologies.comPSI-USA, Inc. dba Domain Robot8 Jan 202627 Feb 20268 Jan 2027
737bluewayrhodes.comGransy s.r.o. d/b/a subreg.cz9 Jan 20269 Jan 20269 Jan 2027
738bluewayadvisory.comSquarespace Domains LLC16 Jan 202623 Jan 202616 Jan 2027
739bluewayservicos.siteHostinger, UAB21 Jan 202626 Jan 202621 Jan 2027
740bluewayservicos.onlineHostinger, UAB21 Jan 202626 Jan 202621 Jan 2027
741bluewayeurope.comKey-Systems GmbH22 Jan 20267 Feb 202622 Jan 2027
742blueways.cn????????????6 Jun 2023-6 Jun 2027
743bluewayclothing.comHostinger, UAB27 Jan 202627 Jan 202627 Jan 2029
744bluewaylojistik.comGoDaddy.com, LLC3 Feb 20263 Feb 20263 Feb 2028
745bluewayglobal.comNameCheap, Inc.11 Feb 202611 Feb 202611 Feb 2027
746bluewayzlogistics.comGoDaddy.com, LLC5 Mar 20265 Mar 20265 Mar 2027
747bluewayconsulting.co.uk-10 Mar 202610 Mar 202610 Mar 2027
748bluewaycharter.comTucows Domains Inc.21 Mar 202621 Mar 202621 Mar 2027
749bluewayexperience.comTucows Domains Inc.21 Mar 202621 Mar 202621 Mar 2027
750bluewayplumbing.comNameCheap, Inc.24 Mar 202624 Mar 202624 Mar 2027
751bluewaytv.onlineNameCheap, Inc.27 Mar 20261 Apr 202627 Mar 2027
752blueways.us-2 Apr 20261 Jun 20262 Apr 2027
753bluewayseguros.com.br-2 Apr 20267 Apr 20262 Apr 2028
754blueway-fitness.co.jp-15 Aug 20191 Sep 2025-
755bluewayinsulation.comName.com, Inc.7 Apr 20267 Apr 20267 Apr 2027
756bluewaydispatch.comGoogle, Inc.22 Apr 202622 Apr 202622 Apr 2027
757bluewaybuildersinc.comHostinger, UAB25 Apr 202625 Apr 202625 Apr 2027
758bluewayenterprises.netHostinger, UAB25 Apr 202625 Apr 202625 Apr 2027
759blueway48.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.13 May 202615 May 202613 May 2027
760bluewaysoutdoor.comCloud Yuqu LLC26 May 202626 May 202626 May 2031
761bluewayinternationalrecord.comRealtime Register B.V.27 May 202627 May 202627 May 2027
762bluewaynotary.comGoogle, Inc.29 May 202629 May 202629 May 2027
763bluewaycold.comGoogle, Inc.4 Jun 20264 Jun 20264 Jun 2027
764bluewaysavings.comCloudFlare, Inc.6 Jun 20266 Jun 20266 Jun 2027
765bluewayviagens.onlineTucows Domains Inc.10 Jun 2026-10 Jun 2027
766blueway-logistic.comDynadot, LLC15 Jun 202615 Jun 202615 Jun 2027
767bluewayoceanfoundation.orgGoogle, Inc.17 Jun 202617 Jun 202617 Jun 2027
768bluewaydems.orgHostinger, UAB23 Jun 202623 Jun 202623 Jun 2027
769bluewaylive.ca-13 Jan 201027 Feb 202613 Jan 2027
770bluewaymobility.comRegister.it SPA26 Jun 202626 Jun 202626 Jun 2027
771bluewayegypt.comHostinger, UAB28 Jun 202628 Jun 202628 Jun 2029
772bluewaywi.comGoDaddy.com, LLC8 Jul 20268 Jul 20268 Jul 2027
773bluewayturismo.comGoogle, Inc.9 Jul 20269 Jul 20269 Jul 2027

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=blueway

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now