With support for 
Keyword: BIGH
Reverse Whois » KEYWORD [bigh ] { 20,699 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | bigh.info | HiChina Zhicheng Technology Limited | 11 Nov 2017 | 11 Nov 2017 | 11 Nov 2018 |
| 2 | bigh.top | Eranet International Limited | 22 Oct 2024 | 22 Oct 2024 | 22 Oct 2025 |
| 3 | bigh.tech | 1&1 Internet AG | 15 Jan 2016 | 4 Apr 2025 | 15 Jan 2026 |
| 4 | bigh.com | GoDaddy.com, LLC | 26 Jun 1998 | 2 Jun 2025 | 1 Jun 2026 |
| 5 | bigh.xyz | GoDaddy.com, LLC | 29 Apr 2020 | 10 Jun 2024 | 29 Apr 2024 |
| 6 | bigh.wine | GoDaddy.com, LLC | 5 Apr 2016 | 20 May 2017 | 5 Apr 2019 |
| 7 | bigh.site | Network Solutions, LLC | 21 Jun 2022 | 23 Jun 2025 | 21 Jun 2026 |
| 8 | bigh.biz | LiquidNet Ltd. | 15 Jun 2016 | 15 Jun 2016 | 14 Jun 2017 |
| 9 | bigh.pro | Namesilo, LLC | 7 Mar 2025 | 12 Mar 2025 | 7 Mar 2026 |
| 10 | bigh.wang | eName Technology Co., Ltd. | 1 Mar 2016 | - | 1 Mar 2017 |
| 11 | bigh.net | Network Solutions, LLC | 19 Nov 1998 | 20 Nov 2024 | 18 Nov 2025 |
| 12 | bigh.org | Annulet LLC | 5 May 2009 | 19 Jun 2025 | 5 May 2026 |
| 13 | bigh.farm | 1&1 Internet AG | 6 Dec 2016 | 20 Jan 2025 | 6 Dec 2025 |
| 14 | bigh.online | GoDaddy.com, LLC | 6 Dec 2016 | 18 Dec 2017 | 6 Dec 2018 |
| 15 | bigh.education | GoDaddy.com, LLC | 6 Dec 2016 | 18 Dec 2017 | 6 Dec 2018 |
| 16 | bigh.amsterdam | GoDaddy.com, LLC | 6 Dec 2016 | 18 Dec 2017 | 6 Dec 2018 |
| 17 | bigh.live | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 26 Apr 2017 | 9 Oct 2017 | 26 Apr 2018 |
| 18 | bigh.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 26 Apr 2017 | 9 Oct 2017 | 26 Apr 2018 |
| 19 | bigh.co.uk | Reserved | 16 Sep 2004 | 15 Sep 2016 | 16 Sep 2018 |
| 20 | bigh.org.uk | - | 14 Mar 2018 | 19 Mar 2019 | 14 Mar 2024 |
| 21 | bigh.store | Hostinger, UAB | 22 Jan 2025 | 27 Jan 2025 | 22 Jan 2026 |
| 22 | bigh.ooo | Google, Inc. | 29 Aug 2020 | 20 Oct 2020 | 29 Aug 2021 |
| 23 | bigh.co.kr | - | 18 Jun 2013 | 17 Oct 2017 | 18 Jun 2023 |
| 24 | bigh.agency | GoDaddy.com, LLC | 3 Jun 2024 | 18 Jul 2025 | 3 Jun 2026 |
| 25 | bigh.cloud | Porkbun, LLC | 5 Aug 2022 | 5 Aug 2024 | 5 Aug 2026 |
| 26 | bigh.space | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Dec 2022 | 19 Dec 2023 | 18 Dec 2024 |
| 27 | bigh.ca | - | 3 Jan 2022 | 4 Jan 2024 | 3 Jan 2026 |
| 28 | bigh.com.cn | - | 19 Oct 2012 | - | 19 Oct 2026 |
| 29 | bigh.ink | DNSPod, Inc. | 1 Mar 2023 | 4 Mar 2024 | 1 Mar 2024 |
| 30 | bigh.ie | - | 23 Jun 2020 | 18 Jun 2025 | 23 Jun 2026 |
| 31 | bigh.in | NameCheap, Inc. | 16 Feb 2019 | 5 Oct 2024 | 16 Feb 2030 |
| 32 | bigh.it | - | 15 Apr 2015 | 1 Mar 2024 | 15 Apr 2024 |
| 33 | bigh.estate | NameCheap, Inc. | 11 Jul 2023 | 13 Jul 2025 | 11 Jul 2026 |
| 34 | bigh.asia | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 17 Oct 2023 | 24 Dec 2024 | 17 Oct 2024 |
| 35 | bigh.cfd | NameCheap, Inc. | 28 Oct 2023 | 8 Jan 2025 | 28 Oct 2024 |
| 36 | bigh.sbs | NameCheap, Inc. | 28 Oct 2023 | 8 Jan 2025 | 28 Oct 2024 |
| 37 | bigh.ru | - | 16 May 2019 | - | 16 May 2026 |
| 38 | bigh.co | GoDaddy.com, LLC | 14 Feb 2025 | 19 Feb 2025 | 14 Feb 2026 |
| 39 | bigh.ag | GoDaddy.com, LLC | 3 Jan 2024 | 17 Feb 2025 | 3 Jan 2026 |
| 40 | bigh.homes | GoDaddy.com, LLC | 12 May 2025 | 24 Jun 2025 | 12 May 2028 |
| 41 | bighotdeals.com | GoDaddy.com, LLC | 7 May 2015 | 8 May 2025 | 7 May 2027 |
| 42 | bighospitality.co.uk | - | 15 Mar 2007 | 21 Feb 2025 | 15 Mar 2026 |
| 43 | bighugelabs.com | NameCheap, Inc. | 29 Sep 2006 | 30 Aug 2024 | 29 Sep 2025 |
| 44 | bighassle.com | Network Solutions, LLC | 28 Jan 1999 | 29 Nov 2024 | 28 Jan 2026 |
| 45 | bighornnet.com | Japan Registry Services Co., Ltd. | 21 Dec 2009 | 19 Dec 2024 | 21 Dec 2025 |
| 46 | bighatseo.com | GoDaddy.com, LLC | 17 Mar 2022 | 29 May 2023 | 17 Mar 2023 |
| 47 | bighosts.com | Moniker Online Services LLC | 26 Apr 2000 | 26 Apr 2025 | 26 Apr 2026 |
| 48 | bighitterdirectory.com | Zone of Domains LLC | 21 Dec 2015 | 21 Dec 2015 | 21 Dec 2016 |
| 49 | bighatstore.com | DomainSite, Inc. | 4 Feb 2001 | 12 Jan 2023 | 4 Feb 2026 |
| 50 | bighostpower.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 Nov 2024 | 25 Jun 2025 | 2 Nov 2025 |
| 51 | bighunter.it | - | 23 Feb 2001 | 3 Jun 2025 | 29 May 2026 |
| 52 | bighunter.net | Tucows Domains Inc. | 26 Mar 2003 | 25 Mar 2025 | 26 Mar 2026 |
| 53 | bighitwords.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 18 Dec 2011 | 24 Dec 2024 | 18 Dec 2024 |
| 54 | bighow.com | NameCheap, Inc. | 14 Sep 2006 | 15 Aug 2024 | 14 Sep 2025 |
| 55 | bighappenshere.com | CSC Corporate Domains, Inc. | 5 Oct 2012 | 1 Oct 2017 | 5 Oct 2018 |
| 56 | bighoolinks.com | Name.com, Inc. | 12 Aug 2010 | 13 Jul 2012 | 12 Aug 2013 |
| 57 | bighoneydog.com | DreamHost, LLC | 16 Sep 2008 | 16 Aug 2024 | 16 Sep 2025 |
| 58 | bighonchomedia.com | Tucows Domains Inc. | 15 May 2004 | 24 Apr 2025 | 15 May 2026 |
| 59 | bighuman.com | 1&1 Internet AG | 16 Feb 2006 | 17 Feb 2017 | 16 Feb 2026 |
| 60 | bighelpers.org | Hostinger, UAB | 7 Jun 2023 | 20 Aug 2025 | 7 Jun 2025 |
| 61 | bighdwallpapers.com | NameCheap, Inc. | 30 Sep 2023 | 31 Aug 2024 | 30 Sep 2025 |
| 62 | bigheadpress.com | Network Solutions, LLC | 12 Aug 2002 | 13 Jun 2023 | 12 Aug 2025 |
| 63 | bighitads.com | Cloud Orchid, LLC | 24 Jun 2019 | 24 Jun 2019 | 24 Jun 2020 |
| 64 | bighits.com | GoDaddy.com, LLC | 23 Nov 1997 | 23 Nov 2024 | 22 Nov 2025 |
| 65 | bighairloudmouth.com | GoDaddy.com, LLC | 2 Sep 2012 | 14 Oct 2024 | 2 Sep 2025 |
| 66 | bighammer.com | Amazon Registrar, Inc. | 3 Oct 1998 | 6 May 2024 | 2 Oct 2026 |
| 67 | bighd.tv | Above.com Pty Ltd. | 9 Jan 2014 | 30 Nov 2024 | 9 Jan 2026 |
| 68 | bighdporn.com | GoDaddy.com, LLC | 13 May 2019 | 24 Jun 2025 | 13 May 2025 |
| 69 | bighdwalls.com | GoDaddy.com, LLC | 15 Sep 2013 | 27 Nov 2023 | 15 Sep 2023 |
| 70 | bighead.net | GoDaddy.com, LLC | 29 Dec 1999 | 30 Dec 2024 | 29 Dec 2025 |
| 71 | bigheadfootball.net | GoDaddy.com, LLC | 30 Mar 2013 | 11 May 2025 | 30 Mar 2025 |
| 72 | bighealthreport.com | - | 7 Apr 2025 | 8 Apr 2025 | 7 Apr 2026 |
| 73 | bigheartpet.com | CSC Corporate Domains, Inc. | 28 Jan 2014 | 24 Jan 2025 | 28 Jan 2026 |
| 74 | bighentaiporn.com | Tucows Domains Inc. | 30 Apr 2018 | 4 May 2019 | 30 Apr 2019 |
| 75 | bighero6adventure.com | GoDaddy.com, LLC | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 76 | bighero6games.org | Internet Domain Services BS Corp | 18 Oct 2019 | 2 Dec 2024 | 18 Oct 2025 |
| 77 | bighistoryproject.com | GoDaddy.com, LLC | 22 Sep 2010 | 23 Sep 2024 | 22 Sep 2025 |
| 78 | bigholler.com | Amazon Registrar, Inc. | 5 Apr 2004 | 1 Mar 2025 | 5 Apr 2026 |
| 79 | bighome.sk | - | 21 May 2013 | 1 Jun 2025 | 21 May 2026 |
| 80 | bighornhomeimprovements.com | GoDaddy.com, LLC | 6 Jan 2014 | 11 Sep 2014 | 21 Jan 2016 |
| 81 | bighornlaw.com | GoDaddy.com, LLC | 3 Jul 2013 | 4 Jul 2025 | 3 Jul 2030 |
| 82 | bighotel.com | GoDaddy.com, LLC | 9 Mar 2022 | 21 Mar 2025 | 9 Mar 2026 |
| 83 | bighouse.com.tw | - | 24 Nov 2014 | - | 24 Nov 2015 |
| 84 | bighow.org | GoDaddy.com, LLC | 2 Jun 2014 | 14 Jul 2024 | 2 Jun 2024 |
| 85 | bighungrygeek.com | FastDomain Inc. | 10 Dec 2011 | 25 Nov 2024 | 10 Dec 2025 |
| 86 | bighuglittlehug.com | DomainGetter LLC | 11 Jan 2016 | 12 Jan 2017 | 11 Jan 2018 |
| 87 | bigheng.com | GoDaddy.com, LLC | 15 Jun 2022 | 14 Jun 2025 | 15 Jun 2026 |
| 88 | bighappy.org | GoDaddy.com, LLC | 18 Jan 2017 | 23 Jan 2018 | 18 Jan 2019 |
| 89 | bighararan.ir | - | - | - | - |
| 90 | bigheart.name | - | - | - | - |
| 91 | bighockey.ua | - | - | - | - |
| 92 | bighost.ir | - | - | - | - |
| 93 | bighot.ru | - | 4 Oct 2016 | - | 4 Oct 2025 |
| 94 | bighousemediacompany.com | NetEarth One Inc. d/b/a NetEarth | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 95 | bigheartedleadership.com | 1API GmbH | 22 Oct 2014 | 23 Oct 2024 | 22 Oct 2025 |
| 96 | bigheartedleader.com | 1API GmbH | 22 Oct 2014 | 22 Sep 2015 | 22 Oct 2018 |
| 97 | bigheadedboxers.com | GlamDomains LLC | 18 Jun 2012 | 19 Jun 2017 | 18 Jun 2018 |
| 98 | bighits4u.com | GoDaddy.com, LLC | 8 Jan 2014 | 23 Jul 2025 | 8 Jan 2026 |
| 99 | bighero6game.org | eName Technology Co., Ltd. | 11 Mar 2015 | 14 May 2025 | 11 Mar 2025 |
| 100 | bighug.ca | - | 27 Dec 2006 | 26 Jan 2025 | 26 Dec 2025 |
| 101 | bighour.biz | NameKing.com Inc. | 6 Aug 2021 | 9 Aug 2021 | 6 Aug 2022 |
| 102 | bighosted.com | Dynadot, LLC | 9 Jul 2025 | 11 Jul 2025 | 9 Jul 2026 |
| 103 | bighighbluesky.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 104 | bigheadmedia.com | NameCheap, Inc. | 2 Feb 2003 | 3 Jan 2025 | 2 Feb 2026 |
| 105 | bighave.com | HiChina Zhicheng Technology Limited | 18 Mar 2016 | 9 Apr 2025 | 18 Mar 2026 |
| 106 | bighairrotatingstylerreview.com | FastDomain Inc. | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 107 | bighairandfoodiefare.com | FastDomain Inc. | 23 Oct 2014 | 8 Oct 2024 | 23 Oct 2025 |
| 108 | bighit.co.jp | - | 28 Jan 2000 | 1 Feb 2025 | - |
| 109 | bigholestube.com | NameCheap, Inc. | 25 Feb 2015 | 9 May 2025 | 25 Feb 2027 |
| 110 | bighuskerfan.com | Tucows Domains Inc. | 5 Oct 2001 | 1 Oct 2022 | 5 Oct 2025 |
| 111 | bighouseweb.com.br | - | 26 Apr 2011 | 1 Apr 2025 | 26 Apr 2026 |
| 112 | bighealthbenefits.com | GoDaddy.com, LLC | 16 Mar 2015 | 18 Mar 2015 | 16 Mar 2016 |
| 113 | bighousevc.com | NameCheap, Inc. | 24 Oct 2014 | 24 Sep 2024 | 24 Oct 2025 |
| 114 | bighorntransit.com | 1&1 Internet AG | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 115 | bighornbus.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 116 | bigheadrub.com | GoDaddy.com, LLC | 16 Jun 2025 | 16 Jun 2025 | 16 Jun 2026 |
| 117 | bigheadribrub.com | GoDaddy.com, LLC | 24 Oct 2014 | 15 Oct 2016 | 24 Oct 2017 |
| 118 | bigheadcaps.com | Wild West Domains, LLC | 24 Feb 1998 | 3 Sep 2022 | 23 Feb 2026 |
| 119 | bighappycheeks.com | GoDaddy.com, LLC | 24 May 2014 | 25 May 2015 | 24 May 2016 |
| 120 | bighugetitsmovies.com | GoDaddy.com, LLC | 24 May 2007 | 5 Aug 2025 | 24 May 2025 |
| 121 | bigheartcambodia.org | Wild West Domains, LLC | 23 Oct 2014 | 24 Oct 2017 | 23 Oct 2018 |
| 122 | bighits.info | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 123 | bighotburger.com | Name.com, Inc. | 12 May 2017 | 12 May 2017 | 12 May 2018 |
| 124 | bighenairedales.com | GoDaddy.com, LLC | 25 Feb 2018 | 26 Feb 2025 | 25 Feb 2026 |
| 125 | bighouseradio.com | NamePal.com #8019 | 10 Jun 2023 | 24 Aug 2024 | 10 Jun 2024 |
| 126 | bighawaiiisland.com | GoDaddy.com, LLC | 20 Aug 2022 | 20 Aug 2024 | 20 Aug 2026 |
| 127 | bighdesign.com | NameCheap, Inc. | 11 Dec 2024 | 11 Dec 2024 | 11 Dec 2025 |
| 128 | bighiver.com | GoDaddy.com, LLC | 28 May 2014 | 29 May 2015 | 28 May 2016 |
| 129 | bigheadhauling.com | GoDaddy.com, LLC | 29 May 2014 | 30 May 2015 | 29 May 2016 |
| 130 | bighornmountainmedicine.com | register.com, Inc. | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 131 | bighorndrones.com | Domain.com, LLC | 25 Oct 2014 | 14 Oct 2017 | 25 Oct 2018 |
| 132 | bigherogames.com | eNom, Inc. | 5 May 2017 | 5 May 2017 | 5 May 2018 |
| 133 | bighampers.com | Annulet LLC | 12 Jan 2016 | 1 Mar 2025 | 12 Jan 2026 |
| 134 | bighorncustomhomes.com | GoDaddy.com, LLC | 14 Dec 2018 | 7 Feb 2025 | 14 Dec 2026 |
| 135 | bigheadinc.org | GoDaddy.com, LLC | 27 Nov 2022 | 8 Jan 2025 | 27 Nov 2024 |
| 136 | bighp.com | NameCheap, Inc. | 31 May 2011 | 2 May 2025 | 31 May 2026 |
| 137 | bigherogames.net | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 138 | bighero6games.info | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 139 | bighudgelabs.com | Above.com Pty Ltd. | 31 Jan 2017 | 9 Jan 2018 | 31 Jan 2019 |
| 140 | bighappypanda.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 22 Oct 2021 | 23 Oct 2021 | 22 Oct 2022 |
| 141 | bighandles.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Mar 2016 | 1 Mar 2016 | 1 Mar 2017 |
| 142 | bighulabbq.com | GoDaddy.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2016 |
| 143 | bighits.biz | GoDaddy.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 25 Oct 2015 |
| 144 | bigheadfredsmaplesyrup.com | Media Elite Holdings Limited | 30 Apr 2020 | 1 May 2025 | 30 Apr 2025 |
| 145 | bigherogames.org | Name.com, Inc. | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 146 | bighealbrin.info | Wild West Domains, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 147 | bighostinganddomains.com | GoDaddy.com, LLC | 22 May 2014 | 23 May 2015 | 22 May 2016 |
| 148 | bigheadkidz.com | GoDaddy.com, LLC | 4 Jun 2013 | 5 Jun 2015 | 4 Jun 2016 |
| 149 | bighardpricks.com | Go China Domains, LLC | 21 Aug 2013 | 21 Apr 2015 | 21 Aug 2015 |
| 150 | bighornrentalandsales.com | GoDaddy.com, LLC | 14 Jul 2014 | 23 Apr 2015 | 14 Jul 2015 |
| 151 | bighometheater.com | eNom, Inc. | 21 Jun 2010 | 27 Jun 2017 | 21 Jun 2018 |
| 152 | bigheadstart.com | eNom, Inc. | 2 Nov 2011 | 1 Nov 2024 | 2 Nov 2025 |
| 153 | bighornnationalforest.com | eNom, Inc. | 9 Aug 2011 | 14 Aug 2025 | 9 Aug 2026 |
| 154 | bighouseconstruction.com | GoDaddy.com, LLC | 9 Aug 2011 | 27 Jan 2025 | 9 Aug 2034 |
| 155 | bighugh.com | TurnCommerce, Inc. DBA NameBright.com | 27 Oct 2014 | 21 Oct 2020 | 27 Oct 2025 |
| 156 | bighostingproviders.com | Internet Domain Services BS Corp | 28 Jan 2022 | 12 Dec 2024 | 28 Jan 2026 |
| 157 | bigheadedmonster.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 27 Oct 2014 | 28 Oct 2017 | 27 Oct 2018 |
| 158 | bigheadbuddha.com | Name.com, Inc. | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 159 | bighorseshow.com | GoDaddy.com, LLC | 6 Jul 2009 | 26 Jun 2014 | 6 Jul 2015 |
| 160 | bighouselittlehouse.net | Domain.com, LLC | 27 Oct 2014 | 12 Oct 2016 | 27 Oct 2017 |
| 161 | bighits.us | GoDaddy.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 25 Oct 2015 |
| 162 | bighits.org | Google, Inc. | 5 May 2023 | 18 Jul 2025 | 5 May 2028 |
| 163 | bigheadsh3.net | 1&1 Internet AG | 27 Oct 2014 | 27 Oct 2016 | 27 Oct 2017 |
| 164 | bighuskiesfans.com | GoDaddy.com, LLC | 5 Aug 2009 | 17 Oct 2024 | 5 Aug 2024 |
| 165 | bighawkeyefan.com | GoDaddy.com, LLC | 10 Aug 2009 | 22 Aug 2025 | 10 Aug 2026 |
| 166 | bighoyasfan.com | GoDaddy.com, LLC | 10 Aug 2009 | 22 Aug 2025 | 10 Aug 2026 |
| 167 | bighunger.com | GoDaddy.com, LLC | 2 Aug 2006 | 3 Aug 2025 | 2 Aug 2026 |
| 168 | bighawksfan.com | GoDaddy.com, LLC | 20 Aug 2009 | 21 Aug 2024 | 20 Aug 2025 |
| 169 | bighuntingranchesforsale.com | GoDaddy.com, LLC | 17 Mar 2013 | 1 May 2015 | 17 Mar 2016 |
| 170 | bighacks.com | GoDaddy.com, LLC | 19 Jun 2007 | 19 Jun 2024 | 19 Jun 2026 |
| 171 | bighass.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Oct 2022 | 21 Dec 2024 | 19 Oct 2024 |
| 172 | bigheartscharity.com | GoDaddy.com, LLC | 6 Mar 2012 | 6 Mar 2015 | 6 Mar 2016 |
| 173 | bigheartscharity.org | GoDaddy.com, LLC | 7 Dec 2022 | 18 Jan 2025 | 7 Dec 2024 |
| 174 | bighotporn.com | Namesilo, LLC | 31 Oct 2011 | 24 Apr 2025 | 31 Oct 2025 |
| 175 | bighail.com | Whois Networks Co., Ltd. | 29 Oct 2014 | 26 Jul 2024 | 29 Oct 2025 |
| 176 | bighike.com | GoDaddy.com, LLC | 21 Nov 2002 | 22 Nov 2024 | 21 Nov 2025 |
| 177 | bighousecafe.com | Beijing Lanhai Jiye Technology Co., Ltd | 15 May 2022 | 17 Jul 2024 | 15 May 2024 |
| 178 | bighold.com | GoDaddy.com, LLC | 1 May 2007 | 22 Jun 2025 | 1 May 2026 |
| 179 | bighir.net | Name.com, Inc. | 13 Dec 2015 | 13 Dec 2015 | 13 Dec 2016 |
| 180 | bigheatherd.com | West263 International Limited | 7 Apr 2021 | 7 Apr 2021 | 7 Apr 2022 |
| 181 | bighome.ca | - | - | - | - |
| 182 | bighope.org | GoDaddy.com, LLC | 10 May 2019 | 21 Jun 2025 | 10 May 2027 |
| 183 | bighope.ca | - | 1 Apr 2009 | 18 Jan 2013 | 1 Apr 2019 |
| 184 | bighope.net | - | 1 Dec 2023 | 1 Dec 2023 | 1 Dec 2024 |
| 185 | bighairyhunks.com | GoDaddy.com, LLC | 20 Sep 2005 | 19 Apr 2015 | 20 Sep 2015 |
| 186 | bight.me | GoDaddy.com, LLC | 15 Dec 2010 | 25 Nov 2016 | 15 Dec 2017 |
| 187 | bighappy.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Oct 1998 | 29 May 2025 | 26 Oct 2031 |
| 188 | bighugevapes.com | GoDaddy.com, LLC | 11 Jan 2015 | 7 Feb 2015 | 11 Jan 2016 |
| 189 | bighugevapor.com | GoDaddy.com, LLC | 11 Jan 2015 | 7 Feb 2015 | 11 Jan 2016 |
| 190 | bighero6.co | GoDaddy.com, LLC | 12 Jan 2015 | 21 May 2015 | 11 Jan 2016 |
| 191 | bighumanllcd.com | Go Montenegro Domains, LLC | 2 Feb 2015 | 3 Feb 2015 | 2 Feb 2016 |
| 192 | bighouse.co | GoDaddy.com, LLC | 6 Jul 2017 | 17 Jul 2025 | 5 Jul 2025 |
| 193 | bigheartclothing.com | NameCheap, Inc. | 1 Apr 2023 | 2 Apr 2024 | 1 Apr 2025 |
| 194 | bighornbluffs.com | - | 24 Sep 2024 | 24 Sep 2024 | 24 Sep 2025 |
| 195 | bightwickmedia.com | DropCatch.com 1496 LLC | 16 Jan 2018 | 16 Jan 2018 | 16 Jan 2019 |
| 196 | bighousesteak.com | Tucows Domains Inc. | 29 Oct 2014 | 2 Nov 2015 | 29 Oct 2016 |
| 197 | bighottitties.com | GoDaddy.com, LLC | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 198 | bighome365.com | HiChina Zhicheng Technology Limited | 30 Oct 2014 | 2 Jan 2018 | 30 Oct 2018 |
| 199 | bigheadtank.com | GoDaddy.com, LLC | 29 Oct 2014 | 29 Sep 2015 | 29 Oct 2017 |
| 200 | bigheadgaming.com | NameCheap, Inc. | 3 May 2025 | 3 May 2025 | 3 May 2026 |
| 201 | bigheartparnters.com | GoDaddy.com, LLC | 8 Mar 2012 | 30 Apr 2015 | 8 Mar 2016 |
| 202 | bigheartbrandsinc.com | GoDaddy.com, LLC | 8 Mar 2012 | 30 Apr 2015 | 8 Mar 2016 |
| 203 | bighula.com | $$$ Private Label Internet Service Kiosk, Inc. dba… | 7 Sep 2001 | 2 Jan 2025 | 7 Sep 2025 |
| 204 | bighemp.com | GoDaddy.com, LLC | 27 Sep 2006 | 28 Sep 2024 | 27 Sep 2025 |
| 205 | bighiit.com | Gransy s.r.o. d/b/a subreg.cz | 23 Feb 2023 | 7 Apr 2024 | 23 Feb 2024 |
| 206 | bigheadproducts.com | DropCatch.com 544 LLC | 26 Mar 2016 | 27 Mar 2017 | 26 Mar 2018 |
| 207 | bighousemeats.net | GoDaddy.com, LLC | 4 Sep 2008 | 16 Aug 2015 | 4 Sep 2017 |
| 208 | bighometools.info | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2014 | 29 Oct 2015 |
| 209 | bighooha.com | eNom, Inc. | 10 Sep 2013 | 21 Dec 2016 | 10 Sep 2017 |
| 210 | bighumanlabs.com | GoDaddy.com, LLC | 26 Aug 2014 | 28 Aug 2014 | 26 Aug 2015 |
| 211 | bighollywoodlaw.com | Domain.com, LLC | 30 Oct 2014 | 31 Oct 2014 | 30 Oct 2015 |
| 212 | bighollywoodcase.com | Domain.com, LLC | 30 Oct 2014 | 31 Oct 2014 | 30 Oct 2015 |
| 213 | bighitcomics.com | Network Solutions, LLC | 30 Oct 2014 | 17 May 2024 | 30 Oct 2026 |
| 214 | bigheartsclub.com | TurnCommerce, Inc. DBA NameBright.com | 17 Jan 2017 | 29 Mar 2025 | 17 Jan 2025 |
| 215 | bighousewifetube.com | GoDaddy.com, LLC | 14 Jul 2008 | 24 Aug 2024 | 14 Jul 2024 |
| 216 | bightwickmedia.org | Tucows Domains Inc. | 30 Oct 2014 | 3 Nov 2017 | 30 Oct 2018 |
| 217 | bightwickmedia.net | Tucows Domains Inc. | 30 Oct 2014 | 3 Nov 2017 | 30 Oct 2017 |
| 218 | bigharbor.net | - | 25 Sep 2013 | 25 Sep 2013 | 25 Sep 2017 |
| 219 | bighousegis.info | Tucows Domains Inc. | 27 Oct 2013 | 31 Oct 2014 | 27 Oct 2015 |
| 220 | bighollywoodlaw.net | Domain.com, LLC | 30 Oct 2014 | 31 Oct 2014 | 30 Oct 2015 |
| 221 | bighollywoodcase.net | Domain.com, LLC | 30 Oct 2014 | 31 Oct 2014 | 30 Oct 2015 |
| 222 | bighornlodge.com | eNom, Inc. | 27 Feb 2000 | 8 Mar 2025 | 27 Feb 2026 |
| 223 | bighorn-canada.com | Go France Domains, LLC | 17 Jan 2012 | 27 Jan 2015 | 17 Jan 2016 |
| 224 | bighunts.us | GoDaddy.com, LLC | 29 Apr 2002 | 21 Apr 2017 | 28 Apr 2018 |
| 225 | bighunt.us | GoDaddy.com, LLC | 29 Apr 2002 | 21 Apr 2017 | 28 Apr 2018 |
| 226 | bighostin.com | GoDaddy.com, LLC | 19 Dec 2013 | 4 May 2015 | 19 Dec 2015 |
| 227 | bigheadwebhost.com | eNom, Inc. | 9 Jan 2013 | 11 Dec 2024 | 9 Jan 2026 |
| 228 | bighornmountainmen.com | Tucows Domains Inc. | 28 Oct 2004 | 29 Oct 2024 | 28 Oct 2025 |
| 229 | bighalo.com | Realtime Register B.V. | 24 Aug 2020 | 21 Aug 2024 | 24 Aug 2025 |
| 230 | bighitvapors.com | GoDaddy.com, LLC | 1 Jul 2016 | 1 Jul 2016 | 1 Jul 2017 |
| 231 | bighornrentals.com | GoDaddy.com, LLC | 3 Jan 1998 | 4 Nov 2024 | 3 Nov 2025 |
| 232 | bigheartsfund.org | Dynadot, LLC | 8 May 2010 | 22 Jun 2025 | 8 May 2027 |
| 233 | bigheadsoccer.net | - | 17 Jun 2025 | 17 Jun 2025 | 17 Jun 2026 |
| 234 | bighips.com | GoDaddy.com, LLC | 18 May 2002 | 5 Aug 2025 | 18 May 2026 |
| 235 | bighitvapor.com | GoDaddy.com, LLC | 18 Feb 2025 | 18 Feb 2025 | 18 Feb 2026 |
| 236 | bighornedsheep.com | GoDaddy.com, LLC | 23 Apr 2012 | 5 May 2015 | 23 Apr 2016 |
| 237 | bighatprinting.com | GoDaddy.com, LLC | 15 Sep 2012 | 16 Sep 2014 | 15 Sep 2015 |
| 238 | bighas.com | GMO Internet Inc. | 5 Oct 2016 | 5 Sep 2024 | 5 Oct 2025 |
| 239 | bighornygirls.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 240 | bighughlabs.com | GoDaddy.com, LLC | 17 Dec 2018 | 17 Dec 2018 | 17 Dec 2019 |
| 241 | bighairynews.com | GoDaddy.com, LLC | 14 Jul 2004 | 14 Jul 2025 | 14 Jul 2026 |
| 242 | bigharrydeals.com | GoDaddy.com, LLC | 18 Apr 2022 | 18 Apr 2022 | 18 Apr 2023 |
| 243 | bighairantennas.com | GoDaddy.com, LLC | 16 Apr 2005 | 5 Sep 2022 | 16 Apr 2028 |
| 244 | bighornmountains.com | Tucows Domains Inc. | 18 Nov 1998 | 16 Nov 2024 | 17 Nov 2025 |
| 245 | bigheartpetvalentines.com | Dynadot, LLC | 28 Jan 2025 | 11 Jul 2025 | 28 Jan 2026 |
| 246 | bighorn.biz | NameCheap, Inc. | 18 Jun 2016 | 21 Jun 2020 | 17 Jun 2021 |
| 247 | bighollywoodlaw.org | Domain.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 248 | bighollywoodcase.org | Domain.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 249 | bigheartsun.org | Wild West Domains, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 250 | bigheadotm.us | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2016 | 29 Oct 2017 |
| 251 | bighollowguitars.com | GoDaddy.com, LLC | 14 Dec 2002 | 12 Sep 2023 | 15 Sep 2025 |
| 252 | bighealtharticles.com | Namesilo, LLC | 28 Jan 2018 | 16 Apr 2025 | 28 Jan 2026 |
| 253 | bigheadbullies.com | Google, Inc. | 10 Aug 2020 | 26 Jul 2025 | 10 Aug 2026 |
| 254 | bighumanprojects.com | 1&1 Internet AG | 27 Jun 2012 | 19 Feb 2018 | 27 Jun 2026 |
| 255 | bighousegames.com | GoDaddy.com, LLC | 12 Mar 2007 | 19 Mar 2024 | 12 Mar 2026 |
| 256 | bighorsecreekfarm.com | GoDaddy.com, LLC | 28 Jan 2000 | 29 Jan 2025 | 28 Jan 2026 |
| 257 | bigheartedfamilies.org | DropCatch.com 488 LLC | 8 Dec 2024 | 18 Apr 2025 | 8 Dec 2025 |
| 258 | bighornbigsky.com | Blue Razor Domains, LLC | 10 Mar 2014 | 11 Mar 2025 | 10 Mar 2026 |
| 259 | bigheadhats.com | GoDaddy.com, LLC | 24 Apr 2004 | 25 Apr 2025 | 24 Apr 2026 |
| 260 | bighornfudge.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 May 2014 | 1 Dec 2023 | 15 May 2028 |
| 261 | bighornsheep.org | GoDaddy.com, LLC | 9 Apr 1999 | 27 Aug 2024 | 9 Apr 2027 |
| 262 | bighugllc.com | GoDaddy.com, LLC | 21 Apr 2009 | 10 Oct 2024 | 9 Oct 2025 |
| 263 | bighugsandkisses.com | GoDaddy.com, LLC | 14 Jul 2004 | 14 Jul 2025 | 14 Jul 2026 |
| 264 | bighamauto.com | Wild West Domains, LLC | 2 Apr 2024 | 3 Apr 2025 | 2 Apr 2026 |
| 265 | bighealth.net | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 6 Sep 2004 | 27 Nov 2024 | 6 Sep 2025 |
| 266 | bighorndiseaseinfo.org | Go Canada Domains, LLC | 12 Aug 2015 | 11 Jul 2016 | 12 Aug 2017 |
| 267 | bighaul.com | GoDaddy.com, LLC | 27 May 2004 | 12 Jun 2025 | 11 Jun 2027 |
| 268 | bigheartwellnesscenter.org | GoDaddy.com, LLC | 7 May 2013 | 14 Mar 2017 | 7 May 2018 |
| 269 | bighostingblog.com | Vautron Rechenzentrum AG | 14 Jun 2013 | 16 Jun 2025 | 14 Jun 2026 |
| 270 | bigharbor.org | - | 25 Sep 2013 | 25 Sep 2013 | 25 Sep 2017 |
| 271 | bighairgroup.com | Tucows Domains Inc. | 4 Jun 2014 | 8 Jun 2015 | 4 Jun 2016 |
| 272 | bighairmetal.com | GoDaddy.com, LLC | 15 Feb 2002 | 26 Jan 2025 | 15 Feb 2026 |
| 273 | bighouse.info | Mesh Digital Limited | 20 Apr 2025 | 25 Apr 2025 | 20 Apr 2026 |
| 274 | bighash.org | CloudFlare, Inc. | 15 Feb 2023 | 15 Feb 2025 | 15 Feb 2026 |
| 275 | bighare.com | TurnCommerce, Inc. DBA NameBright.com | 30 Aug 2015 | 24 Aug 2020 | 30 Aug 2025 |
| 276 | bigheadshop.com | NameCheap, Inc. | 18 Feb 2003 | 19 Jan 2025 | 18 Feb 2026 |
| 277 | bighawgs.com | register.com, Inc. | 18 Jul 2014 | 18 Jun 2025 | 18 Jul 2026 |
| 278 | bighitdomains.com | GoDaddy.com, LLC | 15 May 2015 | 16 May 2025 | 15 May 2026 |
| 279 | bighamag.com | DreamHost, LLC | 13 Aug 2013 | 24 Apr 2025 | 13 Aug 2026 |
| 280 | bighaynescreekwildlifefestival.com | Netowl, Inc. | 25 Aug 2016 | 30 Jul 2017 | 25 Aug 2018 |
| 281 | bigheartpetbrands.com | CSC Corporate Domains, Inc. | 24 Jan 2014 | 20 Jan 2025 | 24 Jan 2026 |
| 282 | bighornbeer.com | GoDaddy.com, LLC | 11 Dec 2021 | 12 Dec 2021 | 11 Dec 2022 |
| 283 | bighornmetals.com | Network Solutions, LLC | 15 Aug 2025 | 15 Aug 2025 | 15 Aug 2026 |
| 284 | bighornmountaincountry.com | Network Solutions, LLC | 7 Feb 2013 | 9 Dec 2024 | 7 Feb 2026 |
| 285 | bighugeclits.com | DropCatch.com 698 LLC | 8 Mar 2019 | 8 Mar 2019 | 8 Mar 2020 |
| 286 | bighorncinemas.com | GoDaddy.com, LLC | 5 Jan 2024 | 2 Oct 2024 | 5 Jan 2026 |
| 287 | bighouseartspace.com | GoDaddy.com, LLC | 9 Jun 2013 | 10 Jun 2015 | 9 Jun 2016 |
| 288 | bigheartpoweryoga.com | GoDaddy.com, LLC | 9 Jun 2014 | 10 Jun 2015 | 9 Jun 2016 |
| 289 | bighouseoncampus.com | GoDaddy.com, LLC | 7 Jun 2012 | 7 Jun 2015 | 7 Jun 2016 |
| 290 | bighotboobs.com | FastDomain Inc. | 22 Apr 2022 | 7 Apr 2025 | 22 Apr 2026 |
| 291 | bighorndesigns.com | 1&1 Internet AG | 12 Oct 2018 | 12 Oct 2018 | 12 Oct 2025 |
| 292 | bigheadshoe.com | Gabia, Inc. | 31 Oct 2001 | 31 Oct 2024 | 31 Oct 2025 |
| 293 | bighousesupplies.com | Amazon Registrar, Inc. | 31 Mar 2021 | 31 Mar 2021 | 31 Mar 2022 |
| 294 | bigheadedbaby.com | - | 2 Aug 2016 | 2 Aug 2016 | 2 Aug 2017 |
| 295 | bighip.com | DNC Holdings, Inc. | 26 Mar 2002 | 9 Feb 2025 | 26 Mar 2026 |
| 296 | bighorncabins.com | GoDaddy.com, LLC | 21 Jun 2002 | 30 May 2025 | 21 Jun 2026 |
| 297 | bighitsvapor.com | GoDaddy.com, LLC | 10 Jun 2013 | 10 Jun 2015 | 10 Jun 2016 |
| 298 | bighornoutfittersllc.com | GoDaddy.com, LLC | 14 Jan 2009 | 28 Feb 2025 | 14 Jan 2026 |
| 299 | bigheadtodd.com | GoDaddy.com, LLC | 10 Apr 1996 | 11 Apr 2025 | 11 Apr 2032 |
| 300 | bighorn.org | GoDaddy.com, LLC | 15 Apr 1998 | 29 May 2025 | 14 Apr 2027 |
| 301 | bighunan.com | GoDaddy.com, LLC | 31 Dec 2009 | 25 Dec 2022 | 31 Dec 2027 |
| 302 | bighornauctions.com | Tucows Domains Inc. | 22 Jan 2010 | 8 Jan 2025 | 22 Jan 2026 |
| 303 | bigheartpethalloween.com | CSC Corporate Domains, Inc. | 28 Apr 2014 | 24 Apr 2019 | 28 Apr 2020 |
| 304 | bigheartbrigade.net | - | 26 Jun 2024 | 27 Jun 2025 | 26 Jun 2026 |
| 305 | bighorsecornmaze.com | GoDaddy.com, LLC | 26 Aug 2009 | 27 Aug 2024 | 26 Aug 2025 |
| 306 | bighambrothers.com | GoDaddy.com, LLC | 24 Sep 1997 | 23 Sep 2024 | 23 Sep 2025 |
| 307 | bighattactical.com | GoDaddy.com, LLC | 27 Aug 2012 | 18 Aug 2024 | 27 Aug 2026 |
| 308 | bighow.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Mar 2017 | 1 May 2024 | 20 Mar 2024 |
| 309 | bigholetrout.com | Wix.com Ltd. | 13 May 2001 | 13 Jun 2023 | 13 May 2031 |
| 310 | bighitflashmobs.com | 1&1 Internet AG | 17 May 2013 | 18 May 2025 | 17 May 2026 |
| 311 | bigheartpetholidays.com | CSC Corporate Domains, Inc. | 28 Apr 2014 | 24 Apr 2019 | 28 Apr 2020 |
| 312 | bighornoutfitters.com | Tucows Domains Inc. | 15 Jan 2006 | 17 Dec 2024 | 15 Jan 2026 |
| 313 | bighy.com | Uniregistrar Corp | 3 Jun 2018 | 4 Jun 2025 | 3 Jun 2026 |
| 314 | bighostnow.com | GoDaddy.com, LLC | 15 Jul 2022 | 15 Jul 2022 | 15 Jul 2023 |
| 315 | bighornhomeimprovementsllc.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 316 | bighero6game.com | Name.com, Inc. | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 317 | bighellokittygames.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 318 | bighornhotel.ca | - | 15 Jun 2010 | 14 Jun 2024 | 15 Jun 2027 |
| 319 | bighousefurniture.com | GoDaddy.com, LLC | 22 May 2001 | 17 Jun 2025 | 16 Jun 2026 |
| 320 | bighubertbbq.com | GMO Internet Inc. | 1 Oct 2022 | 11 Nov 2023 | 1 Oct 2023 |
| 321 | bighanna.com | - | 28 Apr 2008 | 27 Apr 2025 | 28 Apr 2026 |
| 322 | bighornfifthwheel.com | ! #1 Host Japan, Inc. | 29 Jul 2023 | 11 Sep 2024 | 29 Jul 2024 |
| 323 | bighornquilts.com | NameCheap, Inc. | 7 Feb 1998 | 17 Jan 2025 | 6 Feb 2026 |
| 324 | bighero6movie2014.com | GoDaddy.com, LLC | 8 Feb 2016 | 8 Feb 2016 | 8 Feb 2017 |
| 325 | bighorncountynews.com | Network Solutions, LLC | 24 Nov 1998 | 24 Sep 2024 | 23 Nov 2025 |
| 326 | bighammer.net | Network Solutions, LLC | 27 Sep 2002 | 29 Jul 2024 | 27 Sep 2025 |
| 327 | bighatmarketing.com | Google, Inc. | 5 Jun 2019 | 22 May 2025 | 5 Jun 2026 |
| 328 | bighanaexperts.com | GoDaddy.com, LLC | 4 Nov 2014 | 5 Nov 2014 | 4 Nov 2015 |
| 329 | bighanaexpert.com | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 330 | bighorseicehouse.info | GoDaddy.com, LLC | 12 Jun 2012 | 24 Jun 2015 | 12 Jun 2016 |
| 331 | bighorseicehouse.com | GoDaddy.com, LLC | 12 Jun 2012 | 13 Jun 2015 | 12 Jun 2016 |
| 332 | bigheadpeople.info | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 333 | bigheadscientists.com | GoDaddy.com, LLC | 13 Jun 2019 | 14 Jun 2025 | 13 Jun 2026 |
| 334 | bigheartsofgeorgia.com | register.com, Inc. | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 335 | bighero7.com | 1API GmbH | 18 Aug 2014 | 21 Sep 2015 | 18 Aug 2018 |
| 336 | bighistorymusic.com | Dynadot, LLC | 21 Nov 2018 | 21 Nov 2018 | 21 Nov 2019 |
| 337 | bighornproductions.com | Squarespace Domains LLC | 2 Jan 2023 | 18 Dec 2024 | 2 Jan 2026 |
| 338 | bighorntactical.com | GoDaddy.com, LLC | 15 Nov 2018 | 15 Oct 2022 | 15 Nov 2028 |
| 339 | bighammerwelding.com | GoDaddy.com, LLC | 18 Jun 2014 | 18 Jun 2015 | 18 Jun 2016 |
| 340 | bighumdingershop.us | GoDaddy.com, LLC | 18 Jun 2014 | 18 Jun 2014 | 17 Jun 2015 |
| 341 | bighumdinger.us | GoDaddy.com, LLC | 18 Jun 2014 | 18 Jun 2014 | 17 Jun 2015 |
| 342 | bighumdinger.biz | GoDaddy.com, LLC | 18 Jun 2014 | 18 Jun 2014 | 17 Jun 2015 |
| 343 | bighumdinger.org | GoDaddy.com, LLC | 18 Jun 2014 | 30 Jun 2015 | 18 Jun 2016 |
| 344 | bighumdinger.info | GoDaddy.com, LLC | 18 Jun 2014 | 18 Jun 2015 | 18 Jun 2016 |
| 345 | bighockeyfan.com | GoDaddy.com, LLC | 19 Jun 2014 | 19 Jun 2015 | 19 Jun 2016 |
| 346 | bighumdinger.net | GoDaddy.com, LLC | 18 Jun 2014 | 19 Jun 2015 | 18 Jun 2016 |
| 347 | bighumdingershop.com | GoDaddy.com, LLC | 18 Jun 2014 | 19 Jun 2015 | 18 Jun 2016 |
| 348 | bighumdingershop.net | GoDaddy.com, LLC | 18 Jun 2014 | 19 Jun 2015 | 18 Jun 2016 |
| 349 | bighedappz.com | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 350 | bighollywoodlashes.com | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2019 |
| 351 | bighonkk.com | Tucows Domains Inc. | 2 Dec 2013 | 23 Apr 2025 | 2 Dec 2025 |
| 352 | bighoption.com | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 353 | bighouseconverters.com | Vitalwerks Internet Solutions, LLC DBA No-IP | 19 Aug 2014 | 6 Aug 2018 | 20 Aug 2019 |
| 354 | bighouseguitars.com | Launchpad, Inc. | 7 Dec 2017 | 22 Nov 2024 | 7 Dec 2025 |
| 355 | bigheartsbiggerresults.com | GoDaddy.com, LLC | 19 Jun 2014 | 20 Jun 2015 | 19 Jun 2016 |
| 356 | bigheartsbigresults.com | GoDaddy.com, LLC | 19 Jun 2014 | 20 Jun 2015 | 19 Jun 2016 |
| 357 | bighewdiscounts.com | 1&1 Internet AG | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 358 | bigherosex.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 359 | bigheartsandfreespirits.com | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 360 | bighairbiggercloset.com | GoDaddy.com, LLC | 5 Nov 2014 | 6 Nov 2024 | 5 Nov 2025 |
| 361 | bighoverboard.com | Dynadot, LLC | 7 Feb 2022 | 7 Feb 2022 | 7 Feb 2023 |
| 362 | bighovercraft.com | GoDaddy.com, LLC | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 363 | bighovercrafts.com | GoDaddy.com, LLC | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 364 | bighappylifeevents.com | GoDaddy.com, LLC | 25 Jun 2015 | 25 Jun 2025 | 25 Jun 2026 |
| 365 | bighitbreaks.net | Tucows Domains Inc. | 21 Aug 2013 | 25 Aug 2017 | 21 Aug 2017 |
| 366 | bighappyinbox.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2016 | 20 Aug 2017 |
| 367 | bigheadradio.net | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 368 | bighero6photos.com | eNom, Inc. | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 369 | bighitees.com | GoDaddy.com, LLC | 20 Aug 2014 | 22 Sep 2024 | 20 Aug 2024 |
| 370 | bighom.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Jan 2024 | 2 Apr 2025 | 25 Jan 2026 |
| 371 | bighom.net | HiChina Zhicheng Technology Limited | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 372 | bighugeasses.info | GMO Internet Inc. | 19 Sep 2023 | 31 Oct 2024 | 19 Sep 2024 |
| 373 | bigherscore.info | Dynadot, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 374 | bigholland.com | Key-Systems GmbH | 3 Apr 2015 | 8 May 2017 | 3 Apr 2018 |
| 375 | bighornmalamutekennels.com | register.com, Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 376 | bighousegym.net | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2018 |
| 377 | bightu8.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 378 | bighousehunters.com | GoDaddy.com, LLC | 16 Aug 2019 | 16 Aug 2019 | 16 Aug 2020 |
| 379 | bighomesolutionsseller.com | Wild West Domains, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 380 | bighomesolutionsbuyers.com | Wild West Domains, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 381 | bighogbbq.com | GoDaddy.com, LLC | 7 Nov 2014 | 19 Feb 2025 | 7 Nov 2025 |
| 382 | bighistorybuff.com | NameCheap, Inc. | 6 Nov 2014 | 25 Jan 2018 | 6 Nov 2018 |
| 383 | bigheartsandfreespirits.org | GoDaddy.com, LLC | 5 Nov 2014 | 6 Nov 2017 | 5 Nov 2018 |
| 384 | bigheartproductions.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 385 | bighandillustration.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Feb 2015 | 21 Feb 2017 | 28 Feb 2018 |
| 386 | bigheadcustoms.com | DomainPeople, Inc. | 21 Mar 2022 | 5 Mar 2025 | 21 Mar 2028 |
| 387 | bigheadedgeek.com | GoDaddy.com, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2020 |
| 388 | bighistoryu.com | GoDaddy.com, LLC | 28 Feb 2015 | 1 Mar 2025 | 28 Feb 2026 |
| 389 | bighouse.org | GoDaddy.com, LLC | 14 Apr 2015 | 5 Jan 2025 | 14 Apr 2026 |
| 390 | bigheartedgamers.com | GoDaddy.com, LLC | 23 Aug 2014 | 24 Aug 2024 | 23 Aug 2029 |
| 391 | bigheartedgamers.net | GoDaddy.com, LLC | 23 Aug 2014 | 24 Aug 2024 | 23 Aug 2025 |
| 392 | bigheartmarketing.com | Google, Inc. | 25 Feb 2018 | 10 Feb 2025 | 25 Feb 2026 |
| 393 | bighillpoa.org | GoDaddy.com, LLC | 23 Aug 2014 | 6 Jul 2024 | 23 Aug 2025 |
| 394 | bighyforheroes.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 395 | bighotgirls.com | eNom, Inc. | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 396 | bighostserver.com | - | 2 Sep 2024 | 5 Sep 2024 | 2 Sep 2025 |
| 397 | bighiworld.com | Xin Net Technology Corporation | 12 Oct 2021 | 12 Oct 2021 | 12 Oct 2022 |
| 398 | bigheroband.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 399 | bighero6botfight.com | CSC Corporate Domains, Inc. | 7 Nov 2014 | 8 Oct 2024 | 7 Nov 2025 |
| 400 | bighairedbarbie.com | GoDaddy.com, LLC | 7 Nov 2014 | 3 Mar 2025 | 7 Nov 2025 |
| 401 | bigheadwebdesign.com | Launchpad, Inc. | 12 Aug 2014 | 25 Oct 2024 | 12 Aug 2024 |
| 402 | bighornfruit.com | Tucows Domains Inc. | 13 Jul 2014 | 12 Aug 2014 | 13 Jul 2015 |
| 403 | bighornproduce.com | Tucows Domains Inc. | 23 Jul 2014 | 12 Aug 2014 | 23 Jul 2015 |
| 404 | bighelmet.com | GoDaddy.com, LLC | 2 Feb 2017 | 1 Oct 2022 | 2 Feb 2027 |
| 405 | bighornmarket.com | DropCatch.com 1518 LLC | 10 Nov 2021 | 11 Nov 2021 | 10 Nov 2022 |
| 406 | bighornmkt.com | Tucows Domains Inc. | 24 Aug 2014 | 28 Aug 2021 | 24 Aug 2021 |
| 407 | bighence.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Nov 2014 | 8 Nov 2014 | 7 Nov 2015 |
| 408 | bighaertpet.com | eNom, Inc. | 11 Oct 2016 | 23 Nov 2017 | 11 Oct 2017 |
| 409 | bighamdentalutah.com | Name.com, Inc. | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 410 | bighatphotobooth.com | Nobel Networks | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 411 | bighch.com | GoDaddy.com, LLC | 7 Sep 2018 | 7 Sep 2018 | 7 Sep 2019 |
| 412 | bighighrecords.com | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 413 | bighogg.com | - | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2017 |
| 414 | bighoover.com | One.com A/S | 26 Aug 2014 | 27 Jul 2024 | 26 Aug 2025 |
| 415 | bighoujobs.com | GoDaddy.com, LLC | 26 Aug 2014 | 27 Aug 2016 | 26 Aug 2017 |
| 416 | bigheadsolutions.com | GoDaddy.com, LLC | 4 Oct 2023 | 5 Oct 2024 | 4 Oct 2025 |
| 417 | bigherd.org | Realtime Register B.V. | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 418 | bighornmedical.com | GoDaddy.com, LLC | 14 Aug 2014 | 21 Sep 2022 | 14 Aug 2025 |
| 419 | bighornspringandbrake.com | eNom, Inc. | 13 Aug 2014 | 15 Jul 2025 | 13 Aug 2026 |
| 420 | bigheaderic.com | Vitalwerks Internet Solutions, LLC DBA No-IP | 8 Aug 2012 | 14 Aug 2014 | 8 Aug 2015 |
| 421 | bighousebooks32.com | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2017 |
| 422 | bighangoutmusicfest.com | GMO Internet Inc. | 27 Aug 2014 | 1 Aug 2017 | 27 Aug 2018 |
| 423 | bighappydreams.com | GoDaddy.com, LLC | 27 Aug 2014 | 28 Aug 2024 | 27 Aug 2026 |
| 424 | bighappydreamsgames.com | GoDaddy.com, LLC | 27 Aug 2014 | 28 Aug 2016 | 27 Aug 2018 |
| 425 | bighollowoutdoors.com | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2016 | 28 Aug 2018 |
| 426 | bighousenumber.com | GoDaddy.com, LLC | 10 Apr 2023 | 22 May 2025 | 10 Apr 2025 |
| 427 | bigheartnews.com | GoDaddy.com, LLC | 20 Mar 2021 | 30 Apr 2024 | 20 Mar 2024 |
| 428 | bighousediscountshopping.com | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 429 | bighouseselfdefense.com | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 430 | bightfromthestart.org | GoDaddy.com, LLC | 15 Aug 2014 | 16 Aug 2014 | 15 Aug 2015 |
| 431 | bighatlarder.com | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2016 |
| 432 | bighealthylife.net | Network Solutions, LLC | 27 Aug 2014 | 25 Aug 2015 | 27 Aug 2017 |
| 433 | bighittees.com | GoDaddy.com, LLC | 25 Apr 2017 | 6 Jun 2024 | 25 Apr 2024 |
| 434 | bighornmachinery.com | Automattic Inc. | 28 Aug 2014 | 11 Feb 2025 | 28 Aug 2026 |
| 435 | bighornt.com | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 436 | bigheadofhair.com | Domain.com, LLC | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 437 | bigheartjewelry.com | NameCheap, Inc. | 9 Nov 2021 | - | 9 Nov 2022 |
| 438 | bighornrvparts.com | Wild West Domains, LLC | 10 Nov 2014 | 1 Nov 2024 | 10 Nov 2025 |
| 439 | bighavres.com | GMO Internet Inc. | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 440 | bighappylashes.com | GoDaddy.com, LLC | 18 Aug 2014 | 12 Aug 2015 | 18 Aug 2019 |
| 441 | bighornfirearmslv.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Aug 2014 | 15 Aug 2016 | 17 Aug 2017 |
| 442 | bighornlab.com | Domain.com, LLC | 17 Aug 2014 | 19 Jul 2025 | 17 Aug 2026 |
| 443 | bighornysheridan.com | GoDaddy.com, LLC | 18 Aug 2014 | 23 Nov 2024 | 18 Aug 2025 |
| 444 | bigheadenterprises.com | HiChina Zhicheng Technology Limited | 26 Oct 2018 | 27 Oct 2018 | 26 Oct 2019 |
| 445 | bighairbiggerdreams.com | VisualNames LLC | 1 Feb 2016 | 2 Feb 2017 | 1 Feb 2018 |
| 446 | bigheartmedia.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Nov 2014 | 12 Nov 2014 | 12 Nov 2015 |
| 447 | bighadad.org | GMO Internet Inc. | 11 Nov 2014 | - | 11 Nov 2015 |
| 448 | bighits4u.net | eNom, Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 449 | bighouser.com | CloudFlare, Inc. | 27 Jul 2025 | 28 Jul 2025 | 27 Jul 2027 |
| 450 | bighatlarrysonline.com | GMO Internet Inc. | 12 Sep 2014 | 20 Jul 2017 | 12 Sep 2018 |
| 451 | bighomiedeedough.com | Gandi SAS | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 452 | bighookupmail.com | eNom, Inc. | 13 Sep 2014 | 15 Aug 2017 | 13 Sep 2018 |
| 453 | bighornmodular.com | GoDaddy.com, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 454 | bighornhunting.com | DropCatch.com 882 LLC | 31 Jan 2023 | 2 Mar 2024 | 31 Jan 2024 |
| 455 | bighornatblackmountainhoa.com | GoDaddy.com, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2019 |
| 456 | bigheartedspeaker.com | 1API GmbH | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 457 | bigheartedsoul.com | 1API GmbH | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 458 | bigheartedpresenter.com | 1API GmbH | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 459 | bigheartedhealer.com | GoDaddy.com, LLC | 18 Jun 2017 | 18 Jun 2017 | 18 Jun 2018 |
| 460 | bighearteddoctor.com | 1API GmbH | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 461 | bigheartsmallliving.com | 1&1 Internet AG | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 462 | bighaat.com | GoDaddy.com, LLC | 13 Sep 2014 | 28 Jul 2025 | 13 Sep 2027 |
| 463 | bighairymen.com | GoDaddy.com, LLC | 18 Sep 2018 | 18 Sep 2024 | 18 Sep 2026 |
| 464 | bighamklarapuzzling099.com | GoDaddy.com, LLC | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 465 | bigheartsmallspace.com | 1&1 Internet AG | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 466 | bighitsent.com | GoDaddy.com, LLC | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 467 | bighostingpack.com | Moniker Online Services LLC | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 468 | bighugeprofits.com | Tucows Domains Inc. | 10 Sep 2011 | 15 Sep 2014 | 10 Sep 2015 |
| 469 | bighero6toys.com | NameCheap, Inc. | 1 Sep 2014 | 8 Jan 2018 | 1 Sep 2018 |
| 470 | bighostingreviews.com | GMO Internet Inc. | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 471 | bighousefitness.com | GoDaddy.com, LLC | 3 Jun 2021 | 15 Aug 2024 | 3 Jun 2024 |
| 472 | bighvc.com | Network Solutions, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 473 | bighealing.net | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 474 | bighour.com | TurnCommerce, Inc. DBA NameBright.com | 16 Sep 2014 | 29 Aug 2022 | 16 Sep 2025 |
| 475 | bigheartcoffee.com | GoDaddy.com, LLC | 27 Mar 2015 | 28 Mar 2025 | 27 Mar 2026 |
| 476 | bighairmetamorphosis.com | Wild West Domains, LLC | 2 Sep 2014 | 2 Aug 2024 | 2 Sep 2025 |
| 477 | bighigh.us | GoDaddy.com, LLC | 2 Sep 2014 | 3 Sep 2014 | 1 Sep 2015 |
| 478 | bightedcharivariingfk.com | eNom, Inc. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 479 | bighugeepicstory.com | GoDaddy.com, LLC | 2 Sep 2014 | 3 Sep 2016 | 2 Sep 2017 |
| 480 | bighouse168.com | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 481 | bighornyearbooks.com | Network Solutions, LLC | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2017 |
| 482 | bighomiedice.com | - | 24 Sep 2016 | 24 Sep 2016 | 24 Sep 2017 |
| 483 | bigholidaysavings.com | GoDaddy.com, LLC | 13 Nov 2016 | 13 Nov 2016 | 13 Nov 2018 |
| 484 | bighalfofthesandwich.com | GoDaddy.com, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 485 | bighero6lab.com | CSC Corporate Domains, Inc. | 15 Sep 2014 | 16 Aug 2024 | 15 Sep 2025 |
| 486 | bighero6photobomb.com | CSC Corporate Domains, Inc. | 15 Sep 2014 | 16 Aug 2024 | 15 Sep 2025 |
| 487 | bighornsurveillance.com | Tucows Domains Inc. | 12 Sep 2013 | 15 Sep 2014 | 12 Sep 2015 |
| 488 | bigheartcolorado.com | eNom, Inc. | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2016 |
| 489 | bightalks.com | 1&1 Internet AG | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 490 | bighugeblog.com | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 491 | bighearted.org | Dynadot, LLC | 16 Sep 2014 | 31 Oct 2024 | 16 Sep 2025 |
| 492 | bighousedr.com | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2016 | 18 Sep 2017 |
| 493 | bighouses.biz | Dynadot, LLC | 1 Dec 2024 | 6 Dec 2024 | 1 Dec 2025 |
| 494 | bighero6store.com | eNom, Inc. | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 495 | bighelpline.com | BigRock Solutions Ltd. | 15 Nov 2014 | 8 Jun 2025 | 15 Nov 2026 |
| 496 | bight-mtbc23xx9vy4.com | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 497 | bighappydog.com | GoDaddy.com, LLC | 7 Jul 2022 | 17 Sep 2024 | 7 Jul 2024 |
| 498 | bighappydog.net | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 499 | bighuige.com | Xin Net Technology Corporation | 12 Sep 2013 | 17 Sep 2014 | 12 Sep 2015 |
| 500 | bighousedoc.com | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2016 | 18 Sep 2017 |
| 501 | bighabbo.net | eNom, Inc. | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2019 |
| 502 | bighabbo.org | eNom, Inc. | 4 Sep 2014 | 5 Sep 2014 | 4 Sep 2015 |
| 503 | bighatsanchez.com | GoDaddy.com, LLC | 12 Feb 2017 | 12 Feb 2017 | 12 Feb 2018 |
| 504 | bigheadapp.com | GoDaddy.com, LLC | 5 Sep 2014 | 5 Sep 2016 | 5 Sep 2018 |
| 505 | bighor.com | Beijing Lanhai Jiye Technology Co., Ltd | 25 Mar 2023 | 26 May 2024 | 25 Mar 2024 |
| 506 | bighor.org | Dynadot, LLC | 4 Sep 2014 | 4 Nov 2014 | 4 Sep 2017 |
| 507 | bighornaudubon.com | GoDaddy.com, LLC | 4 Sep 2014 | 5 Sep 2024 | 4 Sep 2025 |
| 508 | bighornaudubon.org | GoDaddy.com, LLC | 4 Sep 2014 | 19 Oct 2024 | 4 Sep 2025 |
| 509 | bighornclubrealestate.com | GoDaddy.com, LLC | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 510 | bighranks.com | 1&1 Internet AG | 4 Sep 2014 | 5 Sep 2014 | 4 Sep 2015 |
| 511 | bighealing.org | eNom, Inc. | 22 May 2022 | 23 May 2025 | 22 May 2026 |
| 512 | bighnaraj.com | GoDaddy.com, LLC | 22 Oct 2022 | 3 Jan 2025 | 22 Oct 2024 |
| 513 | bighogblog.com | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2016 |
| 514 | bighunndoe.com | Gandi SAS | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 515 | bigheartsoftexas.com | GoDaddy.com, LLC | 18 Sep 2014 | 19 Sep 2024 | 18 Sep 2025 |
| 516 | bigheartstulsa.com | GoDaddy.com, LLC | 16 Nov 2014 | 14 Jul 2025 | 16 Nov 2025 |
| 517 | bigheadhundredsinfo.com | Tucows Domains Inc. | 2 Sep 2011 | 6 Sep 2014 | 2 Sep 2015 |
| 518 | bigheadhundredsinfo.net | Tucows Domains Inc. | 2 Sep 2011 | 6 Sep 2014 | 2 Sep 2015 |
| 519 | bighomesllc.com | Network Solutions, LLC | 3 Feb 2017 | 4 Jan 2025 | 3 Feb 2026 |
| 520 | bighurricanechurch.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 521 | bighearthelp.org | GoDaddy.com, LLC | 6 Mar 2024 | 17 Apr 2025 | 6 Mar 2025 |
| 522 | bighatinvestments.com | GoDaddy.com, LLC | 6 Sep 2023 | 18 Oct 2024 | 6 Sep 2024 |
| 523 | bighub.info | NameCheap, Inc. | 22 Jan 2025 | 27 Jan 2025 | 22 Jan 2026 |
| 524 | bighealthfitnessstore.com | Hongkong Domain Name Information Management Co., L… | 14 Apr 2021 | 14 Apr 2021 | 14 Apr 2022 |
| 525 | bighealthgroup.com | GoDaddy.com, LLC | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2019 |
| 526 | bighuge.org | GoDaddy.com, LLC | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2015 |
| 527 | bighorncollection.com | Network Solutions, LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 528 | bighotkey.com | Tucows Domains Inc. | 20 Sep 2014 | 24 Sep 2015 | 20 Sep 2016 |
| 529 | bighorncountry.us | Dynadot, LLC | 6 Dec 2017 | 13 Dec 2017 | 6 Dec 2018 |
| 530 | bighorncommunications.com | Dynadot, LLC | 3 Feb 2024 | 18 Feb 2025 | 3 Feb 2026 |
| 531 | bighornbeverage.com | GoDaddy.com, LLC | 17 Nov 2014 | 23 Nov 2024 | 17 Nov 2034 |
| 532 | bighensnightout.com | Crazy Domains FZ-LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 533 | bighempy.com | GoDaddy.com, LLC | 13 Feb 2018 | 14 Feb 2025 | 13 Feb 2026 |
| 534 | bighachio.biz | GMO Internet Inc. | 17 Nov 2014 | - | 16 Nov 2015 |
| 535 | bighairconsultinggroup.com | Tucows Domains Inc. | 18 Sep 2013 | 21 Sep 2014 | 18 Sep 2015 |
| 536 | bighomesinc.com | GoDaddy.com, LLC | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2016 |
| 537 | bighostbuilder.com | Moniker Online Services LLC | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 538 | bighouseoutdoorsupplies.com | GoDaddy.com, LLC | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 539 | bigheadwear.com | LiquidNet Ltd. | 24 Jun 2025 | 24 Jun 2025 | 24 Jun 2026 |
| 540 | bigharpy.com | eNom, Inc. | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 541 | bigheadgunner.com | DomainPeople, Inc. | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 542 | bigheartsforlittlepeople.com | GoDaddy.com, LLC | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2017 |
| 543 | bighelpbigsave.com | GoDaddy.com, LLC | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 544 | bighktworld.com | eNom, Inc. | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 545 | bighornpizza.com | GoDaddy.com, LLC | 9 Sep 2014 | 10 Sep 2019 | 9 Sep 2020 |
| 546 | bighouseofsmut.com | GoDaddy.com, LLC | 9 Sep 2014 | 10 Sep 2016 | 9 Sep 2017 |
| 547 | bighungryjoe.com | GMO Internet Inc. | 28 Nov 2016 | 8 Dec 2016 | 27 Nov 2017 |
| 548 | bighost24.com | Protocol Internet Technology Limited T/A Hosting I… | 1 Jan 2023 | 8 Mar 2024 | 1 Jan 2024 |
| 549 | bighostingreview.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 550 | bigheadtraydesigns.com | Tucows Domains Inc. | 3 Oct 2014 | 7 Oct 2015 | 3 Oct 2016 |
| 551 | bighunt2014.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 552 | bighugelabe.com | Hebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.… | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 553 | bighornbutte.com | Wild West Domains, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 554 | bighero6-games.com | GoDaddy.com, LLC | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 555 | bigheadscajun.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2016 |
| 556 | bighams.net | Webfusion Ltd. | 28 Apr 2023 | 25 Apr 2025 | 28 Apr 2034 |
| 557 | bighornrodeocircuit.org | GoDaddy.com, LLC | 17 Nov 2014 | 16 Nov 2016 | 17 Nov 2017 |
| 558 | bighero6toys.org | eNom, Inc. | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 559 | bighornranch.net | GoDaddy.com, LLC | 9 Jul 2018 | 20 Sep 2024 | 9 Jul 2024 |
| 560 | bighealthsupplements.com | DreamHost, LLC | 3 Oct 2014 | 5 Oct 2017 | 3 Oct 2018 |
| 561 | bighairhouse.com | Hangzhou AiMing Network Co., LTD | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 562 | bigheadgourds.com | Nobel Networks | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 563 | bigheartsathome.com | GoDaddy.com, LLC | 20 Feb 2018 | 2 Apr 2024 | 20 Feb 2024 |
| 564 | bighornapparel.com | DreamHost, LLC | 10 Sep 2014 | 10 Aug 2024 | 10 Sep 2025 |
| 565 | bighornclothing.com | DreamHost, LLC | 10 Sep 2014 | 10 Aug 2024 | 10 Sep 2025 |
| 566 | bighornclothingco.com | DreamHost, LLC | 10 Sep 2014 | 12 Sep 2017 | 10 Sep 2018 |
| 567 | bighugemassivedeals.com | Tucows Domains Inc. | 13 Aug 2017 | 17 Aug 2018 | 13 Aug 2018 |
| 568 | bighairy.net | Tucows Domains Inc. | 1 Oct 2001 | 5 Oct 2014 | 1 Oct 2015 |
| 569 | bighaiti.com | Gandi SAS | 4 Oct 2014 | 6 Jul 2025 | 4 Oct 2025 |
| 570 | bighaiti.info | Gandi SAS | 4 Oct 2014 | 5 Sep 2024 | 4 Oct 2025 |
| 571 | bighaiti.net | Gandi SAS | 4 Oct 2014 | 31 Aug 2024 | 4 Oct 2025 |
| 572 | bighaiti.us | Gandi SAS | 4 Oct 2014 | 30 Aug 2017 | 3 Oct 2018 |
| 573 | bighaiti.biz | Gandi SAS | 4 Oct 2014 | 4 Sep 2024 | 3 Oct 2025 |
| 574 | bighaiti.org | Gandi SAS | 4 Oct 2014 | 5 Sep 2024 | 4 Oct 2025 |
| 575 | bigheaddogs.com | Amazon Registrar, Inc. | 4 Oct 2014 | 31 Aug 2024 | 4 Oct 2025 |
| 576 | bighearthome.com | GoDaddy.com, LLC | 18 Sep 2020 | 19 Sep 2024 | 18 Sep 2026 |
| 577 | bighurrah.com | NameKing.com Inc. | 18 Dec 2023 | 23 May 2025 | 18 Dec 2025 |
| 578 | bigheartsbigsoles.com | Network Solutions, LLC | 21 Apr 2016 | 21 Apr 2016 | 21 Apr 2019 |
| 579 | bighotcock.com | GoDaddy.com, LLC | 22 Jul 2024 | 30 Jun 2025 | 22 Jul 2026 |
| 580 | bighitlures.net | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 581 | bighurtphotography.com | Tucows Domains Inc. | 19 Nov 2014 | 23 Nov 2018 | 19 Nov 2018 |
| 582 | bighitsales.com | - | - | - | - |
| 583 | bighand-rmjfirm.com | Network Solutions, LLC | 19 Nov 2014 | 20 Sep 2024 | 19 Nov 2026 |
| 584 | bighappylove.com | GoDaddy.com, LLC | 11 Sep 2014 | 5 Jul 2025 | 11 Sep 2025 |
| 585 | bighead-smallbody.com | Tucows Domains Inc. | 7 Sep 2012 | 11 Sep 2014 | 7 Sep 2015 |
| 586 | bigheadgenius.com | Wild West Domains, LLC | 19 Sep 2005 | 20 Sep 2024 | 19 Sep 2025 |
| 587 | bigheartseasoning.com | Name.com, Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 588 | bighornbistro.com | Gandi SAS | 12 Sep 2014 | 20 Jul 2025 | 12 Sep 2025 |
| 589 | bigharvestcorp.net | DomainsAtCost Corporation | 1 Oct 2014 | 17 Aug 2017 | 1 Oct 2018 |
| 590 | bighamfamilytree.com | - | - | - | - |
| 591 | bigheadev.com | Acens Technologies, S.L.U. | 5 Jul 2023 | 16 Sep 2024 | 5 Jul 2024 |
| 592 | bigheartpetcare.com | TurnCommerce, Inc. DBA NameBright.com | 17 Dec 2016 | 11 Dec 2020 | 17 Dec 2025 |
| 593 | bighecks.com | TurnCommerce, Inc. DBA NameBright.com | 1 Apr 2012 | 3 May 2024 | 1 Apr 2024 |
| 594 | bighero6tix.com | Hrunting, LLC | 5 Nov 2015 | 5 Nov 2015 | 5 Nov 2016 |
| 595 | bighostindia.com | FastDomain Inc. | 2 Oct 2014 | 2 Oct 2024 | 2 Oct 2026 |
| 596 | bighudhandymanservices.com | 1&1 Internet AG | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 597 | bighospital.net | GoDaddy.com, LLC | 27 Jan 2021 | 28 Jan 2024 | 27 Jan 2027 |
| 598 | bigheart-bigbusiness.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 10 Apr 2020 | 10 Jun 2023 | 10 Apr 2023 |
| 599 | bighigh.info | GMO Internet Inc. | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 600 | bighanfeng.com | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 601 | bighousegod.info | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 602 | bigheadcoach.com | Gransy s.r.o. d/b/a subreg.cz | 5 Oct 2014 | 3 Oct 2016 | 5 Oct 2017 |
| 603 | bighousepresents.com | Key-Systems GmbH | 8 Jul 2021 | 8 Jul 2021 | 8 Jul 2022 |
| 604 | bighobbit.com | Gabia, Inc. | 19 Jul 2022 | 27 Aug 2023 | 19 Jul 2023 |
| 605 | bighornequity.com | GoDaddy.com, LLC | 14 Jan 2022 | 5 Oct 2022 | 14 Jan 2032 |
| 606 | bighug-g.com | GMO Internet Inc. | 24 Sep 2014 | 9 Sep 2024 | 24 Sep 2025 |
| 607 | bighairygorillarents.com | Tucows Domains Inc. | 23 Sep 2014 | 27 Sep 2017 | 23 Sep 2017 |
| 608 | bighornep.com | GoDaddy.com, LLC | 24 Sep 2014 | 25 Aug 2015 | 24 Sep 2017 |
| 609 | bighairygorillaequipment.com | Tucows Domains Inc. | 23 Sep 2014 | 27 Sep 2017 | 23 Sep 2017 |
| 610 | bighistoryjourney.com | Network Solutions, LLC | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2016 |
| 611 | bigheartlittlehands.com | Network Solutions, LLC | 6 Oct 2014 | 26 Jan 2018 | 6 Oct 2018 |
| 612 | bighero6-movie-toys.com | DreamHost, LLC | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 613 | bighighdeas.com | GoDaddy.com, LLC | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 614 | bighornnotary.com | eNom, Inc. | 6 Oct 2014 | 3 Nov 2016 | 6 Oct 2017 |
| 615 | bighu.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 616 | bighotbikes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 617 | bigherodesign.com | NameCheap, Inc. | 27 Jul 2022 | 28 Jul 2025 | 27 Jul 2026 |
| 618 | bigheartedbobs.net | Epik Inc. | 22 Aug 2011 | 21 Sep 2016 | 22 Aug 2017 |
| 619 | bighouseincountry.info | GoDaddy.com, LLC | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 620 | bighaircraftychicks.com | - | 10 Sep 2016 | 10 Sep 2016 | 10 Sep 2018 |
| 621 | bighero6movie.com | Namesilo, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 622 | bighousecountrysitecitylife.info | GoDaddy.com, LLC | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 623 | bighorndivers.com | GMO Internet Inc. | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 624 | bighorizon.info | 1&1 Internet AG | 20 Nov 2014 | 6 Dec 2016 | 20 Nov 2017 |
| 625 | bighornvacations.com | GoDaddy.com, LLC | 26 Dec 2020 | 27 Dec 2024 | 26 Dec 2025 |
| 626 | bighorny.com | TurnCommerce, Inc. DBA NameBright.com | 15 Jun 2017 | 9 Jun 2020 | 15 Jun 2026 |
| 627 | bighui.com | eName Technology Co., Ltd. | 8 Jun 2025 | 8 Jun 2025 | 8 Jun 2026 |
| 628 | bighousebarbeque.com | DNC Holdings, Inc. | 27 Sep 2014 | 27 Sep 2014 | 27 Sep 2015 |
| 629 | bigholepussy.com | GoDaddy.com, LLC | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 630 | bighouseinthelakes.com | eNom, Inc. | 14 Sep 2007 | 12 Sep 2017 | 14 Sep 2018 |
| 631 | bighorntough.com | HiChina Zhicheng Technology Limited | 5 Feb 2020 | 6 Feb 2020 | 5 Feb 2021 |
| 632 | bighitssports.com | GoDaddy.com, LLC | 22 Nov 2014 | 22 Nov 2016 | 22 Nov 2018 |
| 633 | bigheartcircle.us | GoDaddy.com, LLC | 25 Sep 2014 | 25 Sep 2014 | 24 Sep 2015 |
| 634 | bighnabinashanays.org | Wild West Domains, LLC | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 635 | bighairradio.com | GoDaddy.com, LLC | 28 Jun 2016 | 29 Jun 2025 | 28 Jun 2026 |
| 636 | bighornpmo.org | FastDomain Inc. | 20 Nov 2014 | 28 Nov 2016 | 20 Nov 2017 |
| 637 | bighornenergy.net | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 638 | bighangingtits.com | Fabulous.com Pty Ltd. | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 639 | bighugehistory.com | FastDomain Inc. | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 640 | bighugethoughts.com | FastDomain Inc. | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 641 | bighacknews.com | GoDaddy.com, LLC | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 642 | bighat-nocattle.com | Tucows Domains Inc. | 28 Sep 2014 | 3 Nov 2024 | 28 Sep 2026 |
| 643 | bighotphotomaster.com | OnlineNIC, Inc. | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 644 | bighappyhead.com | Gandi SAS | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 645 | bighouserestaurante.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 646 | bighermesbags.com | Internet.bs Corp. | 29 Sep 2014 | 29 Sep 2014 | 29 Sep 2015 |
| 647 | bighoodtrucks.com | GoDaddy.com, LLC | 30 Sep 2014 | 30 Sep 2014 | 30 Sep 2015 |
| 648 | bighugecorp.com | GoDaddy.com, LLC | 29 Sep 2014 | 30 Sep 2024 | 29 Sep 2025 |
| 649 | bighalloweenparty.info | NameCheap, Inc. | 30 Sep 2014 | 3 Mar 2024 | 30 Sep 2025 |
| 650 | bighostdomain.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Sep 2014 | 12 Sep 2016 | 29 Sep 2017 |
| 651 | bighottubs.com | Uniregistrar Corp | 11 Aug 2017 | 23 Oct 2024 | 11 Aug 2024 |
| 652 | bighornwater.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 May 2021 | 17 May 2023 | 16 May 2024 |
| 653 | bigholidayparty.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Sep 2023 | 21 Sep 2024 | 20 Sep 2025 |
| 654 | bighn.com | DropCatch.com 977 LLC | 8 Feb 2016 | 9 Feb 2017 | 8 Feb 2018 |
| 655 | bighairymangoes.com | Crazy Domains FZ-LLC | 17 Oct 2014 | 13 Nov 2017 | 17 Oct 2024 |
| 656 | bighalitics.com | GoDaddy.com, LLC | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 657 | bighangar.com | DreamHost, LLC | 13 Sep 2013 | 16 Aug 2024 | 13 Sep 2025 |
| 658 | bighatagency.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 16 Oct 2014 | 7 Aug 2017 | 16 Oct 2018 |
| 659 | bighookmusic.com | GoDaddy.com, LLC | 16 Oct 2014 | 17 Oct 2024 | 16 Oct 2026 |
| 660 | bighopp.com | GoDaddy.com, LLC | 12 Jan 2022 | 12 Jan 2022 | 12 Jan 2023 |
| 661 | bighornfeed.com | Network Solutions, LLC | 16 Oct 2014 | 19 May 2023 | 16 Oct 2028 |
| 662 | bighrecordings.com | GoDaddy.com, LLC | 17 Oct 2014 | 17 Oct 2016 | 17 Oct 2017 |
| 663 | bighelper24.com | eNom, Inc. | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2015 |
| 664 | bighandscolvin.com | eNom, Inc. | 23 Nov 2014 | 18 Nov 2024 | 23 Nov 2025 |
| 665 | bighairyaudaciousgoals.com | Name.com, Inc. | 23 Nov 2014 | 1 Nov 2017 | 23 Nov 2018 |
| 666 | bighairyyak.com | Hostinger, UAB | 12 Oct 2014 | 3 Sep 2024 | 12 Oct 2025 |
| 667 | bighammerremodeling.com | FastDomain Inc. | 13 Oct 2014 | 29 Sep 2017 | 13 Oct 2018 |
| 668 | bighbo.com | GoDaddy.com, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 669 | bighouselittlebudget.com | Network Solutions, LLC | 4 Jul 2024 | 6 Jul 2025 | 4 Jul 2026 |
| 670 | bighuasuan.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 May 2024 | 2 Aug 2025 | 2 May 2026 |
| 671 | bighatinvesting.com | Domainsoftheday.net LLC | 21 Apr 2017 | 22 Apr 2017 | 21 Apr 2018 |
| 672 | bighousehelpers.com | Tucows Domains Inc. | 13 Oct 2014 | 17 Oct 2015 | 13 Oct 2016 |
| 673 | bighorngold.com | GoDaddy.com, LLC | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 674 | bighongbao.com | HiChina Zhicheng Technology Limited | 25 Sep 2014 | 15 Sep 2024 | 25 Sep 2025 |
| 675 | bighermieslittlebugs.com | GoDaddy.com, LLC | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2019 |
| 676 | bigheartfoundation.com | TurnCommerce, Inc. DBA NameBright.com | 30 Mar 2013 | 24 Mar 2021 | 30 Mar 2026 |
| 677 | bigheartbiglifeshow.com | GoDaddy.com, LLC | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 678 | bighealthylifesecret.com | eNom, Inc. | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 679 | bigheadlittlearms.com | DropCatch.com 888 LLC | 14 Dec 2023 | 4 Jan 2024 | 14 Dec 2025 |
| 680 | bighornrun.com | Domain.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 681 | bighornpainting.com | Squarespace Domains LLC | 18 Oct 2023 | 4 Oct 2024 | 18 Oct 2025 |
| 682 | bighitmall.com | Gabia, Inc. | 9 Apr 2024 | 9 Apr 2024 | 9 Apr 2027 |
| 683 | bighornflyfish.com | DreamHost, LLC | 18 Sep 2013 | 15 Oct 2014 | 18 Sep 2015 |
| 684 | bighollowarts.com | NameCheap, Inc. | 18 Oct 2014 | 8 Jan 2018 | 18 Oct 2018 |
| 685 | bigheadtaxidermy.com | Tucows Domains Inc. | 14 Oct 2013 | 18 Oct 2014 | 14 Oct 2015 |
| 686 | bigheartsrescueaz.com | GoDaddy.com, LLC | 31 May 2019 | 31 May 2019 | 31 May 2020 |
| 687 | bighornwebdesign.com | 1&1 Internet AG | 3 Aug 2022 | 3 Aug 2022 | 3 Aug 2026 |
| 688 | bighostel.com | Synergy Wholesale Pty Ltd | 14 Nov 2003 | 14 Oct 2024 | 14 Nov 2025 |
| 689 | bighotfuck.com | eNom, Inc. | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 690 | bighugrealty.com | register.com, Inc. | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 691 | bighornshow.com | GoDaddy.com, LLC | 25 Nov 2014 | 25 Nov 2024 | 25 Nov 2025 |
| 692 | bighornresourcemanagement.com | GoDaddy.com, LLC | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 693 | bighomestay.com | NameKing.com Inc. | 21 Feb 2024 | 7 Apr 2025 | 21 Feb 2025 |
| 694 | bighomebuyer.com | GoDaddy.com, LLC | 21 Mar 2017 | 13 Aug 2024 | 21 Mar 2026 |
| 695 | bigheartintelligence.com | GoDaddy.com, LLC | 4 Aug 2023 | 5 Aug 2025 | 4 Aug 2026 |
| 696 | bigheadcuts.com | GoDaddy.com, LLC | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2017 |
| 697 | bigheartsrescueaz.org | GoDaddy.com, LLC | 25 Nov 2014 | 28 Nov 2016 | 25 Nov 2017 |
| 698 | bigheartintelligence.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Nov 2014 | 29 Nov 2017 | 25 Nov 2018 |
| 699 | bighornclub.com | Wix.com Ltd. | 1 Apr 2022 | 11 Jun 2023 | 1 Apr 2023 |
| 700 | bighappy.biz | register.com, Inc. | 25 Mar 2022 | 27 Mar 2023 | 25 Mar 2023 |
| 701 | bighairsmallwaist.com | GoDaddy.com, LLC | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2015 |
| 702 | bighercproductions.com | Tucows Domains Inc. | 28 Nov 2014 | 14 Nov 2017 | 28 Nov 2018 |
| 703 | bighenrys.com | GoDaddy.com, LLC | 28 Nov 2014 | 29 Nov 2024 | 28 Nov 2025 |
| 704 | bighairbiggerdreams.org | GoDaddy.com, LLC | 27 Nov 2014 | 11 Jan 2025 | 27 Nov 2025 |
| 705 | bighonda.com | GoDaddy.com, LLC | 25 Apr 2017 | 26 Apr 2025 | 25 Apr 2026 |
| 706 | bigheromovie.com | GoDaddy.com, LLC | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 707 | bighah.com | DropCatch.com 912 LLC | 12 Oct 2022 | 23 Dec 2023 | 12 Oct 2023 |
| 708 | bighouseinvestmentgroup.com | GoDaddy.com, LLC | 30 Nov 2014 | 1 Dec 2023 | 30 Nov 2025 |
| 709 | bighero6themovie.com | GoDaddy.com, LLC | 30 Nov 2014 | 1 Dec 2014 | 30 Nov 2015 |
| 710 | bighitvaporcom.com | GoDaddy.com, LLC | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 711 | bightly.com | DNC Holdings, Inc. | 10 Nov 2019 | 10 Nov 2019 | 10 Nov 2020 |
| 712 | bighousebarbecue.com | DNC Holdings, Inc. | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 713 | bighorntrucking.com | TurnCommerce, Inc. DBA NameBright.com | 2 Dec 2014 | 20 Aug 2021 | 2 Dec 2025 |
| 714 | bighealthinsuranceoptions.com | eNom, Inc. | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 715 | bighua.net | Threadagent.com, Inc. | 28 Oct 2024 | 2 Nov 2024 | 28 Oct 2025 |
| 716 | bigharvest.org | - | 16 May 2025 | 21 May 2025 | 16 May 2026 |
| 717 | bighostingmachine.com | Launchpad, Inc. | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 718 | bighorncourt.com | GoDaddy.com, LLC | 3 Dec 2014 | 4 Dec 2024 | 3 Dec 2025 |
| 719 | bighland.com | Webfusion Ltd. | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 720 | bighippohost.com | NameCheap, Inc. | 3 Dec 2014 | 1 Jun 2025 | 3 Dec 2025 |
| 721 | bighealthinsurancesearch.com | eNom, Inc. | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 722 | bigheadstavern.com | Tucows Domains Inc. | 30 Nov 2013 | 4 Dec 2014 | 30 Nov 2015 |
| 723 | bighairsmalltown.com | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 724 | bighitterlaw.com | GoDaddy.com, LLC | 4 Dec 2014 | 5 Dec 2016 | 4 Dec 2017 |
| 725 | bigheadres.com | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 726 | bighitpromotions.com | Wild West Domains, LLC | 5 Dec 2014 | 5 Dec 2014 | 5 Dec 2015 |
| 727 | bighornwoodart.com | GoDaddy.com, LLC | 7 Dec 2014 | 7 Dec 2024 | 7 Dec 2025 |
| 728 | bigherocorp.com | GoDaddy.com, LLC | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 729 | bigheartsunited.com | DropCatch.com 1177 LLC | 23 Feb 2017 | 23 Feb 2017 | 23 Feb 2018 |
| 730 | bigheartart.com | TurnCommerce, Inc. DBA NameBright.com | 6 Dec 2014 | 15 Jan 2025 | 6 Dec 2024 |
| 731 | bigharts.com | TurnCommerce, Inc. DBA NameBright.com | 6 Dec 2014 | 15 Jan 2025 | 6 Dec 2024 |
| 732 | bighousekennels.com | TurnCommerce, Inc. DBA NameBright.com | 7 Dec 2014 | 16 Jan 2025 | 7 Dec 2024 |
| 733 | bighotmen.com | NameCheap, Inc. | 29 Oct 2020 | 17 Aug 2023 | 29 Oct 2025 |
| 734 | bighitvaporstore.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 735 | bighistoryprojects.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 736 | bigherotix.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 737 | bigheadwomen.com | Fabulous.com Pty Ltd. | 2 Nov 2005 | 1 Dec 2015 | 2 Nov 2016 |
| 738 | bigharrypussy.com | Fabulous.com Pty Ltd. | 2 Nov 2005 | 4 Dec 2017 | 2 Nov 2018 |
| 739 | bighamcontracting.com | eNom, Inc. | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2016 |
| 740 | bigholegolfclub.com | Crazy Domains FZ-LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2016 |
| 741 | bigheartsunited.org | Tucows Domains Inc. | 7 Dec 2014 | 2 Dec 2016 | 7 Dec 2017 |
| 742 | bighornlifttruck.info | Network Solutions, LLC | 1 Jan 2019 | 1 Jan 2019 | 1 Jan 2020 |
| 743 | bighousevisits.com | 1&1 Internet AG | 10 Dec 2014 | 21 May 2017 | 10 Dec 2017 |
| 744 | bighomeservice.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Mar 2017 | 11 May 2017 | 11 Mar 2018 |
| 745 | bighearing.com | GoDaddy.com, LLC | 30 Jun 2023 | 5 Jul 2025 | 30 Jun 2026 |
| 746 | bighornbuildingerectors.net | GoDaddy.com, LLC | 17 Feb 2023 | 18 Feb 2025 | 17 Feb 2026 |
| 747 | bightofbeninenergy.com | Webfusion Ltd. | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2018 |
| 748 | bigherdnet.com | 1API GmbH | 10 Dec 2014 | 11 Nov 2024 | 10 Dec 2025 |
| 749 | bighelp.net | GMO Internet Inc. | 3 Aug 2025 | 5 Aug 2025 | 3 Aug 2026 |
| 750 | bighawaii.org | GoDaddy.com, LLC | 9 Dec 2014 | 23 Jan 2025 | 9 Dec 2026 |
| 751 | bighitvaporz.com | GoDaddy.com, LLC | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 752 | bighero6sky.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 753 | bighextra.net | Cronon AG | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2017 |
| 754 | bightransport.info | Tucows Domains Inc. | 8 Dec 2010 | 12 Dec 2014 | 8 Dec 2015 |
| 755 | bighosswheelgun.com | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 756 | bighossmagnum.com | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 757 | bighierarchy.com | register.com, Inc. | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 758 | bightransport.net | Tucows Domains Inc. | 8 Dec 2010 | 12 Dec 2014 | 8 Dec 2015 |
| 759 | bighugetheband.com | eNom, Inc. | 14 Dec 2014 | 27 Sep 2016 | 14 Dec 2017 |
| 760 | bighossfirearmstraining.com | GoDaddy.com, LLC | 13 Dec 2014 | 13 Dec 2014 | 13 Dec 2015 |
| 761 | bigholdingsinternational.com | Hosting Concepts B.V. dba Openprovider | 28 Jul 2024 | 28 Jul 2025 | 28 Jul 2026 |
| 762 | bightransport.org | Tucows Domains Inc. | 8 Dec 2010 | 12 Dec 2014 | 8 Dec 2015 |
| 763 | bighorsedon.info | GoDaddy.com, LLC | 13 Dec 2014 | 13 Dec 2014 | 13 Dec 2015 |
| 764 | bighungbo.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 765 | bighstockphoto.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 766 | bighorsecock.com | Fabulous.com Pty Ltd. | 28 Nov 2004 | 4 Dec 2017 | 28 Nov 2018 |
| 767 | bighipgirls.com | Fabulous.com Pty Ltd. | 29 Nov 2005 | 1 Dec 2015 | 29 Nov 2016 |
| 768 | bighimaltravellers.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 769 | bigharley.com | GoDaddy.com, LLC | 14 Dec 2014 | 8 Dec 2024 | 14 Dec 2025 |
| 770 | bighappybuddah.com | Fabulous.com Pty Ltd. | 28 Nov 2004 | 4 Dec 2017 | 28 Nov 2018 |
| 771 | bighorsedon.us | GoDaddy.com, LLC | 13 Dec 2014 | 13 Dec 2014 | 12 Dec 2019 |
| 772 | bighorsedon.net | GoDaddy.com, LLC | 13 Dec 2014 | 13 Dec 2014 | 13 Dec 2015 |
| 773 | bigholdingsinternational.org | Domain.com, LLC | 13 Dec 2014 | - | 13 Dec 2016 |
| 774 | bighambp.info | Dynadot, LLC | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 775 | bighthouston.com | NameCheap, Inc. | 25 Mar 2016 | 10 Jun 2023 | 25 Mar 2026 |
| 776 | bighouseofchrome.com | Beijing Lanhai Jiye Technology Co., Ltd | 25 May 2023 | 27 Jul 2024 | 25 May 2024 |
| 777 | bighomeofchrome.com | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 778 | bighitvaporstore.net | register.com, Inc. | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 779 | bighealingchurch.org | OnlineNIC, Inc. | 15 Dec 2014 | 16 Dec 2016 | 15 Dec 2017 |
| 780 | bighouseph.com | Hostinger, UAB | 8 Apr 2023 | 21 Jun 2025 | 8 Apr 2025 |
| 781 | bighornveterinaryconsulting.com | - | 13 Mar 2023 | 13 Apr 2024 | 13 Mar 2024 |
| 782 | bighitgames.com | GoDaddy.com, LLC | 18 Dec 2014 | 27 Nov 2024 | 18 Dec 2025 |
| 783 | bigheadroofing.com | Network Solutions, LLC | 17 Dec 2014 | 15 Dec 2016 | 17 Dec 2017 |
| 784 | bigheadbondingfasteners.com | Tucows Domains Inc. | 14 Dec 2012 | 18 Dec 2014 | 14 Dec 2015 |
| 785 | bighead-bonding-fasteners.com | Tucows Domains Inc. | 14 Dec 2012 | 18 Dec 2014 | 14 Dec 2015 |
| 786 | bighax.com | CloudFlare, Inc. | 1 Apr 2025 | 8 Apr 2025 | 1 Apr 2026 |
| 787 | bighappening.com | TurnCommerce, Inc. DBA NameBright.com | 17 Dec 2014 | 11 Dec 2020 | 17 Dec 2025 |
| 788 | bighockey.net | GoDaddy.com, LLC | 17 Dec 2014 | 17 Dec 2024 | 17 Dec 2034 |
| 789 | bigholegolfchallenge.com | DNC Holdings, Inc. | 18 Dec 2014 | 19 Dec 2016 | 18 Dec 2017 |
| 790 | bighitvape.com | GoDaddy.com, LLC | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 791 | bighealthyenergy.com | Wild West Domains, LLC | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 792 | bigheadbigthoughts.com | Wild West Domains, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 793 | bighold.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 18 Dec 2014 | 19 Dec 2014 | 18 Dec 2015 |
| 794 | bightofbeninmusculusscalenus.info | eNom, Inc. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 795 | bighomiez.com | GoDaddy.com, LLC | 27 Jan 2019 | 27 Jan 2019 | 27 Jan 2020 |
| 796 | bighonedog.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 797 | bigheartpetholidas.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 798 | bigheadbabybibs.com | GoDaddy.com, LLC | 21 Dec 2014 | 21 Dec 2014 | 21 Dec 2016 |
| 799 | bighorntrans.com | Tucows Domains Inc. | 19 Dec 2013 | 23 Dec 2014 | 19 Dec 2015 |
| 800 | bighorn4x4.com | Name.com, Inc. | 16 Sep 2021 | 15 Aug 2024 | 16 Sep 2025 |
| 801 | bigheadedant.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 802 | bighead3d.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 23 May 2025 | 23 May 2025 | 23 May 2026 |
| 803 | bighattechnology.com | - | - | - | - |
| 804 | bighamtavern.com | Tucows Domains Inc. | 3 Apr 2010 | 19 Mar 2025 | 3 Apr 2026 |
| 805 | bighugepartyfuntime.com | GoDaddy.com, LLC | 1 May 2019 | 1 May 2019 | 1 May 2020 |
| 806 | bighotelier.com | Mesh Digital Limited | 23 Dec 2014 | 18 Dec 2016 | 23 Dec 2018 |
| 807 | bighelperhomesearch.com | GoDaddy.com, LLC | 23 Dec 2014 | 24 Dec 2024 | 23 Dec 2026 |
| 808 | bigheartsun.com | Intersolved-WA.com Inc. | 23 Dec 2014 | 23 Dec 2014 | 23 Dec 2015 |
| 809 | bighappypartyfuntime.com | FastDomain Inc. | 23 Dec 2014 | 8 Dec 2024 | 23 Dec 2025 |
| 810 | bighouseadvertise.net | Domainshype.com, Inc. | 23 Dec 2014 | 23 Dec 2014 | 23 Dec 2015 |
| 811 | bighousehoodies.com | GoDaddy.com, LLC | 18 Jan 2024 | 1 Mar 2025 | 18 Jan 2025 |
| 812 | bighitcms.com | - | 24 Sep 2022 | 26 Nov 2023 | 24 Sep 2023 |
| 813 | bighatoacre.com | 1&1 Internet AG | 25 Dec 2014 | 26 Dec 2016 | 25 Dec 2017 |
| 814 | bighostcompany.com | GMO Internet Inc. | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 815 | bigheartfilms.com | Tucows Domains Inc. | 26 Dec 2013 | 30 Dec 2022 | 26 Dec 2022 |
| 816 | bighornboatrentals.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 817 | bighomiesiah.com | Gandi SAS | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 818 | bighomehosting.com | NetEarth One Inc. d/b/a NetEarth | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 819 | bigheartsinaction.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2016 |
| 820 | bighatlaw.com | Wild West Domains, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 821 | bighugemess.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Mar 2023 | 6 May 2024 | 25 Mar 2024 |
| 822 | bighouseonthehill.com | 1&1 Internet AG | 30 Dec 2014 | 31 Dec 2016 | 30 Dec 2017 |
| 823 | bighorsepictures.com | Fabulous.com Pty Ltd. | 6 Dec 2005 | 2 Jan 2018 | 6 Dec 2018 |
| 824 | bighornsigns.biz | Tucows Domains Inc. | 27 Dec 2012 | 30 Dec 2014 | 26 Dec 2014 |
| 825 | bighitstudio.com | Google, Inc. | 31 Dec 2014 | 13 Mar 2025 | 31 Dec 2024 |
| 826 | bighhuntinglodge.com | 1&1 Internet AG | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 827 | bighfish.com | Key-Systems GmbH | 20 Jul 2021 | 20 Jul 2021 | 20 Jul 2022 |
| 828 | bigheartedgamer.com | GoDaddy.com, LLC | 31 Dec 2014 | 31 Dec 2024 | 31 Dec 2026 |
| 829 | bigheadoutdoors.com | GoDaddy.com, LLC | 7 Feb 2023 | 20 Mar 2024 | 7 Feb 2024 |
| 830 | bighasslemedia.com | Fabulous.com Pty Ltd. | 6 Dec 2005 | 2 Jan 2018 | 6 Dec 2018 |
| 831 | bighash.net | CloudFlare, Inc. | 10 May 2025 | 17 May 2025 | 10 May 2026 |
| 832 | bighousesevices.com | eNom, Inc. | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 833 | bighousegym.com | GoDaddy.com, LLC | 31 Dec 2014 | 17 Sep 2022 | 31 Dec 2026 |
| 834 | bighalla.com | GoDaddy.com, LLC | 31 Dec 2014 | 1 Jan 2015 | 31 Dec 2015 |
| 835 | bighero6game.net | Name.com, Inc. | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2016 |
| 836 | bigheartsmallhands.com | 1&1 Internet AG | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2016 |
| 837 | bigheadyouth.org | Tucows Domains Inc. | 31 Dec 2014 | 23 Jan 2017 | 31 Dec 2017 |
| 838 | bighitcourses.com | - | - | - | - |
| 839 | bighz.com | TurnCommerce, Inc. DBA NameBright.com | 18 Mar 2018 | 12 Mar 2021 | 18 Mar 2026 |
| 840 | bighero6games.biz | EvoPlus Ltd. | 8 Nov 2014 | 3 Jan 2015 | 7 Nov 2015 |
| 841 | bighairsmallheart.com | FastDomain Inc. | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 842 | bighealthplan.com | GoDaddy.com, LLC | 14 Feb 2020 | 5 Mar 2025 | 4 Mar 2026 |
| 843 | bighairyaudaciousgoal.com | GoDaddy.com, LLC | 20 Oct 2020 | 31 Dec 2023 | 20 Oct 2023 |
| 844 | bighairbetty.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 845 | bigheartsmallhands.org | 1&1 Internet AG | 1 Jan 2015 | - | 1 Jan 2016 |
| 846 | bighouseworkout.xyz | Network Solutions, LLC | 23 Jul 2014 | 23 Jul 2014 | 23 Jul 2015 |
| 847 | bighjuices.xyz | Network Solutions, LLC | 28 Jul 2014 | 28 Jul 2014 | 28 Jul 2015 |
| 848 | bighornent.xyz | Network Solutions, LLC | 25 Jul 2014 | 25 Jul 2014 | 25 Jul 2015 |
| 849 | bighornimports.xyz | Network Solutions, LLC | 1 Aug 2014 | 1 Aug 2014 | 1 Aug 2015 |
| 850 | bigheadpictures.xyz | Network Solutions, LLC | 30 Jul 2014 | 31 Jul 2014 | 30 Jul 2015 |
| 851 | bighappybootcamp.xyz | Network Solutions, LLC | 30 Jul 2014 | 30 Jul 2014 | 30 Jul 2015 |
| 852 | bighead.photos | GoDaddy.com, LLC | 6 Aug 2014 | 14 Jun 2020 | 6 Aug 2021 |
| 853 | bighookcamps.xyz | Network Solutions, LLC | 24 Jul 2014 | 24 Jul 2014 | 24 Jul 2015 |
| 854 | bighautomart.xyz | Network Solutions, LLC | 23 Jul 2014 | 24 Jul 2014 | 23 Jul 2015 |
| 855 | bighassle.xyz | Network Solutions, LLC | 24 Jul 2014 | 30 May 2025 | 24 Jul 2027 |
| 856 | bighearted.guru | Key-Systems, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 857 | bighornrock.church | 1&1 Internet AG | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 858 | bighornwildwesttours.vegas | united-domains AG | 15 Sep 2014 | - | 15 Sep 2015 |
| 859 | bighorntours.vegas | united-domains AG | 15 Sep 2014 | - | 15 Sep 2015 |
| 860 | bighornhummertours.vegas | united-domains AG | 15 Sep 2014 | - | 15 Sep 2015 |
| 861 | bighouse.church | Google, Inc. | 12 May 2018 | 3 Jun 2025 | 12 May 2026 |
| 862 | bighistory.education | GoDaddy.com, LLC | 28 May 2019 | 12 Jul 2025 | 28 May 2026 |
| 863 | bighearted.church | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 864 | bighat-nocattle.club | Tucows Domains Inc. | 1 Oct 2014 | 28 Mar 2025 | 30 Sep 2026 |
| 865 | bighornrealestate.club | GoDaddy.com, LLC | 6 Oct 2014 | 11 Oct 2024 | 5 Oct 2029 |
| 866 | bighornproperties.club | GoDaddy.com, LLC | 6 Oct 2014 | 11 Oct 2024 | 5 Oct 2029 |
| 867 | bighornhomes.club | GoDaddy.com, LLC | 6 Oct 2014 | 11 Oct 2024 | 5 Oct 2029 |
| 868 | bighorngolfclub.club | GoDaddy.com, LLC | 6 Oct 2014 | 11 Oct 2024 | 5 Oct 2029 |
| 869 | bighorncountryclub.club | GoDaddy.com, LLC | 6 Oct 2014 | 11 Oct 2024 | 5 Oct 2029 |
| 870 | bighawaii.rocks | GoDaddy.com, LLC | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2015 |
| 871 | bighouse.soy | 101domain, Inc. | 16 Oct 2014 | - | 16 Oct 2015 |
| 872 | bighouse.ventures | NameCheap, Inc. | 24 Oct 2014 | 29 Sep 2024 | 24 Oct 2025 |
| 873 | bighouseboys.us | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2016 | 10 Aug 2017 |
| 874 | bighorncompany.com | Dynadot, LLC | 2 Apr 2023 | 4 Apr 2025 | 2 Apr 2026 |
| 875 | bigheartmediaatl.com | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 876 | bigheartmatchmaking.com | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2017 |
| 877 | bighealthsale.info | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 878 | bighairymonster.net | Tucows Domains Inc. | 12 Aug 2015 | 16 Aug 2018 | 12 Aug 2018 |
| 879 | bightwickmedia.company | Tucows Domains Inc. | 30 Oct 2014 | 3 Nov 2017 | 30 Oct 2018 |
| 880 | bighouse86.club | Network Solutions, LLC | 26 Oct 2014 | 26 Oct 2014 | 25 Oct 2015 |
| 881 | bighearts.club | Tucows Domains Inc. | 24 Mar 2021 | 28 Mar 2025 | 24 Mar 2026 |
| 882 | bighero.link | GMO Internet Inc. | 17 Nov 2014 | - | 17 Nov 2015 |
| 883 | bighug.club | Porkbun, LLC | 8 Aug 2025 | 8 Aug 2025 | 8 Aug 2026 |
| 884 | bighouse.wang | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 5 May 2017 | 13 Dec 2017 | 5 May 2018 |
| 885 | bighomebusinessexpert.ninja | eNom, Inc. | 5 Dec 2014 | 5 Dec 2014 | 5 Dec 2015 |
| 886 | bigheart.today | Easyspace LTD | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 887 | bighat.club | Regional Network Information Center, JSC dba RU-CE… | 23 Dec 2014 | 21 Dec 2016 | 22 Dec 2017 |
| 888 | bigheadfarm.organic | Emerald Registrar Limited | 8 Dec 2014 | 21 Dec 2014 | 8 Dec 2015 |
| 889 | bighostel.moscow | Limited Liability Company "Registrar of domain nam… | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2015 |
| 890 | bighead.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 28 Nov 2021 | 2 Feb 2025 | 28 Nov 2025 |
| 891 | bighouse.moscow | Limited Liability Company "Registrar of domain nam… | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2015 |
| 892 | bighack.club | eNom, Inc. | 1 Jan 2015 | 1 Jan 2015 | 31 Dec 2015 |
| 893 | bighitter.tokyo | GMO Internet Inc. | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 894 | bighit.fitness | GoDaddy.com, LLC | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 895 | bigheros.club | 101domain, Inc. | 19 Jan 2021 | 18 Mar 2022 | 19 Jan 2028 |
| 896 | bighero.club | GMO Internet Inc. | 16 May 2020 | 17 May 2020 | 16 May 2021 |
| 897 | bighand.top | Namesilo, LLC | 12 Aug 2022 | 15 Sep 2023 | 12 Aug 2023 |
| 898 | bighornregisteredagents.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2024 | 13 Aug 2027 |
| 899 | bighornregisteredagent.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2024 | 13 Aug 2027 |
| 900 | bighogbarbecue.net | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2017 |
| 901 | bighogbarbecue.com | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2017 |
| 902 | bigheartconnections.com | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2017 |
| 903 | bigheartconnecter.com | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2017 |
| 904 | bighatrealty.com | NameCheap, Inc. | 1 Jan 2024 | 8 Jan 2025 | 1 Jan 2026 |
| 905 | bighangout15.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 906 | bighair.rocks | Name.com, Inc. | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2017 |
| 907 | bighero6.club | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Jan 2015 | - | 29 Jan 2016 |
| 908 | bighorn.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 909 | bighill.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 910 | bighouzz.science | Alpnames Limited | 3 Mar 2015 | 3 Mar 2015 | 2 Mar 2016 |
| 911 | bighello.world | GoDaddy.com, LLC | 28 Mar 2023 | 8 Jun 2024 | 28 Mar 2024 |
| 912 | bighead.nyc | GoDaddy.com, LLC | 20 Feb 2015 | 25 Feb 2025 | 19 Feb 2027 |
| 913 | bighelp.global | Super Registry Inc. | 15 Mar 2015 | 15 Mar 2017 | 15 Mar 2018 |
| 914 | bighorn.capital | eNom, Inc. | 24 Mar 2015 | 16 Mar 2025 | 24 Mar 2026 |
| 915 | bighuge.fail | GoDaddy.com, LLC | 23 Mar 2015 | 8 Jul 2024 | 23 Mar 2026 |
| 916 | bighero.science | Alpnames Limited | 4 Apr 2015 | - | 3 Apr 2016 |
| 917 | bighome.rocks | Name.com, Inc. | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 918 | bighome.reviews | Name.com, Inc. | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 919 | bighaitaxli.science | Alpnames Limited | 7 Apr 2015 | - | 6 Apr 2016 |
| 920 | bighornplumbingllc.net | register.com, Inc. | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 921 | bighornpainclinic.com | Tucows Domains Inc. | 13 Aug 2015 | 7 Aug 2024 | 13 Aug 2025 |
| 922 | bighorncpa.com | GoDaddy.com, LLC | 12 Jul 2017 | 12 Jun 2025 | 12 Jul 2027 |
| 923 | bighomiegwap.com | eNom, Inc. | 11 Jan 2018 | 22 Feb 2025 | 11 Jan 2025 |
| 924 | bighairbigdreams.net | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 13 Aug 2015 | 15 Jul 2025 | 13 Aug 2025 |
| 925 | bighairbaby.com | HiChina Zhicheng Technology Limited | 1 Nov 2019 | 1 Nov 2019 | 1 Nov 2020 |
| 926 | bighfiauhe.xyz | GMO Internet Inc. | 16 Apr 2015 | 17 Apr 2015 | 16 Apr 2016 |
| 927 | bighost.ninja | Name.com, Inc. | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2016 |
| 928 | bighouston.com | Tucows Domains Inc. | 5 Jan 2015 | 5 Jan 2017 | 5 Jan 2018 |
| 929 | bighotelprinkipo.com | FBS Inc. | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2017 |
| 930 | bighornjeep.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2017 |
| 931 | bighashmap.com | TurnCommerce, Inc. DBA NameBright.com | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 932 | bighuzknows.com | Wild West Domains, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 933 | bighorsedon.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2020 |
| 934 | bighorizonsoftware.com | Hosting Concepts B.V. dba Openprovider | 30 Mar 2021 | 9 Jun 2025 | 30 Mar 2025 |
| 935 | bighillforever.com | GoDaddy.com, LLC | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2016 |
| 936 | bighermskitchenreviews.com | eNom, Inc. | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 937 | bigheadsnake.com | Xin Net Technology Corporation | 12 Aug 2018 | 12 Aug 2018 | 12 Aug 2019 |
| 938 | bighcomputers.com | Tucows Domains Inc. | 3 Jan 2014 | 7 Jan 2015 | 3 Jan 2016 |
| 939 | bighairtricia.com | Wild West Domains, LLC | 7 Jan 2015 | 8 Dec 2024 | 7 Jan 2026 |
| 940 | bighairbigcity.com | GoDaddy.com, LLC | 13 May 2017 | 13 Sep 2022 | 13 May 2027 |
| 941 | bigheartswithhelpinghands.org | GoDaddy.com, LLC | 5 Jan 2015 | 16 Feb 2025 | 5 Jan 2025 |
| 942 | bighomes.info | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 4 Sep 2023 | 11 Nov 2024 | 4 Sep 2024 |
| 943 | bighollywood.net | Domain Registration Services, Inc. dba dotEarth.co… | 12 Feb 2010 | 13 Feb 2025 | 12 Feb 2026 |
| 944 | bighoki.org | NameCheap, Inc. | 18 May 2025 | 23 May 2025 | 18 May 2026 |
| 945 | bighealthyme.com | NameCheap, Inc. | 28 Jan 2023 | 10 Apr 2024 | 28 Jan 2024 |
| 946 | bighartbrewing.com | NameCheap, Inc. | 7 Jan 2015 | 6 Jan 2025 | 7 Jan 2026 |
| 947 | bighartbrewery.com | NameCheap, Inc. | 7 Jan 2015 | 6 Jan 2025 | 7 Jan 2026 |
| 948 | bighuo.com | West263 International Limited | 29 Nov 2021 | 29 Nov 2021 | 29 Nov 2022 |
| 949 | bighqtube.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 950 | bighide.com | GoDaddy.com, LLC | 9 May 2024 | 9 May 2024 | 9 May 2027 |
| 951 | bighousewarnerrobins.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 952 | bighero6.xyz | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 953 | bighavana.com | GoDaddy.com, LLC | 21 Apr 2024 | 21 Apr 2024 | 21 Apr 2027 |
| 954 | bighorngeo.com | Tucows Domains Inc. | 9 Jan 2015 | 13 Jan 2021 | 9 Jan 2021 |
| 955 | bighorn-geo.com | Tucows Domains Inc. | 9 Jan 2015 | 13 Jan 2018 | 9 Jan 2018 |
| 956 | bighedgehogmap.org | Tucows Domains Inc. | 7 Jan 2015 | 5 Jan 2025 | 7 Jan 2026 |
| 957 | bighorngeo.org | Tucows Domains Inc. | 9 Jan 2015 | 25 Feb 2017 | 9 Jan 2018 |
| 958 | bighorngeo.net | Tucows Domains Inc. | 9 Jan 2015 | 13 Jan 2018 | 9 Jan 2018 |
| 959 | bighorn-geo.org | Tucows Domains Inc. | 9 Jan 2015 | 25 Feb 2017 | 9 Jan 2018 |
| 960 | bighorn-geo.net | Tucows Domains Inc. | 9 Jan 2015 | 13 Jan 2018 | 9 Jan 2018 |
| 961 | bigheadnation.net | Tucows Domains Inc. | 20 Jan 2023 | 24 Jan 2025 | 20 Jan 2026 |
| 962 | bighatnoranch.com | GoDaddy.com, LLC | 10 Jan 2015 | 16 Dec 2024 | 10 Jan 2027 |
| 963 | bighashtable.com | Hefei Juming Network Technology Co., Ltd | 4 Nov 2022 | 5 Nov 2023 | 4 Nov 2024 |
| 964 | bighatnoranch.net | GoDaddy.com, LLC | 10 Jan 2015 | 16 Dec 2024 | 10 Jan 2027 |
| 965 | bigheartproduction.com | Nordreg AB | 13 Jan 2015 | 14 Dec 2016 | 13 Jan 2018 |
| 966 | bighostcpanel.com | eNom, Inc. | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 967 | bighornco.com | Dynadot, LLC | 3 Apr 2023 | 4 Apr 2025 | 3 Apr 2026 |
| 968 | bighomietinkweekend.com | Tucows Domains Inc. | 15 Jan 2015 | 19 Jan 2019 | 15 Jan 2019 |
| 969 | bigherolabs.com | FastDomain Inc. | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 970 | bighproductions.biz | Tucows Domains Inc. | 15 Jan 2015 | 18 Jan 2017 | 14 Jan 2017 |
| 971 | bighornsales.com | GoDaddy.com, LLC | 15 Jan 2015 | 17 Sep 2022 | 15 Jan 2026 |
| 972 | bighornrvpark.com | NameCheap, Inc. | 12 Sep 2019 | 13 Aug 2024 | 12 Sep 2025 |
| 973 | bighustlertv.com | Tucows Domains Inc. | 13 Jan 2014 | 17 Jan 2015 | 13 Jan 2016 |
| 974 | bightlight.com | Tucows Domains Inc. | 14 Nov 2022 | 25 Jan 2024 | 14 Nov 2023 |
| 975 | bighouse191.com | register.com, Inc. | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 976 | bighornriverdriftboatrental.com | Internet Domain Services BS Corp | 31 Jul 2023 | 10 Sep 2024 | 31 Jul 2024 |
| 977 | bighairpromotions.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 978 | bighairpr.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 979 | bighairmusicpromotions.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 980 | bighuman.memorial | eNom, Inc. | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 981 | bigharddrive.nyc | Network Solutions, LLC | 13 May 2015 | 13 May 2017 | 12 May 2017 |
| 982 | bigharddisk.wtf | Tucows Domains Inc. | 13 May 2015 | 17 May 2017 | 13 May 2018 |
| 983 | bigharddisk.work | Tucows Domains Inc. | 13 May 2015 | 13 May 2015 | 13 May 2016 |
| 984 | bigharddisk.space | - | 13 May 2015 | 13 May 2015 | 13 May 2017 |
| 985 | bigharddisk.farm | Tucows Domains Inc. | 13 May 2015 | 13 May 2015 | 13 May 2017 |
| 986 | bigharddisk.digital | Tucows Domains Inc. | 13 May 2015 | 17 May 2017 | 13 May 2018 |
| 987 | bigharddisk.church | Tucows Domains Inc. | 13 May 2015 | 13 May 2015 | 13 May 2017 |
| 988 | bigharddisk.army | - | 13 May 2015 | 13 May 2015 | 13 May 2017 |
| 989 | bigharddisk.fail | Tucows Domains Inc. | 20 May 2015 | 20 May 2015 | 20 May 2017 |
| 990 | bigharddisk.computer | Tucows Domains Inc. | 20 May 2015 | 30 Jun 2020 | 20 May 2020 |
| 991 | bigharddisk.agency | Tucows Domains Inc. | 20 May 2015 | 24 May 2017 | 20 May 2018 |
| 992 | bighair.club | GoDaddy.com, LLC | 20 May 2025 | 25 May 2025 | 20 May 2026 |
| 993 | bighornsounds.wtf | Tucows Domains Inc. | 21 May 2015 | 21 May 2015 | 21 May 2017 |
| 994 | bigharddisk.works | Tucows Domains Inc. | 20 May 2015 | 24 May 2017 | 20 May 2018 |
| 995 | bighealth.club | NameCheap, Inc. | 23 Jan 2019 | 23 Jan 2019 | 23 Jan 2020 |
| 996 | bigharpregistration.work | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jun 2015 | 6 Jun 2015 | 6 Jun 2016 |
| 997 | bighot.club | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Jun 2015 | 14 Jun 2015 | 12 Jun 2016 |
| 998 | bighuman.design | GoDaddy.com, LLC | 15 Jun 2015 | 21 Jun 2025 | 15 Jun 2026 |
| 999 | bighornsheep.farm | Network Solutions, LLC | 19 Jun 2015 | 21 Jun 2017 | 19 Jun 2018 |
| 1000 | bighero.global | GoDaddy.com, LLC | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2016 |
Displaying 1,000 out of 20,699 domains starting with the keyword "BIGH". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=bigh
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |