Our database now contains whois records of 616 Million (616,978,646) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1576 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [616 Million Domains] $10,000 Details

Keyword: BIDO

Reverse Whois » KEYWORD [bido ]  { 5,738 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1bido.comFabulous.com Pty Ltd.28 Jun 200122 Sep 202028 Jun 2029
2bido.pwChengdu West Dimension Digital Technology Co., Ltd…29 Mar 201711 Apr 201729 Mar 2018
3bido.oooPDR Ltd. d/b/a PublicDomainRegistry.com4 Nov 20144 Nov 20144 Nov 2015
4bido.xyzSuper Registry Inc.25 Dec 202119 Feb 202525 Dec 2025
5bido.onePDR Ltd. d/b/a PublicDomainRegistry.com9 Jan 201825 Oct 20219 Jan 2029
6bido.topChengdu West Dimension Digital Technology Co., Ltd…29 Sep 2015-29 Sep 2016
7bido.infoFabulous.com Pty Ltd.26 Sep 200810 Nov 202426 Sep 2025
8bido.ovhOVH sas19 Dec 201519 Dec 201519 Dec 2016
9bido.videoAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…18 Apr 201618 Apr 201618 Apr 2017
10bido.pubAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…18 Apr 201618 Apr 201618 Apr 2017
11bido.liveCommuniGal Communication Ltd.29 Nov 202329 Nov 202429 Nov 2024
12bido.vipAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…15 Jun 201618 Jun 201615 Jun 2017
13bido.inTLD Registrar Solutions Ltd.19 Jun 200922 Jun 202419 Jun 2025
14bido.wangeName Technology Co., Ltd.21 Oct 201521 Oct 201521 Oct 2016
15bido.bizeNom, Inc.24 Jan 200630 Oct 202423 Jan 2026
16bido.mobiFabulous.com Pty Ltd.15 Dec 200829 Jan 202515 Dec 2025
17bido.netFabulous.com Pty Ltd.8 Nov 200312 Nov 20218 Nov 2025
18bido.orgFabulous.com Pty Ltd.28 Sep 200312 Nov 202428 Sep 2025
19bido.usTLD Registrar Solutions Ltd.9 Mar 201130 May 20158 Mar 2022
20bido.ch----
21bido.de--27 May 2010-
22bido.websitePDR Ltd. d/b/a PublicDomainRegistry.com10 Sep 202231 Aug 202310 Sep 2025
23bido.onlineP.A. Viet Nam Company Limited2 Jun 20174 Jul 20172 Jun 2018
24bido.ltdAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…12 Sep 201712 Sep 201712 Sep 2018
25bido.inkAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…22 Sep 201722 Sep 201722 Sep 2018
26bido.co.uk-17 Apr 200018 Apr 202517 Apr 2025
27bido.fundGoDaddy.com, LLC21 Jul 20184 Sep 201921 Jul 2020
28bido.pageGlobal Domains International, Inc. DBA DomainCostC…23 Oct 201823 Oct 201823 Oct 2019
29bido.linkUniregistrar Corp16 Feb 201921 Feb 201916 Feb 2020
30bido.proGMO Internet Inc.22 Feb 20244 Apr 202522 Feb 2025
31bido.clubDynadot, LLC31 Dec 202131 Dec 202331 Dec 2023
32bido.agency1&1 Internet AG2 Aug 201916 Sep 20242 Aug 2025
33bido.dk-25 Mar 2019-31 Mar 2029
34bido.storeGoDaddy.com, LLC20 Oct 202425 Nov 202420 Oct 2025
35bido.groupChengdu West Dimension Digital Technology Co., Ltd…14 Nov 202024 Feb 202514 Nov 2025
36bido.bidName.com, Inc.7 Feb 20227 Feb 20227 Feb 2023
37bido.digitalCronon AG27 Jun 20229 Mar 202427 Jun 2024
38bido.graphicsNordreg AB21 Sep 202221 Sep 202221 Sep 2023
39bido.co.id-6 Oct 2022-6 Oct 2023
40bido.devGoogle, Inc.29 Nov 202220 Nov 202429 Nov 2025
41bido.com.pl-19 Jun 20189 Feb 202519 Jun 2025
42bido.appNameCheap, Inc.16 Jan 202317 Dec 202416 Jan 2026
43bido.lifeGoDaddy.com, LLC23 Feb 20239 Apr 202523 Feb 2026
44bido.it-15 Jan 200923 Jun 20247 Jun 2025
45bido.nl-5 Jan 20009 Nov 2023-
46bido.plNamware.com, Inc.27 Dec 200620 Dec 202427 Dec 2025
47bido.shopGoDaddy.com, LLC8 Aug 20178 Jun 20248 Aug 2024
48bido.pt-1 Oct 2023-1 Oct 2024
49bido.sa.comNameKing.com Inc.16 Dec 202330 Jan 202516 Dec 2024
50bido.financeCloudFlare, Inc.20 Feb 202426 Jan 202520 Feb 2026
51bido.uk-9 Dec 20151 Sep 20249 Dec 2025
52bido.ru-15 Feb 2024-15 Feb 2026
53bido.se-7 May 201526 Apr 20217 May 2025
54bido.sk-11 Jan 20199 Jan 202511 Jan 2026
55bido.cl-9 Nov 2024-9 Nov 2025
56bido.unoHostinger, UAB9 Nov 202414 Nov 20249 Nov 2025
57bido.blogAutomattic Inc.5 Mar 20255 May 20255 Mar 2026
58bidontravel.comNetwork Solutions, LLC15 May 200215 May 202015 May 2030
59bidouilleur.comOVH sas21 Aug 200322 Aug 202421 Aug 2025
60bidoorpal.comKagoya Japan Inc.10 Apr 200820 Nov 202410 Apr 2026
61bidoluhaber.tvHosting Concepts B.V. dba Openprovider5 Sep 202210 Sep 20245 Sep 2025
62bidonmyhouse.co.ukGoDaddy.com, LLC17 Aug 20101 Apr 201717 Aug 2018
63bidou.ca-4 Sep 202419 Dec 20244 Sep 2025
64bidoki.comTurnCommerce, Inc. DBA NameBright.com31 Mar 201425 Mar 202131 Mar 2026
65bidops.comCloudFlare, Inc.16 Apr 20171 Jun 202416 Apr 2026
66bidobido.comOVH sas22 Mar 200822 Mar 202422 Mar 2025
67bidondirectory.comNamePal.com, LLC3 Jan 20153 Jan 20153 Jan 2016
68bidonmygig.comeNom, Inc.18 Mar 200915 Mar 202518 Mar 2026
69bidolito.co.uk-25 May 202231 Oct 202425 May 2026
70bidonfusion.comKey-Systems GmbH17 Jan 201930 Jan 202517 Jan 2028
71bidonline.orgGoDaddy.com, LLC27 Sep 20168 Nov 201727 Sep 2018
72bidonthis.co.uk-8 Jul 20234 Apr 20258 Jul 2025
73bidoo.comGoDaddy.com, LLC20 Mar 200221 Mar 202420 Mar 2026
74bidorbuy.co.ke-25 May 20233 Jun 202425 May 2025
75bidorhire.comNameCheap, Inc.7 Jul 20146 Jul 20247 Jul 2025
76bidogabriel.com-21 Oct 201421 Oct 201421 Oct 2017
77bidomania.ru----
78bidoink.comNetwork Solutions, LLC3 Feb 202417 Mar 20253 Feb 2025
79bidonpads.comName.com, Inc.22 Oct 201422 Oct 201422 Oct 2015
80bidonapts.comName.com, Inc.22 Oct 201422 Oct 201422 Oct 2015
81bidolaeventagency.comAscio Technologies, Inc. Danmark - Filial af Ascio…22 Oct 201422 Oct 201422 Oct 2015
82bidorbuy.co.zaDomainz Limited24 Aug 199926 Jul 201724 Aug 2018
83bidolubaski.comGandi SAS22 Jan 201419 Dec 202422 Jan 2026
84bidoo.it-21 Feb 20114 May 20253 May 2025
85bidonmyjunk.comNamespro Solutions Inc.18 Jan 201823 Dec 202418 Jan 2026
86bidocsonline.comPSI-USA, Inc. dba Domain Robot20 Oct 201310 Dec 202420 Oct 2027
87bidonmydiamond.comGoDaddy.com, LLC24 Oct 201424 Oct 201424 Oct 2015
88bidolusupriz.comGoDaddy.com, LLC7 Mar 20207 Mar 20207 Mar 2021
89bidolumal.comNics Telekomünikasyon Ticaret Ltd. Şti.24 Oct 201424 Oct 201424 Oct 2015
90bidouillesikea.comOVH sas22 Oct 201323 Oct 202422 Oct 2025
91bidocha.neteNom, Inc.23 Oct 201423 Oct 201423 Oct 2015
92bidonfix.comDynadot12 LLC7 Dec 20208 Dec 20207 Dec 2021
93bidobama.comGoDaddy.com, LLC27 May 201127 May 201527 May 2016
94bidogiecigars.comGoDaddy.com, LLC28 May 201428 May 201528 May 2016
95bidouyany.comBeijing Lanhai Jiye Technology Co., Ltd12 May 202213 Jun 202412 May 2024
96bidorbuy.orgNameKing.com Inc.10 Jun 201823 Aug 202410 Jun 2024
97bidoobee.comWild West Domains, LLC31 May 20101 Jun 201531 May 2016
98bidobee.org----
99bidownload.netGoDaddy.com, LLC2 Jun 20143 Jun 20152 Jun 2016
100bidonmyservice.comDomain.com, LLC3 Apr 20163 Apr 20163 Apr 2017
101bidonchevys.comGoDaddy.com, LLC23 May 201124 May 201523 May 2016
102bidonchevrolets.comGoDaddy.com, LLC23 May 201124 May 201523 May 2016
103bidonnevada.comGoDaddy.com, LLC4 Jun 20095 Jun 20154 Jun 2016
104bidonisrael.comGoDaddy.com, LLC4 Jun 20095 Jun 20154 Jun 2016
105bidonhouse.comGoDaddy.com, LLC19 Apr 202224 Apr 202519 Apr 2026
106bidonfrance.comGoDaddy.com, LLC4 Jun 20095 Jun 20154 Jun 2016
107bidonkorea.comWhois Networks Co., Ltd.19 Dec 201819 Dec 201819 Dec 2019
108bidoncanada.comGoDaddy.com, LLC1 Oct 20221 Oct 20221 Oct 2025
109bidonrussia.comGoDaddy.com, LLC4 Jun 20095 Jun 20154 Jun 2016
110bidonlondon.comGoDaddy.com, LLC4 Jun 20095 Jun 20154 Jun 2016
111bidonspain.comGoDaddy.com, LLC4 Jun 20095 Jun 20154 Jun 2016
112bidondubai.comGMO Internet Inc.17 Jul 202422 Jul 202417 Jul 2025
113bidonmyapt.comGoDaddy.com, LLC6 Jun 20146 Jun 20156 Jun 2016
114bidonapartment.comGoDaddy.com, LLC6 Jun 20146 Jun 20156 Jun 2016
115bidonhamptons.comGoDaddy.com, LLC5 Jun 20096 Jun 20155 Jun 2016
116bidonapt.comGoDaddy.com, LLC6 Jun 20146 Jun 20156 Jun 2016
117bidonmyapartment.comGoDaddy.com, LLC6 Jun 20146 Jun 20156 Jun 2016
118bidonleads.comMoniker Online Services LLC9 Aug 20019 Sep 20249 Aug 2025
119bidoux.comNameKing.com Inc.26 Dec 200528 Feb 202526 Dec 2025
120bidonbands.comeNom, Inc.4 Jun 200915 Jun 20174 Jun 2018
121bidonvilles.comeNom, Inc.27 Jul 201215 Aug 202327 Jul 2025
122bidouillage.comeNom, Inc.28 Jul 201227 Jul 202428 Jul 2025
123bidous.comGoDaddy.com, LLC14 Sep 20212 Aug 202414 Sep 2025
124bidonwatt.comGoDaddy.com, LLC28 Feb 201128 Feb 201528 Feb 2016
125bidonwatts.comGoDaddy.com, LLC28 Feb 201128 Feb 201528 Feb 2016
126bidobid.com-16 Apr 202417 Apr 202516 Apr 2026
127bidonmoving.infoGoDaddy.com, LLC27 Oct 20147 Jan 202427 Oct 2023
128bidota.comGransy s.r.o. d/b/a subreg.cz25 Oct 202230 Dec 202325 Oct 2023
129bidoneverything.coGoDaddy.com, LLC24 Jul 201028 Jul 201423 Jul 2015
130bidourjobs.comGoDaddy.com, LLC28 Jul 200910 Jun 202428 Jul 2027
131bidourjob.comGoDaddy.com, LLC14 Jul 202015 Nov 202214 Jul 2030
132bidoop.comGoDaddy.com, LLC7 Mar 201417 Mar 20257 Mar 2026
133bidonestop.comBeijing Lanhai Jiye Technology Co., Ltd28 Apr 202229 Apr 202528 Apr 2026
134bidonmysurgery.comGoDaddy.com, LLC10 Feb 201330 Apr 201510 Feb 2017
135bidoodles.bizTucows Domains Inc.25 Oct 201128 Oct 201424 Oct 2014
136bidonhotels.comGoDaddy.com, LLC18 Apr 200029 Mar 202518 Apr 2026
137bidouyan.orgWest263 International Limited28 Oct 201428 Oct 202428 Oct 2025
138bidonmoving.orgGoDaddy.com, LLC27 Oct 20147 Jan 202427 Oct 2023
139bidonmoving.netGoDaddy.com, LLC27 Oct 20148 Dec 202327 Oct 2023
140bidown.comNameCheap, Inc.11 Oct 200611 Sep 202411 Oct 2025
141bidonvirginity.comGoDaddy.com, LLC16 Jan 200912 Jan 201516 Jan 2016
142bidonairfare.comGoDaddy.com, LLC5 Feb 20007 Jan 20155 Feb 2016
143bidonjewels.comGoDaddy.com, LLC16 Apr 201517 Apr 202516 Apr 2026
144bidonacar.comDynadot, LLC2 Jul 199830 Aug 20241 Jul 2026
145bidonbeaurivage.comGoDaddy.com, LLC23 Jun 201024 Jun 202423 Jun 2025
146bidoffs.comGoDaddy.com, LLC9 Jul 201810 Jul 20249 Jul 2025
147bidonfed.comGoDaddy.com, LLC18 Oct 201218 Oct 202418 Oct 2025
148bidonfeds.comGoDaddy.com, LLC18 Oct 201224 Oct 201418 Oct 2015
149bidot.comPSI-USA, Inc. dba Domain Robot29 May 200218 Jul 202429 May 2025
150bidoutlet.comTurnCommerce, Inc. DBA NameBright.com14 Oct 201218 Jul 202214 Oct 2025
151bidonkeywords.comGoDaddy.com, LLC7 May 200112 May 20257 May 2026
152bidose.comNameKing.com Inc.5 Jun 202128 Apr 20255 Jun 2026
153bidonmediaspace.comGoDaddy.com, LLC22 Mar 200817 Apr 201522 Mar 2020
154bidonadvertising.comGoDaddy.com, LLC21 Mar 200916 Feb 201721 Mar 2018
155bidoluoyun.netAtak Domain Hosting Internet d/b/a Atak Teknoloji29 Dec 201630 Dec 201629 Dec 2017
156bidondestin.comGoDaddy.com, LLC23 Jun 201024 Jun 202423 Jun 2025
157bidonvacationhomes.comGoDaddy.com, LLC22 Jun 20032 Jun 201522 Jun 2016
158bidontraffic.comGoDaddy.com, LLC2 Nov 20242 Nov 20242 Nov 2025
159bidonseats.comGoDaddy.com, LLC12 Oct 201420 Apr 201512 Oct 2015
160bidounsukar.comGoDaddy.com, LLC20 Feb 201228 Apr 201520 Feb 2016
161bidomatic.comDynadot, LLC9 Feb 200426 Sep 20242 Sep 2025
162bidonsilver.comGoDaddy.com, LLC20 Apr 20002 Jun 201520 Apr 2016
163bidondn.comGoDaddy.com, LLC1 May 20172 May 20171 May 2018
164bidonall.comGoDaddy.com, LLC7 May 201012 May 20257 May 2026
165bidonall.netGoDaddy.com, LLC7 May 201029 May 20157 May 2016
166bidonold.comGoDaddy.com, LLC7 May 201029 May 20157 May 2016
167bidonacondo.comGoDaddy.com, LLC12 Feb 20056 Feb 201512 Feb 2016
168bidonstamps.comKey-Systems GmbH22 Jul 202127 Aug 202422 Jul 2025
169bidoutthatjob.comGoDaddy.com, LLC31 Oct 201431 Oct 201431 Oct 2016
170bidolustore.comIHS Telekom, Inc.20 Feb 201816 Jan 202520 Feb 2026
171bidorpurchase.comGoDaddy.com, LLC7 Mar 20197 Mar 20197 Mar 2020
172bidorbids.comGoDaddy.com, LLC16 Jun 201417 Jun 201516 Jun 2016
173bidolumagaza.comSquarespace Domains LLC23 Dec 202423 Dec 202423 Dec 2025
174bidontools.comNetwork Solutions, LLC10 May 202515 May 202510 May 2026
175bidonrealestate.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Mar 20081 Feb 202524 Mar 2026
176bidodo.comNameCheap, Inc.31 Aug 20241 Sep 202431 Aug 2025
177bidonwestchester.comGoDaddy.com, LLC11 Jun 200912 Jun 202411 Jun 2026
178bidoh.comGoDaddy.com, LLC29 Nov 20062 Nov 202429 Nov 2025
179bidondeals4u.comGoDaddy.com, LLC19 Jun 201219 Jun 201519 Jun 2016
180bidom.comDynadot, LLC1 May 200711 Apr 202530 Apr 2026
181bidolulezzet.comGoDaddy.com, LLC20 Sep 202213 Sep 202420 Sep 2026
182bidolufikir.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Mar 201918 Mar 201918 Mar 2020
183bidometer.comGoDaddy.com, LLC24 Jan 201625 Jan 202524 Jan 2026
184bidonhotels.orgGoDaddy.com, LLC7 Dec 201619 Dec 20177 Dec 2018
185bidonfixerupper.comGoDaddy.com, LLC9 Jun 201010 Jun 20159 Jun 2016
186bidomi.comTucows Domains Inc.30 Oct 200916 Oct 202430 Oct 2025
187bidonflip.comGoDaddy.com, LLC9 Jun 201010 Jun 20159 Jun 2016
188bidonmyevent.comTucows Domains Inc.5 Feb 202421 Jan 20255 Feb 2026
189bidonhertime.comGoDaddy.com, LLC11 Jun 201411 Jun 201511 Jun 2016
190bidouelectrical.netGoDaddy.com, LLC11 Jun 201412 Jun 201511 Jun 2016
191bidows.comNameCheap, Inc.4 Jul 20205 Jun 20244 Jul 2025
192bidolazot54moosa.inWeb Werks India Pvt. Ltd d/b/a ZenRegistry.com20 Jan 201521 Mar 201520 Jan 2016
193bidonx.comFastDomain Inc.26 Jan 202411 Mar 202526 Jan 2025
194bidoncam.comGoDaddy.com, LLC13 Jun 201414 Jun 201513 Jun 2016
195bidonkafa.comFBS Inc.3 May 201626 Jul 20173 May 2018
196bidoover.comGoDaddy.com, LLC18 Aug 201418 Aug 201418 Aug 2015
197bidondolandscaping.comGoDaddy.com, LLC15 Jun 201416 Jun 201515 Jun 2016
198bidoc.netAscio Technologies, Inc. Danmark - Filial af Ascio…19 Aug 201420 Aug 202419 Aug 2025
199bidongxi.comBraveNames Inc.11 Jun 202112 Jun 202111 Jun 2022
200bidopublicidad.comGoDaddy.com, LLC5 Nov 20145 Nov 20145 Nov 2015
201bidonavet.comNetwork Solutions, LLC20 Aug 201420 Aug 201420 Aug 2015
202bidopet.org1&1 Internet AG19 Aug 2014-19 Aug 2015
203bidolu.comTurnCommerce, Inc. DBA NameBright.com2 Apr 20187 Apr 20252 Apr 2026
204bidolu.netTurnCommerce, Inc. DBA NameBright.com30 Oct 202110 Nov 202430 Oct 2025
205bidopps.comMegazone Corp., dba HOSTING.KR18 Dec 200816 Jan 202518 Dec 2025
206bidoktor.netFBS Inc.30 Nov 201830 Nov 201830 Nov 2019
207bidomain.netGoDaddy.com, LLC15 Jan 202227 Jan 202415 Jan 2025
208bidorange.comDomain.com, LLC6 Feb 201517 Feb 20176 Feb 2018
209bidortravel.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Nov 201428 Feb 20176 Nov 2018
210bidolualisveris.comNameCheap, Inc.30 Apr 202530 Apr 202530 Apr 2026
211bidony.bizTucows Domains Inc.4 Nov 20137 Nov 20143 Nov 2014
212bidonvia.comeNom, Inc.28 Feb 201528 Feb 201528 Feb 2016
213bidonwheels.comTurnCommerce, Inc. DBA NameBright.com6 Aug 202131 Jul 20226 Aug 2025
214bidolutema.comWix.com Ltd.22 Apr 202522 Apr 202522 Apr 2026
215bidonstorage.comDynadot, LLC7 Nov 201430 Mar 20247 Nov 2025
216bidoikn.comXin Net Technology Corporation30 Jul 201830 Jul 201830 Jul 2019
217bidonlubbock.comGoDaddy.com, LLC12 Aug 201412 Aug 201412 Aug 2015
218bidonthis.netGlobal Domain Name Trading Center Ltd22 Sep 20234 Nov 202422 Sep 2024
219bidoluyemek.comNics Telekomünikasyon Ticaret Ltd. Şti.20 Oct 202230 Dec 202320 Oct 2023
220bidolucicek.comNics Telekomünikasyon Ticaret Ltd. Şti.17 Mar 201717 Mar 202517 Mar 2026
221bidomains.comGoDaddy.com, LLC11 Jul 200616 Dec 202411 Jul 2025
222bidony.netKey-Systems GmbH3 Oct 20152 Oct 20163 Oct 2017
223bidonstorage.usGoDaddy.com, LLC7 Nov 20147 Nov 20146 Nov 2015
224bidonstorage.orgGoDaddy.com, LLC7 Nov 20148 Nov 20177 Nov 2018
225bidonstorage.netGoDaddy.com, LLC7 Nov 201419 Nov 20167 Nov 2017
226bidonstorage.infoGoDaddy.com, LLC7 Nov 20147 Nov 20147 Nov 2015
227bidokeeblog.comGoDaddy.com, LLC14 Aug 201414 Aug 201414 Aug 2017
228bidourway.comGoDaddy.com, LLC14 Aug 201411 Aug 201614 Aug 2017
229bidoluproje.comFBS Inc.24 Aug 201824 Aug 201824 Aug 2019
230bidophar.comP.A. Viet Nam Company Limited8 Aug 20149 Jul 20248 Aug 2029
231bidontime.comGoDaddy.com, LLC12 Jan 20214 Aug 202412 Jan 2028
232bidongida.comIHS Telekom, Inc.28 Aug 201410 Jun 201628 Aug 2017
233bidoluhobi.comNics Telekomünikasyon Ticaret Ltd. Şti.29 Jan 201723 Jan 202529 Jan 2026
234bidojo.orgNameCheap, Inc.17 Aug 201423 Jul 202417 Aug 2025
235bidonroom.comGoDaddy.com, LLC27 Mar 202127 Mar 202127 Mar 2022
236bidoften.comGoDaddy.com, LLC23 Sep 201624 Sep 202423 Sep 2026
237bidosx.comGoDaddy.com, LLC14 Nov 201414 Nov 201414 Nov 2015
238bidovi.comTucows Domains Inc.30 Aug 20143 Sep 202130 Aug 2021
239bidonrenorentals.comGoDaddy.com, LLC13 Sep 201413 Sep 201413 Sep 2016
240bidomain.comGoDaddy.com, LLC29 Jul 200516 Dec 202429 Jul 2025
241bidonexec.comGoDaddy.com, LLC14 Sep 20146 Aug 201614 Sep 2017
242bidonshelfspace.comGoDaddy.com, LLC14 Sep 201414 Sep 201414 Sep 2015
243bidona.netTucows Domains Inc.22 Oct 202310 Oct 202422 Oct 2025
244bidolubutik.comRealtime Register B.V.29 Nov 202129 Nov 202129 Nov 2022
245bidooh.comGoDaddy.com, LLC8 Feb 20123 Feb 20258 Feb 2026
246bidoora.comNameCheap, Inc.13 Dec 202413 Dec 202413 Dec 2025
247bidora.netGoDaddy.com, LLC2 Sep 201414 Oct 20242 Sep 2024
248bidora.orgGoDaddy.com, LLC2 Sep 201414 Oct 20242 Sep 2024
249bidonbait.com1&1 Internet AG15 Sep 201415 Sep 201415 Sep 2015
250bidoccasion.comTucows Domains Inc.9 Dec 202426 Dec 20249 Dec 2025
251bidontools.netNetwork Solutions, LLC14 Nov 20142 Feb 201814 Nov 2020
252bidonvape.comGoDaddy.com, LLC17 Nov 201417 Nov 201417 Nov 2015
253bidonbody.comTucows Domains Inc.13 Nov 200617 Nov 201413 Nov 2015
254bidorbuyparts.infoTucows Domains Inc.13 Nov 201217 Nov 201413 Nov 2015
255bidofvic.com-17 Apr 202218 Apr 202317 Apr 2024
256bidonbeads.comHongkong Domain Name Information Management Co., L…17 Apr 202117 Apr 202117 Apr 2022
257bidoncamp.comTurnCommerce, Inc. DBA NameBright.com25 Nov 201819 Nov 202025 Nov 2025
258bidorbook.comTurnCommerce, Inc. DBA NameBright.com24 Jul 201418 Jul 202024 Jul 2025
259bidotou.comGMO Internet Inc.7 Sep 20147 Sep 20147 Sep 2015
260bidodent.comBigRock Solutions Ltd.21 Sep 201421 Sep 201421 Sep 2015
261bidonmyremodel.comGoDaddy.com, LLC21 Sep 201421 Sep 201421 Sep 2015
262bidoservice.comBigRock Solutions Ltd.21 Sep 201421 Sep 201421 Sep 2015
263bidoncamp.infoGoDaddy.com, LLC8 Sep 20149 Sep 20178 Sep 2018
264bidoncamp.netGoDaddy.com, LLC8 Sep 201411 Apr 20168 Sep 2017
265bidoncamp.orgGoDaddy.com, LLC8 Sep 20149 Sep 20178 Sep 2018
266bidong.orgEpik Inc.4 Aug 200114 Nov 20174 Aug 2018
267bidonlongisland.comGoDaddy.com, LLC8 Sep 201427 Apr 202515 Apr 2026
268bidorian.comGoDaddy.com, LLC9 Sep 20149 Sep 20149 Sep 2015
269bidoevents.comLaunchpad, Inc.1 Oct 20142 Oct 20211 Oct 2027
270bidoche.comAzdomainz LLC18 Nov 20143 Jan 202518 Nov 2025
271bidorbuyparts.orgTucows Domains Inc.13 Nov 201217 Nov 201413 Nov 2015
272bidolubilet.comDomainsofvalue.com LLC20 Apr 202423 Apr 202520 Apr 2026
273bidoglobal.comGoDaddy.com, LLC3 Oct 20143 Oct 20143 Oct 2015
274bidoceangiftbasket.comTucows Domains Inc.9 Sep 201313 Sep 20159 Sep 2016
275bidois.comPorkbun, LLC10 Sep 20149 Sep 202410 Sep 2025
276bidonfree.comGoDaddy.com, LLC10 Sep 201410 Sep 201410 Sep 2016
277bidonr.comGoDaddy.com, LLC20 Nov 201420 Nov 201420 Nov 2015
278bidonlaborjobs.comOmnis Network, LLC11 Sep 201422 Aug 201611 Sep 2017
279bidovate.comGoDaddy.com, LLC3 Jan 20234 Jan 20253 Jan 2026
280bidonfl.comGoDaddy.com, LLC23 Sep 201424 Sep 202423 Sep 2025
281bidonmylisting.comGoDaddy.com, LLC17 Mar 202417 Mar 202417 Mar 2027
282bidoluparca.comPDXPrivateNames.com LLC25 Apr 202428 Apr 202525 Apr 2026
283bidonlawyer.comGoDaddy.com, LLC24 Sep 201424 Sep 201424 Sep 2015
284bidonlawyers.comGoDaddy.com, LLC24 Sep 201424 Sep 201424 Sep 2015
285bidoncafe.com1&1 Internet AG24 Sep 201425 Sep 201624 Sep 2017
286bidoe.orgInternet.bs Corp.16 Sep 201426 Sep 201416 Sep 2015
287bidonenergy.orgGoDaddy.com, LLC16 Sep 201410 Jul 202416 Sep 2026
288bidoktoradanis.orgReg2C.com Inc.25 Sep 201425 Sep 201425 Sep 2015
289bidolumobilya.com-15 Jul 202415 Jul 202415 Jul 2025
290bidoncribs.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Oct 20148 Oct 20148 Oct 2015
291bidonville-lefilm.comGoDaddy.com, LLC8 Oct 20149 Oct 20168 Oct 2017
292bidoktoradanis.netReg2C.com Inc.25 Sep 201425 Sep 201425 Sep 2015
293bidoktorasor.netFBS Inc.29 Oct 201613 Oct 201729 Oct 2018
294bidoktorasor.orgReg2C.com Inc.25 Sep 201425 Sep 201425 Sep 2015
295bidolu.orgTurnCommerce, Inc. DBA NameBright.com18 Nov 20212 Jan 202518 Nov 2025
296bidonvilles.orgCronon AG10 Oct 201411 Oct 201610 Oct 2017
297bidoucheservices.comRegister.it SPA29 Sep 20141 Nov 202429 Sep 2025
298bidorbribe.comTucows Domains Inc.19 Nov 201323 Nov 201419 Nov 2015
299bidondomainnames.comPorkbun, LLC19 Feb 20212 Mar 202519 Feb 2026
300bidondomainname.comGoDaddy.com, LLC2 Oct 20242 Oct 20242 Oct 2025
301bidonauction.comDynadot, LLC10 Oct 20031 Oct 202410 Oct 2025
302bidonpopculture.comGoDaddy.com, LLC13 Oct 201413 Oct 201413 Oct 2015
303bidorkwnogheng.comTucows Domains Inc.13 Oct 201417 Oct 201513 Oct 2016
304bidoonsokkar.comWild West Domains, LLC25 Sep 201425 Sep 201425 Sep 2015
305bidonlinerealty.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Sep 201426 Sep 201426 Sep 2016
306bidondelivery.com-23 Jul 201623 Jul 201623 Jul 2017
307bidoktoradanis.comReg2C.com Inc.25 Sep 201425 Sep 201425 Sep 2015
308bidoctor.comWild Bunch Domains, LLC4 Jan 202417 Feb 20254 Jan 2025
309bidofying.comGoDaddy.com, LLC15 Oct 201415 Oct 201415 Oct 2015
310bidoktoragozuk.comGoDaddy.com, LLC14 Oct 201414 Oct 201414 Oct 2015
311bidoupai.comGoDaddy.com, LLC10 Sep 201910 Sep 201910 Sep 2020
312bidopore.comGMO Internet Inc.17 Oct 201417 Oct 201417 Oct 2015
313bidorbuyparts.comDropCatch.com 435 LLC1 Jan 20152 Jan 20171 Jan 2018
314bidolusurpriz.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Jan 20188 Jan 20188 Jan 2019
315bidolukahve.comİsimtescil Bilişim A.Ş.12 Apr 202413 Apr 202512 Apr 2026
316bidourlnks.comCSL Computer Service Langenbach GmbH d/b/a joker.c…4 Aug 202316 Jun 20244 Aug 2025
317bidonlistings.comGoDaddy.com, LLC28 Feb 20221 Mar 202528 Feb 2026
318bidonoo.com1&1 Internet AG27 Nov 201419 Feb 201827 Nov 2018
319bidouilliste.comOnline SAS28 Nov 20148 Oct 202428 Nov 2025
320bidonaspen.comGoDaddy.com, LLC28 Nov 201429 Nov 201428 Nov 2015
321bidouilliste.orgGandi SAS28 Nov 20142 Nov 201728 Nov 2018
322bidouilliste.netGandi SAS28 Nov 20142 Nov 201728 Nov 2018
323bidonshelter.comeNom, Inc.1 Dec 20141 Dec 20141 Dec 2015
324bidonic.comTurnCommerce, Inc. DBA NameBright.com25 Mar 202425 Mar 202425 Mar 2026
325bidonhotel.comRabbitsfoot.com LLC d/b/a Oxygen.nyc13 May 201726 Jun 202413 May 2025
326bidolukirtasiye.comIHS Telekom, Inc.27 Oct 20227 Dec 202327 Oct 2023
327bidolubilisim.comNics Telekomünikasyon Ticaret Ltd. Şti.11 Sep 202221 Nov 202311 Sep 2023
328bidovec.netNameCheap, Inc.1 Dec 201430 Nov 20241 Dec 2025
329bidonic.net1&1 Internet AG1 Dec 20142 Dec 20161 Dec 2017
330bidouilles-et-cie.comOVH sas3 Dec 20143 Dec 20143 Dec 2015
331bidonsex.comWebfusion Ltd.14 Feb 201614 Feb 201614 Feb 2018
332bidonstorage.bizGoDaddy.com, LLC6 Dec 20146 Dec 20145 Dec 2015
333bidon.bizGoDaddy.com, LLC6 Dec 20146 Dec 20145 Dec 2015
334bidolukampanya.comİsimtescil Bilişim A.Ş.13 Jun 202413 Jun 202413 Jun 2025
335bidon.infoKey-Systems GmbH8 Mar 201622 Apr 20258 Mar 2026
336bidourtransport.comGoDaddy.com, LLC6 Dec 20146 Dec 20146 Dec 2015
337bidon.mobiGoDaddy.com, LLC6 Dec 20146 Dec 20146 Dec 2015
338bidonmyrate.comGoDaddy.com, LLC8 Dec 20148 Dec 20148 Dec 2015
339bidoluucuzluk.comIHS Telekom, Inc.8 Dec 20148 Dec 20148 Dec 2015
340bidordie.comNameCheap, Inc.19 Feb 202519 Feb 202519 Feb 2026
341bidoox.comTucows Domains Inc.29 Feb 20204 Mar 202128 Feb 2021
342bidonusum.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Dec 201411 Dec 201411 Dec 2015
343bidoart.comFabulous.com Pty Ltd.4 Dec 201231 Dec 20244 Dec 2025
344bidoluzebra.comIHS Telekom, Inc.13 Dec 201413 Dec 201413 Dec 2015
345bidofame.comTucows Domains Inc.13 Dec 201417 Dec 201713 Dec 2017
346bidocarot.comeNom, Inc.15 Dec 201415 Dec 201415 Dec 2015
347bidonmywedding.netGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2015
348bidonmywedding.infoGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2015
349bidonsa.comFBS Inc.18 Dec 201418 Dec 201418 Dec 2015
350bidonestates.comTucows Domains Inc.18 Dec 201421 Nov 202218 Dec 2027
351bidonneworleans.comGoDaddy.com, LLC19 Dec 201419 Dec 201419 Dec 2015
352bidosya.netPDR Ltd. d/b/a PublicDomainRegistry.com18 Dec 201418 Dec 201418 Dec 2015
353bidonsa.orgFBS Inc.18 Dec 201418 Dec 201418 Dec 2015
354bidonsa.netFBS Inc.18 Dec 201418 Dec 201418 Dec 2015
355bidoche-lelivre.comNameKing.com Inc.14 Nov 20209 Dec 202414 Nov 2025
356bidolumarket.comGoDaddy.com, LLC17 Mar 202017 Mar 202417 Mar 2026
357bidolio.comGoDaddy.com, LLC22 Dec 201422 Dec 201422 Dec 2015
358bidoleo.comGoDaddy.com, LLC22 Dec 201422 Dec 201422 Dec 2015
359bidoncourse.comDropCatch.com 908 LLC11 Mar 201612 Mar 201711 Mar 2018
360bidoncourse.netGoDaddy.com, LLC23 Dec 201423 Dec 201423 Dec 2015
361bidoncourse.infoGoDaddy.com, LLC23 Dec 201423 Dec 201423 Dec 2015
362bidolual.comAtak Domain Hosting Internet d/b/a Atak Teknoloji19 Oct 202019 Oct 202019 Oct 2021
363bidoncourse.orgGoDaddy.com, LLC23 Dec 201423 Dec 201423 Dec 2015
364bidoubi.comDynadot4 LLC17 Aug 202227 Sep 202317 Aug 2023
365bidonseafood.comGoDaddy.com, LLC26 Dec 201427 Dec 202426 Dec 2026
366bidonitweb.comregister.com, Inc.27 Dec 201427 Dec 201427 Dec 2015
367bidonhidood.comGoDaddy.com, LLC27 Dec 201427 Dec 201427 Dec 2015
368bidonesdeplastico.comDynadot, LLC13 Aug 201822 Sep 202413 Aug 2024
369bidoncaviar.comGoDaddy.com, LLC26 Dec 201426 Dec 201426 Dec 2015
370bidoozle.comTurnCommerce, Inc. DBA NameBright.com17 Mar 201827 Apr 202517 Mar 2025
371bidonmy.comTurnCommerce, Inc. DBA NameBright.com12 Mar 20156 Mar 202112 Mar 2026
372bidolusabun.comGoDaddy.com, LLC27 Dec 201428 Dec 201427 Dec 2015
373bidonlineauction.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Feb 20255 Mar 202525 Feb 2027
374bidonsleague.netGMO Internet Inc.28 Dec 201429 Dec 201428 Dec 2015
375bidonhidood.netGoDaddy.com, LLC28 Dec 201428 Dec 201428 Dec 2015
376bido-bido.comGoDaddy.com, LLC2 Jan 201516 Mar 20252 Jan 2025
377bidolupazar.comİsimtescil Bilişim A.Ş.28 Dec 20189 Feb 202528 Dec 2024
378bidonyourdate.netGoDaddy.com, LLC4 Jan 20154 Jan 20154 Jan 2016
379bidonyourdate.infoGoDaddy.com, LLC4 Jan 20154 Jan 20154 Jan 2016
380bidorganizer.buildGoDaddy.com, LLC8 Aug 201413 Aug 20148 Aug 2016
381bidonmydwi.lawyerGoDaddy.com, LLC9 Oct 201410 Oct 20179 Oct 2018
382bidonmycase.lawyerGoDaddy.com, LLC9 Oct 201410 Jan 20179 Oct 2017
383bidonmybankruptcy.lawyerGoDaddy.com, LLC9 Oct 201423 Nov 20179 Oct 2018
384bidonmydivorce.lawyerGoDaddy.com, LLC9 Oct 201410 Jan 20179 Oct 2017
385bidon.dealseNom, Inc.15 Oct 201415 Oct 201415 Oct 2015
386bidoptimizer.xyzPDR Ltd. d/b/a PublicDomainRegistry.com11 Aug 201511 Aug 201511 Aug 2016
387bidocean.linkTucows Domains Inc.27 Oct 201431 Oct 202327 Oct 2024
388bidou.wangChengdu West Dimension Digital Technology Co., Ltd…15 Jan 201615 Jan 201615 Jan 2017
389bidon.toolsNetwork Solutions, LLC7 Nov 201424 Oct 20197 Nov 2020
390bidopium.xyzGMO Internet Inc.12 Nov 201412 Nov 201412 Nov 2015
391bidonstorage.bidGoDaddy.com, LLC6 Dec 20146 Dec 20145 Dec 2015
392bidon.auctionGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2015
393bidonyourdate.guruGoDaddy.com, LLC4 Jan 20156 Jan 20174 Jan 2018
394bidoluavm.netFBS Inc.12 Aug 201512 Aug 201512 Aug 2016
395bidointernational.comGoDaddy.com, LLC16 Apr 201716 Apr 201716 Apr 2018
396bidonit.todayGoDaddy.com, LLC30 Jan 201516 Mar 202530 Jan 2026
397bidonline.auctionGoDaddy.com, LLC11 Feb 201511 Feb 201511 Feb 2016
398bidocean.workGoDaddy.com, LLC10 Feb 201516 Feb 202510 Feb 2026
399bidoffer.auctionGoDaddy.com, LLC20 Feb 201520 Feb 201520 Feb 2016
400bidonline.bidGoDaddy.com, LLC25 Feb 20152 Mar 202524 Feb 2027
401bidonit.auctionGoDaddy.com, LLC25 Feb 201511 Apr 202525 Feb 2026
402bidonline.centerGoDaddy.com, LLC25 Feb 201511 Apr 202525 Feb 2026
403bidon.servicesregister.com, Inc.1 Mar 20151 Mar 20151 Mar 2016
404bidorbuy.bidNamesilo, LLC9 Aug 201723 Sep 20249 Aug 2025
405bidonthis.auctionMesh Digital Limited12 Mar 201512 Mar 201512 Mar 2016
406bidorbuy.xyzPorkbun, LLC24 Oct 201831 Aug 202324 Oct 2025
407bidong.xyzDNSPod, Inc.15 Nov 2021-15 Nov 2022
408bidong.wangeName Technology Co., Ltd.17 Apr 20158 Nov 201717 Apr 2026
409bidon.failGoDaddy.com, LLC17 Apr 201517 Apr 201517 Apr 2016
410bidon.exposedGoDaddy.com, LLC17 Apr 201517 Apr 201517 Apr 2016
411bidonite.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Jan 201513 Dec 20245 Jan 2026
412bidolucanta.comRealtime Register B.V.14 Oct 202111 Oct 202414 Oct 2025
413bidorrent.comGoDaddy.com, LLC5 Jan 201510 Jan 20255 Jan 2026
414bidorent.comGoDaddy.com, LLC5 Jan 201510 Jan 20255 Jan 2026
415bidonbase.comName.com, Inc.7 Jan 20157 Jan 20157 Jan 2016
416bidolucep.comNics Telekomünikasyon Ticaret Ltd. Şti.21 Oct 202131 Dec 202421 Oct 2024
417bidonyourdate.usGoDaddy.com, LLC4 Jan 20154 Jan 20153 Jan 2016
418bidonyourdate.orgGoDaddy.com, LLC4 Jan 20154 Jan 20154 Jan 2016
419bidolukonu.comBeijing Lanhai Jiye Technology Co., Ltd6 Jul 20227 Aug 20246 Jul 2024
420bidonunits.comFastDomain Inc.14 Aug 201514 Aug 201514 Aug 2016
421bidonlinewilson.comGoDaddy.com, LLC9 Jan 201510 Jan 20259 Jan 2027
422bidonme3.comGoDaddy.com, LLC10 Jan 201510 Jan 201510 Jan 2016
423bidontabs.comGoDaddy.com, LLC14 Jan 201514 Jan 201514 Jan 2016
424bidonnormans.comGoDaddy.com, LLC14 Jan 201514 Jan 201514 Jan 2016
425bidolubazaar.comIHS Telekom, Inc.14 Jan 201514 Jan 201514 Jan 2016
426bidonanae.comDynadot, LLC10 Apr 201910 Apr 201910 Apr 2020
427bidonbar.comNameCheap, Inc.28 Dec 202428 Dec 202428 Dec 2025
428bidoffer.usGoDaddy.com, LLC14 Aug 201514 Aug 201613 Aug 2017
429bidols.comChengdu West Dimension Digital Technology Co., Ltd…7 Jun 20197 Jun 20197 Jun 2020
430bidonanae.orgRegister.it SPA15 Jan 2015-15 Jan 2016
431bidonanae.netRegister.it SPA15 Jan 201515 Jan 201515 Jan 2016
432bidon.wangeName Technology Co., Ltd.14 May 201514 May 201514 May 2016
433bidong.pubAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 May 20152 Jul 201725 May 2017
434bidonmy.workMinds + Machines Registrar Limited15 Jun 201515 Jun 201515 Jun 2016
435bidon.workMinds + Machines Registrar Limited15 Jun 201515 Jun 201515 Jun 2016
436bidode.linkNameCheap, Inc.21 Jun 201521 Jun 201521 Jun 2016
437bidong.clubAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…26 Jun 2015-25 Jun 2016
438bidopedia.comGoDaddy.com, LLC16 Aug 201516 Aug 201516 Aug 2016
439bidonmythings.comGoDaddy.com, LLC18 Nov 202014 Mar 202518 Nov 2025
440bidonlinerealestateauctions.comGoDaddy.com, LLC16 Aug 201516 Aug 201516 Aug 2016
441bidonlinerealestateauction.comGoDaddy.com, LLC16 Aug 201516 Aug 201516 Aug 2016
442bidonlinerealestate.auctionGoDaddy.com, LLC16 Aug 201516 Aug 201516 Aug 2016
443bidoluvideo.workKey-Systems, LLC25 Jul 201525 Jul 201525 Jul 2016
444bidoffices.spacePDR Ltd. d/b/a PublicDomainRegistry.com4 Aug 20154 Aug 20154 Aug 2016
445bidoo.win1&1 Internet AG5 Aug 20155 Aug 20154 Aug 2016
446bidotestosteronetherapyonline.comTucows Domains Inc.17 Jan 201521 Jan 201717 Jan 2017
447bidotestosteronetherapyonline.orgTucows Domains Inc.17 Jan 201521 Jan 201617 Jan 2017
448bidolution.comGoDaddy.com, LLC20 Jan 201520 Jan 201520 Jan 2016
449bidonmytrade.orgGoDaddy.com, LLC18 Jan 201518 Jan 201518 Jan 2016
450bidonmybusiness.netGoDaddy.com, LLC18 Jan 201518 Jan 201518 Jan 2016
451bidonhotels.netGoDaddy.com, LLC7 Dec 20167 Dec 20167 Dec 2017
452bidonyourride.comDomain.com, LLC21 Jan 201521 Jan 201521 Jan 2017
453bidoludukkan.comNics Telekomünikasyon Ticaret Ltd. Şti.19 Mar 202229 May 202319 Mar 2023
454bidoludukkan.netFBS Inc.21 Jan 201522 Jan 201521 Jan 2017
455bidonmycompany.comGoDaddy.com, LLC24 Jan 201524 Jan 201524 Jan 2016
456bidonlogo.comKey-Systems GmbH23 Jan 201516 Jan 201723 Jan 2018
457bidolusus.comFBS Inc.23 Jan 201523 Jan 201523 Jan 2016
458bidonlogo.orgKey-Systems GmbH23 Jan 201523 Jan 201523 Jan 2016
459bidonlogo.netKey-Systems GmbH23 Jan 201523 Jan 201523 Jan 2016
460bidonsarebottles.comeNom, Inc.26 Jan 201526 Jan 201526 Jan 2016
461bidonmedia.comCrazy Domains FZ-LLC26 Jan 201530 Nov 201526 Jan 2018
462bidoluhersey.comFBS Inc.27 Jan 201520 May 201727 Jan 2018
463bidoverdraft.netregister.com, Inc.18 Aug 201518 Aug 201518 Aug 2016
464bidouyanyao.com-15 Dec 202115 Feb 202415 Dec 2023
465bidomen.comAccentDomains LLC27 Jan 201827 Jan 201827 Jan 2019
466bidon-energy.orgGoDaddy.com, LLC28 Jan 201529 Jan 201528 Jan 2016
467bidoluhersey.mobiFBS Inc.27 Jan 201527 Jan 201527 Jan 2016
468bidonstars.comInlandDomains, LLC30 Jan 201530 Jan 201530 Jan 2016
469bidonjunk.comGoDaddy.com, LLC30 Jan 201531 Jan 202530 Jan 2027
470bidoiesel.comCloud Yuqu LLC27 Oct 201927 Oct 201927 Oct 2020
471bidohagala.comDomain.com, LLC29 Jan 201524 Jan 201729 Jan 2018
472bidonenergy.netGoDaddy.com, LLC29 Jan 201530 Jan 202529 Jan 2026
473bidoof.partyAlpnames Limited7 May 2015-6 May 2016
474bidonsarebottles.neteNom, Inc.26 Jan 201526 Jan 201526 Jan 2016
475bidoul.design1&1 Internet AG12 May 201512 May 201512 May 2016
476bidoluvantage.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Jan 201531 Jan 201531 Jan 2016
477bidoluinsan.comRealtime Register B.V.19 Aug 201519 Aug 201519 Aug 2016
478bidonmedications.comDynadot, LLC2 Feb 20152 Feb 20152 Feb 2016
479bidonmedication.comDynadot, LLC2 Feb 20152 Feb 20152 Feb 2016
480bidondrug.comGoDaddy.com, LLC21 Jun 201721 Jun 201721 Jun 2018
481bidongapp.comXin Net Technology Corporation4 Feb 20152 Feb 20214 Feb 2022
482bidonspokaneradio.comGoDaddy.com, LLC4 Feb 201527 Apr 202515 Apr 2026
483bidoluesya.com-24 Mar 202324 Apr 202524 Mar 2025
484bidolucuz.comFBS Inc.20 Aug 201520 Aug 201520 Aug 2016
485bidolphindream.comGoDaddy.com, LLC8 Feb 20159 Feb 20158 Feb 2017
486bidooskls.comTucows Domains Inc.9 Feb 201513 Feb 20169 Feb 2017
487bidonconstructionprojects.comGoDaddy.com, LLC9 Feb 201510 Feb 20259 Feb 2026
488bidoncommercialprojects.comGoDaddy.com, LLC9 Feb 201510 Feb 20259 Feb 2026
489bidonauburn.comMarkMonitor Inc.9 Feb 201514 Mar 202515 Apr 2026
490bidossessiong.orgLigne Web Services SARL10 Jun 201710 Aug 201710 Jun 2018
491bidome.netInternet Domain Services BS Corp3 Jul 202012 Jun 20243 Jul 2025
492bidoia.netGoDaddy.com, LLC30 May 201910 Jun 202430 May 2025
493bidouillepoucette.comNamebay SAM23 Jul 201724 Jun 202423 Jul 2025
494bidotis.com-3 Aug 20203 Aug 20203 Aug 2021
495bidongli.comHiChina Zhicheng Technology Limited21 Aug 201510 Aug 201621 Aug 2017
496bidonmyhousescotland.comWebfusion Ltd.16 Feb 20159 Feb 201716 Feb 2019
497bidobachelorette.comLaunchpad, Inc.17 Feb 20152 Feb 201717 Feb 2018
498bidoktor.orgFBS Inc.14 Mar 20175 Jul 201714 Mar 2018
499bidoncincy.comMarkMonitor Inc.21 Jun 20212 Aug 202421 Jun 2025
500bidolusepet.netIHS Telekom, Inc.25 Sep 201725 Sep 201725 Sep 2018
501bidontheki.comRegister.it SPA19 Feb 201519 Feb 201519 Feb 2016
502bidonesperu.comGoDaddy.com, LLC9 Apr 201913 Apr 20259 Apr 2026
503bidoneverything.comGoDaddy.com, LLC11 Feb 202011 Feb 202511 Feb 2026
504bidoevents.netNetwork Solutions, LLC19 Feb 201519 Feb 201519 Feb 2016
505bidonmy.infoGoDaddy.com, LLC15 Feb 2015-15 Feb 2016
506bidonsites.comGoDaddy.com, LLC7 Jul 20167 Jul 20167 Jul 2017
507bidonagig.comNamesilo, LLC17 Apr 202018 Apr 202017 Apr 2021
508bidoushiye.comDropCatch.com 1233 LLC5 Nov 20195 Nov 20195 Nov 2020
509bidondomain.comGoDaddy.com, LLC22 Aug 201523 Aug 202422 Aug 2025
510bidonmytrades.comGoDaddy.com, LLC23 Feb 201523 Feb 201523 Feb 2016
511bidonbets.comGoDaddy.com, LLC23 Feb 201523 Feb 201523 Feb 2016
512bidonstudio.comAscio Technologies, Inc. Danmark - Filial af Ascio…24 Feb 201524 Feb 201524 Feb 2016
513bidonmytrades.netGoDaddy.com, LLC23 Feb 201523 Feb 201523 Feb 2016
514bidonit.usGoDaddy.com, LLC25 Feb 201525 Feb 201724 Feb 2018
515bidonwilmington.com1&1 Internet AG26 Feb 20157 Mar 202426 Feb 2026
516bidolan.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Feb 201526 Feb 201526 Feb 2016
517bidokeecoop.comGoDaddy.com, LLC26 Feb 201526 Feb 201526 Feb 2016
518bidourprojects.comGoDaddy.com, LLC27 Feb 201527 Feb 201527 Feb 2016
519bidokeecoop.orgGoDaddy.com, LLC26 Feb 201526 Feb 201526 Feb 2016
520bidokeecoop.netGoDaddy.com, LLC26 Feb 201526 Feb 201526 Feb 2016
521bidokeecoop.infoGoDaddy.com, LLC26 Feb 2015-26 Feb 2016
522bidoluesya.netLaunchpad, Inc.22 Feb 201522 Feb 201522 Feb 2016
523bidorbuyit.comGoDaddy.com, LLC14 Dec 201814 Dec 201814 Dec 2019
524bidonaut.comNameCheap, Inc.17 May 202229 Jun 202317 May 2023
525bidonabooth.comWild West Domains, LLC24 Aug 201524 Aug 201524 Aug 2016
526bidoffice.netDynadot, LLC23 Aug 201523 Aug 201523 Aug 2017
527bidoori.net-12 Oct 201612 Oct 201612 Oct 2017
528bidozoyun.comGoogle, Inc.5 Mar 20156 Mar 20175 Mar 2018
529bidonmytruck.com----
530bidonmeals.comWild West Domains, LLC28 Mar 202129 Mar 202528 Mar 2026
531bidonmytruck.netGoDaddy.com, LLC7 Mar 20157 Mar 20157 Mar 2016
532bidonmytruck.infoGoDaddy.com, LLC7 Mar 2015-7 Mar 2016
533bidonitforcharity.org1API GmbH6 Mar 2015-6 Mar 2016
534bidonitforcharity.com1API GmbH7 Mar 20157 Mar 20157 Mar 2016
535bidology.bizGoDaddy.com, LLC8 Mar 201519 Mar 20177 Mar 2017
536bidonmywedding.comGMO Internet Inc.19 Aug 202120 Aug 202119 Aug 2022
537bidolukiralik.com----
538bidonmyproperty.comDynadot, LLC20 Feb 202121 Feb 202120 Feb 2022
539bidology.usGoDaddy.com, LLC8 Mar 20158 Mar 20157 Mar 2016
540bidodate.comGoDaddy.com, LLC25 Aug 202325 Aug 202325 Aug 2024
541bidology.orgGoDaddy.com, LLC8 Mar 20158 Mar 20158 Mar 2016
542bidonmyparty.comGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2017
543bidonmyparties.comGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2017
544bidonbloomington.comGoDaddy.com, LLC11 Mar 201522 Apr 202511 Mar 2025
545bidoluayakkabi.comNics Telekomünikasyon Ticaret Ltd. Şti.20 Oct 202230 Dec 202320 Oct 2023
546bidost.netRealtime Register B.V.10 Mar 20156 Mar 202510 Mar 2026
547bidonmyparty.usGoDaddy.com, LLC10 Mar 201510 Mar 20159 Mar 2017
548bidonpot.comGoDaddy.com, LLC12 Mar 201512 Mar 201512 Mar 2016
549bidonden.comNameCheap, Inc.1 Feb 2022-1 Feb 2023
550bidoncrib.comName.com, Inc.12 Mar 201512 Mar 201512 Mar 2016
551bidoncondo.comName.com, Inc.12 Mar 201512 Mar 201512 Mar 2016
552bidonestates.netGoDaddy.com, LLC12 Mar 201513 Mar 202512 Mar 2026
553bidonglasspipes.comGoDaddy.com, LLC15 Mar 201515 Mar 201515 Mar 2016
554bidoluu.comFBS Inc.14 Mar 201514 Mar 201514 Mar 2016
555bidosa.comGoDaddy.com, LLC13 Nov 20168 May 202513 Nov 2025
556bidonmytruck.orgGoDaddy.com, LLC7 Mar 20157 Mar 20157 Mar 2016
557bidology.netGoDaddy.com, LLC8 Mar 20158 Mar 20158 Mar 2016
558bidology.mobiGoDaddy.com, LLC8 Mar 20158 Mar 20158 Mar 2016
559bidonenc.comGoDaddy.com, LLC17 Mar 201518 Mar 202517 Mar 2026
560bidonhotelrooms.orgGoDaddy.com, LLC9 Dec 201621 Dec 20179 Dec 2018
561bidotados.orgGoDaddy.com, LLC18 Mar 201518 Mar 201518 Mar 2016
562bidorbuy.infoAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 May 20232 Jul 202425 May 2024
563bidonpussy.comMijn InternetOplossing B.V.21 Mar 201521 Mar 201521 Mar 2016
564bidoya.comGoDaddy.com, LLC26 Aug 201530 Mar 202526 Aug 2026
565bidountaklid.comRealtime Register B.V.22 Mar 201522 Mar 201522 Mar 2016
566bidonsnotbottles.com1&1 Internet AG23 Mar 201523 Mar 201723 Mar 2026
567bidonequipo5.comGoDaddy.com, LLC23 Mar 201523 Mar 201523 Mar 2016
568bidorbuycoins.comGoDaddy.com, LLC24 Mar 201525 Mar 202524 Mar 2027
569bidolufirsat.com-2 Mar 20254 Mar 20252 Mar 2026
570bidooom.comNet-Chinese Co., Ltd.25 Mar 201525 Mar 201525 Mar 2017
571bidonradiospokane.comGoDaddy.com, LLC25 Mar 201527 Apr 202515 Apr 2026
572bidolumagazin.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.4 Apr 20203 Apr 20254 Apr 2026
573bidolsa.comIHS Telekom, Inc.25 Mar 20152 Mar 201725 Mar 2018
574bidolumagazin.netDomainplace LLC2 Jul 20193 Jul 20192 Jul 2020
575bidongyixia.wangAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…27 Aug 201515 Sep 201627 Aug 2017
576bidou.ovhOVH sas1 Jul 20201 Jul 20201 Jul 2021
577bidoops.comCorehub, S.R.L.27 Apr 201828 Apr 202427 Apr 2026
578bidonskins.comeNom, Inc.28 Aug 201528 Aug 201528 Aug 2016
579bidonbitcoin.comGoDaddy.com, LLC27 Aug 20158 Sep 202427 Aug 2025
580bidosity.comGoDaddy.com, LLC27 Mar 201527 Mar 202527 Mar 2026
581bidourmedz.comDropCatch.com 729 LLC29 Mar 201530 Mar 201729 Mar 2018
582bidourmeds.comDropCatch.com 499 LLC29 Mar 201530 Mar 201729 Mar 2018
583bidourmedication.comDropCatch.com 467 LLC29 Mar 201530 Mar 201729 Mar 2018
584bidonmygigblog.comWild West Domains, LLC31 Mar 201531 Mar 201531 Mar 2016
585bidolucocuk.comHongkong Domain Name Information Management Co., L…3 Jul 20213 Jul 20213 Jul 2022
586bidopine.comGoDaddy.com, LLC31 Mar 201531 Mar 201531 Mar 2016
587bidouzi.comBeijing Innovative Linkage Technology Ltd. dba dns…29 Mar 20111 Apr 201529 Mar 2016
588bidonwaste.com----
589bidolumalzeme.comNics Telekomünikasyon Ticaret Ltd. Şti.23 Feb 202118 Feb 202523 Feb 2027
590bidomhaiti.comGoDaddy.com, LLC20 Feb 202520 Feb 202520 Feb 2026
591bidonjewelry.comGoDaddy.com, LLC22 Aug 201723 Aug 202422 Aug 2025
592bidolukalite.comFBS Inc.3 Apr 20153 Apr 20153 Apr 2017
593bidodahomemadewhiskeyinweeglasspendants.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Apr 20155 Apr 20155 Apr 2016
594bidolusey.comGoDaddy.com, LLC2 Jun 20213 Jun 20242 Jun 2026
595bidonjobs.netGoDaddy.com, LLC6 Apr 20156 Apr 20156 Apr 2016
596bidoudavril.netGoDaddy.com, LLC31 Aug 201531 Aug 201531 Aug 2016
597bidosaur.usTucows Domains Inc.28 Aug 201131 Aug 201527 Aug 2015
598bidoluindirim.comIHS Telekom, Inc.29 Aug 201524 Aug 202429 Aug 2025
599bidona.comGoDaddy.com, LLC8 Apr 201523 Mar 20258 Apr 2026
600bidologist.comGoDaddy.com, LLC9 Apr 20152 Feb 20251 Feb 2026
601bidolegui.comGoDaddy.com, LLC8 Apr 20158 Apr 20158 Apr 2016
602bidobrushes.comeNom, Inc.9 Apr 20159 Apr 20159 Apr 2016
603bidobrush.comeNom, Inc.9 Apr 20159 Apr 20159 Apr 2016
604bidobeauty.com----
605bidounamour.com1&1 Internet AG12 Apr 201512 Apr 201512 Apr 2016
606bidoutchat.comTucows Domains Inc.4 Sep 20158 Sep 20174 Sep 2017
607bidonrepair.comGoDaddy.com, LLC13 Apr 201513 Apr 201513 Apr 2017
608bidorbuyexpress.comGoDaddy.com, LLC15 Apr 201515 Apr 201515 Apr 2016
609bidonplc.comGoDaddy.com, LLC15 Apr 201515 Apr 201515 Apr 2016
610bidonperks.comGoDaddy.com, LLC15 Apr 20153 Mar 202515 Apr 2026
611bidongwifi.comBeijing Lanhai Jiye Technology Co., Ltd16 Apr 201516 Apr 202516 Apr 2026
612bidon-myjob.comGoDaddy.com, LLC16 Apr 201516 Apr 201516 Apr 2016
613bidopa.com1&1 Internet AG14 Feb 202014 Feb 202014 Feb 2021
614bidonusa.comBeijing Lanhai Jiye Technology Co., Ltd10 Mar 202330 Mar 202510 Mar 2026
615bidontrades.comGoDaddy.com, LLC11 Jul 202112 Jul 202311 Jul 2025
616bidontrade.comGoDaddy.com, LLC22 May 201922 May 201922 May 2020
617bidonmycontract.comTierraNet Inc. d/b/a DomainDiscover17 Apr 201513 Mar 201718 Apr 2018
618bidomic.comeNom, Inc.18 Apr 201518 Apr 201518 Apr 2016
619bidowls.comFastDomain Inc.21 Jun 20176 Jun 202321 Jun 2024
620bidontc.comDomain.com, LLC1 Aug 20105 Aug 20241 Aug 2029
621bidolusepetim.comİsimtescil Bilişim A.Ş.25 Nov 201721 Nov 202425 Nov 2026
622bidoneandall.comHiChina Zhicheng Technology Limited9 Jul 20209 Jul 20209 Jul 2021
623bido-auctions.infoGoDaddy.com, LLC22 Apr 2015-22 Apr 2016
624bidonapartments.comGoDaddy.com, LLC23 Apr 201523 Apr 201523 Apr 2016
625bidonce.netDNC Holdings, Inc.8 Dec 201913 Dec 20248 Dec 2025
626bidoshop.comGoDaddy.com, LLC24 Apr 201524 Apr 202524 Apr 2026
627bidoask.comNameCheap, Inc.3 Jun 20235 May 20253 Jun 2026
628bidosuck.comGMO Internet Inc.28 Nov 2016-28 Nov 2017
629bidolupara.comNics Telekomünikasyon Ticaret Ltd. Şti.20 Oct 202230 Dec 202320 Oct 2023
630bidogames.oneOne.com A/S7 Sep 201522 Oct 20167 Sep 2017
631bidonbeachrentals.comGoDaddy.com, LLC25 Apr 201525 Apr 201525 Apr 2017
632bidongdong.comName.com, Inc.10 Aug 201916 Jul 202410 Aug 2025
633bidongbidong.comBeijing Lanhai Jiye Technology Co., Ltd3 Apr 20253 Apr 20253 Apr 2026
634bidoludijital.netFBS Inc.25 Apr 201525 Apr 201525 Apr 2016
635bidoludijital.comİsimtescil Bilişim A.Ş.15 Jan 202121 Jan 202515 Jan 2026
636bidocoins.comFabulous.com Pty Ltd.11 Apr 201324 May 202411 Apr 2024
637bidonutilities.comFabulous.com Pty Ltd.28 Apr 201528 Apr 201528 Apr 2016
638bidonelectricity.comFabulous.com Pty Ltd.28 Apr 201528 Apr 201528 Apr 2016
639bidoux.info1&1 Internet AG28 Apr 2015-28 Apr 2016
640bidorbit.comGoDaddy.com, LLC29 Apr 201530 Apr 202429 Apr 2026
641bidonmylifeinsurance.comGoDaddy.com, LLC29 Apr 201529 Apr 201529 Apr 2020
642bidonmyinsurance.comGoDaddy.com, LLC29 Apr 201529 Apr 201529 Apr 2020
643bidonmyhomeinsurance.comGoDaddy.com, LLC29 Apr 201529 Apr 201529 Apr 2020
644bidonmycarinsurance.comGoDaddy.com, LLC29 Apr 201529 Apr 201529 Apr 2020
645bidonmybusinessinsurance.comGoDaddy.com, LLC29 Apr 201529 Apr 201529 Apr 2020
646bidonbio.comNameCheap, Inc.12 Aug 202212 Aug 202212 Aug 2023
647bidortake.comDomain.com, LLC30 Apr 201530 Apr 201530 Apr 2017
648bidondeal.comNameCheap, Inc.27 Nov 201827 Nov 201827 Nov 2019
649bidon-ville.com-14 Jul 202328 Feb 202514 Jul 2025
650bidoluavantaj.comIHS Telekom, Inc.30 Apr 201517 Apr 201730 Apr 2018
651bidoux.net1&1 Internet AG29 Apr 201529 Apr 201529 Apr 2016
652bidorbit.netGoDaddy.com, LLC29 Apr 201529 Apr 201529 Apr 2016
653bidonbio.netGoDaddy.com, LLC29 Apr 201529 Apr 201529 Apr 2017
654bidonpedia.com1API GmbH1 May 20151 May 20151 May 2016
655bidondog.comGoDaddy.com, LLC22 Sep 201814 Sep 202422 Sep 2025
656bidofly.comGoDaddy.com, LLC1 May 20151 May 20151 May 2016
657bidortake.netDomain.com, LLC30 Apr 201530 Apr 201530 Apr 2017
658bidonbids.comDomain.com, LLC2 May 20152 May 20152 May 2016
659bidonmetals.comGoDaddy.com, LLC4 May 20154 May 20154 May 2016
660bidongo.comGoDaddy.com, LLC19 Feb 202419 Feb 202419 Feb 2025
661bido-names.infoGoDaddy.com, LLC4 May 2015-4 May 2016
662bidourgolf.comGoDaddy.com, LLC7 May 20157 May 20157 May 2016
663bidouilleur-numerique.com1&1 Internet AG6 May 20156 May 20156 May 2016
664bidoubledate.comGoDaddy.com, LLC6 May 20156 May 20156 May 2016
665bidorshare.comeNom, Inc.7 May 20157 May 20157 May 2016
666bidornobid.comGoDaddy.com, LLC12 Jun 202328 Mar 202412 Jun 2026
667bidonourhouse.comWebfusion Ltd.10 Sep 201510 Sep 201510 Sep 2017
668bidoncigars.comeNom, Inc.8 May 20159 May 20158 May 2016
669bidoluhizmet.comNameCheap, Inc.6 May 20247 May 20256 May 2025
670bidoluhizmet.netTucows Domains Inc.9 May 201513 May 20179 May 2017
671bidonmyprojectnow.comWild West Domains, LLC11 May 201511 May 201511 May 2016
672bidouke.comHiChina Zhicheng Technology Limited22 Mar 201822 Mar 201822 Mar 2019
673bidonusedcar.comGoDaddy.com, LLC11 Sep 201511 Sep 201511 Sep 2016
674bidonlise.comregister.com, Inc.11 Sep 201511 Sep 201511 Sep 2016
675bidouyan100.comClick Registrar, Inc. d/b/a publicdomainregistry.c…12 Dec 202112 Dec 202112 Dec 2022
676bidonesdeagua.netArsys Internet, S.L. dba NICLINE.COM13 May 20156 Jul 201713 May 2018
677bidonfashion.comTurnCommerce, Inc. DBA NameBright.com2 Aug 201927 Jul 20202 Aug 2025
678bidonthatjob.comGoDaddy.com, LLC18 May 201518 May 201518 May 2016
679bidoflove.comGoDaddy.com, LLC18 May 201518 May 201518 May 2016
680bidoola.comNameCheap, Inc.13 Sep 202413 Sep 202413 Sep 2025
681bidourplan.comGoDaddy.com, LLC21 May 201521 May 201521 May 2020
682bidonbwic.comFastDomain Inc.20 May 20155 May 202520 May 2026
683bidonaire.comGoDaddy.com, LLC20 May 201520 May 201520 May 2016
684bidoem.comGoDaddy.com, LLC31 Mar 20231 Apr 202531 Mar 2027
685bidonzoloshop.com1&1 Internet AG21 May 201521 May 201521 May 2016
686bidonzolo.comDropCatch.com 866 LLC6 Apr 20246 May 20256 Apr 2025
687bidonmyyacht.comKey-Systems GmbH21 May 201521 May 201521 May 2016
688bido2o.comHiChina Zhicheng Technology Limited22 May 201522 May 201522 May 2017
689bidonimalati.comIHS Telekom, Inc.29 Dec 201829 Dec 201829 Dec 2019
690bidonamotor.comGoDaddy.com, LLC22 May 201523 May 202422 May 2025
691bidonservices.netGoDaddy.com, LLC13 Sep 201513 Sep 201513 Sep 2017
692bidonzolo.org1&1 Internet AG21 May 20153 Jul 201721 May 2018
693bidonzolo.net1&1 Internet AG21 May 201521 May 201521 May 2016
694bidolubebek.comOnlineNIC, Inc.26 May 201813 Dec 202426 May 2025
695bidobin.com1&1 Internet AG24 May 201524 May 201524 May 2016
696bidoner.netFBS Inc.25 Sep 201725 Sep 201725 Sep 2018
697bidod-us.com1&1 Internet AG25 May 201525 May 201525 May 2016
698bidoolgi.comWhois Networks Co., Ltd.24 May 200426 Mar 202424 May 2025
699bidoculus.comGoDaddy.com, LLC26 May 201527 May 202426 May 2026
700bidonbins.comGoDaddy.com, LLC18 Jun 202330 Jul 202418 Jun 2024
701bidonbin.comDynadot, LLC27 May 201527 May 201527 May 2016
702bidonroofs.comGoDaddy.com, LLC4 Jan 20205 Jan 20254 Jan 2026
703bidome.comAscio Technologies, Inc. Danmark - Filial af Ascio…29 May 20152 May 202329 May 2026
704bidoluemlak.comNics Telekomünikasyon Ticaret Ltd. Şti.4 Mar 20254 Mar 20254 Mar 2026
705bidongshoppingmall.comHiChina Zhicheng Technology Limited30 May 201530 May 201530 May 2016
706bidongshoppingcenter.comHiChina Zhicheng Technology Limited30 May 201530 May 201530 May 2016
707bidongshangcheng.comHiChina Zhicheng Technology Limited30 May 201530 May 201530 May 2016
708bidongmall.comHiChina Zhicheng Technology Limited30 May 201530 May 201530 May 2016
709bidongcenter.comHiChina Zhicheng Technology Limited30 May 201530 May 201530 May 2016
710bidongjia.comDNSPod, Inc.20 Apr 202122 Apr 202120 Apr 2022
711bidorbuycoza.com----
712bidofficials.comGoDaddy.com, LLC2 Jun 20152 Jun 20152 Jun 2016
713bidonsite.comGoDaddy.com, LLC22 Aug 201828 Aug 202422 Aug 2025
714bidoro.netAmazon Registrar, Inc.2 Jun 201528 Apr 20242 Jun 2025
715bidova.comGoDaddy.com, LLC16 Sep 201517 Sep 202416 Sep 2025
716bidonhvac.comGoDaddy.com, LLC8 Feb 202021 Mar 20238 Feb 2023
717bidonadate.comCloud Yuqu LLC7 Dec 20247 Dec 20247 Dec 2025
718bidoz.netNameCheap, Inc.18 May 202518 May 202518 May 2026
719bidolar.netAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.4 Jun 201515 Jul 20174 Jun 2017
720bidolumutluluk.comİsimtescil Bilişim A.Ş.16 Jun 20201 Feb 202416 Jun 2029
721bidontrend.comGoDaddy.com, LLC10 Jun 201522 Aug 202410 Jun 2024
722bidoluusta.comMat Bao Trading & Service Company Limited d/b/a Ma…9 Oct 202110 Oct 20219 Oct 2022
723bidolufilmseyret.comNics Telekomünikasyon Ticaret Ltd. Şti.10 Jun 201510 Jun 201510 Jun 2016
724bidolufilmizle.comEranet International Limited1 Oct 20201 Oct 20201 Oct 2021
725bidolufilm.comNameCheap, Inc.17 Nov 201718 Oct 202417 Nov 2025
726bidokun.comClick Registrar, Inc. d/b/a publicdomainregistry.c…27 Mar 20228 Jun 202327 Mar 2023
727bidoushi.comeName Technology Co., Ltd.13 Jan 202326 Feb 202413 Jan 2024
728bidonfiber.comeNom, Inc.11 Jun 201511 Jun 201511 Jun 2016
729bidontrend.orgGoDaddy.com, LLC10 Jun 201510 Jun 201510 Jun 2016
730bidontrend.netGoDaddy.com, LLC10 Jun 201510 Jun 201510 Jun 2016
731bidontrend.infoGoDaddy.com, LLC10 Jun 2015-10 Jun 2016
732bidooraliraq.comNameCheap, Inc.15 Nov 202217 Nov 202415 Nov 2025
733bidonyx.comGoDaddy.com, LLC13 Jun 201513 Jun 201513 Jun 2016
734bidoloo.comDynadot, LLC11 Nov 202010 Apr 202511 Nov 2025
735bidoption.comGoDaddy.com, LLC16 Jun 201517 Jun 202416 Jun 2025
736bidonbugs.comGoDaddy.com, LLC17 Jun 201517 Jun 201517 Jun 2016
737bidoluteklif.comregister.com, Inc.17 Jun 201517 Jun 201517 Jun 2016
738bidolapp.comTucows Domains Inc.17 Jun 201517 Jun 201517 Jun 2017
739bidolap.comHostinger, UAB14 Feb 20257 Apr 202514 Feb 2027
740bidoverstock.comSquarespace Domains LLC10 Mar 202510 Mar 202510 Mar 2028
741bidode.comGoDaddy.com, LLC19 Jun 201519 Jun 201519 Jun 2016
742bidoupfieldschool2016.orgGoogle, Inc.18 Jun 201518 Jun 201518 Jun 2016
743bidonlinewebs.orgeNom, Inc.20 Sep 201520 Sep 201520 Sep 2016
744bidoluonline.comFBS Inc.21 Jun 201521 Jun 201521 Jun 2016
745bido-raku.comPSI-USA, Inc. dba Domain Robot2 Nov 20202 Nov 20202 Nov 2021
746bidonauto.netGoDaddy.com, LLC22 Jun 201522 Jun 201522 Jun 2017
747bidonmemphis.comMarkMonitor Inc.26 Jul 20172 Aug 202426 Jul 2025
748bidoupfieldschool.orgGMO Internet Inc.16 Sep 201628 Aug 201716 Sep 2018
749bidonead.comAscio Technologies, Inc. Danmark - Filial af Ascio…25 Jun 201525 Jun 201525 Jun 2016
750bidogumfotografcisi.comFBS Inc.25 Jun 20157 Jul 201725 Jun 2018
751bidock.comTurnCommerce, Inc. DBA NameBright.com6 Dec 202123 Aug 20226 Dec 2025
752bidonexpertise.comIServeYourDomain.com LLC10 Jun 201422 Sep 201510 Jun 2016
753bidonsell.comGoDaddy.com, LLC26 Jun 201527 Jun 201526 Jun 2016
754bidonoffers.comGoDaddy.com, LLC26 Jun 201527 Jun 201526 Jun 2016
755bidonoffer.comGoDaddy.com, LLC26 Jun 201527 Jun 201526 Jun 2016
756bidonask.comGoDaddy.com, LLC26 Jun 201527 Jun 201526 Jun 2016
757bidoludiziseyret.comNics Telekomünikasyon Ticaret Ltd. Şti.26 Jun 201526 Jun 201526 Jun 2016
758bidoludiziizle.comNics Telekomünikasyon Ticaret Ltd. Şti.26 Jun 201526 Jun 201526 Jun 2016
759bidoludizi.comNics Telekomünikasyon Ticaret Ltd. Şti.23 Oct 20222 Jan 202423 Oct 2023
760bidofferstock.comGoDaddy.com, LLC26 Jun 201527 Jun 201526 Jun 2016
761bidoffergoods.comGoDaddy.com, LLC26 Jun 201527 Jun 201526 Jun 2016
762bidofferauction.comGoDaddy.com, LLC26 Jun 201527 Jun 201526 Jun 2016
763bidofferanything.comGoDaddy.com, LLC26 Jun 201527 Jun 201526 Jun 2016
764bidofferall.comGoDaddy.com, LLC26 Jun 201527 Jun 201526 Jun 2016
765bidonpress.comTucows Domains Inc.10 Oct 202427 Oct 202410 Oct 2025
766bidongyixia.com----
767bidonbyagents.comGoDaddy.com, LLC30 Jun 201530 Jun 201530 Jun 2016
768bidolucarsi.comGoDaddy.com, LLC12 Jul 202123 Sep 202312 Jul 2023
769bidoludekor.comNics Telekomünikasyon Ticaret Ltd. Şti.6 Nov 202421 Nov 20246 Nov 2025
770bidolusepetimm.comFBS Inc.5 Jul 20155 Jul 20155 Jul 2016
771bidosaur.comMat Bao Trading & Service Company Limited d/b/a Ma…21 Aug 202322 Aug 202421 Aug 2025
772bidoutdoors.comBeijing Lanhai Jiye Technology Co., Ltd6 Apr 20227 Apr 20236 Apr 2024
773bidongold.comGoDaddy.com, LLC23 Jun 20203 Sep 202423 Jun 2024
774bidonbundles.comGoDaddy.com, LLC15 Jul 201515 Jul 201515 Jul 2016
775bidonrides.comGoDaddy.com, LLC27 Sep 20158 Nov 202427 Sep 2024
776bidon.ovhOVH sas27 Sep 20156 Aug 202327 Sep 2029
777bidoofcraft.netGoDaddy.com, LLC16 Jul 201516 Jul 201516 Jul 2016
778bidonmyrealestate.comGoDaddy.com, LLC17 Jul 201517 Jul 201517 Jul 2016
779bidonmyhouselisting.comGoDaddy.com, LLC17 Jul 201517 Jul 201517 Jul 2016
780bidonmyhomelisting.comGoDaddy.com, LLC17 Jul 201517 Jul 201517 Jul 2016
781bidoolgi.netWhois Networks Co., Ltd.16 Jul 201529 Mar 202416 Jul 2027
782bidonmyreno.comGoDaddy.com, LLC19 Jul 201519 Jul 201519 Jul 2016
783bidonmytradein.usGoDaddy.com, LLC18 Jul 201518 Jul 201617 Jul 2017
784bidoncharlotte.comGoDaddy.com, LLC21 Dec 201516 Apr 202521 Dec 2025
785bidone.netNameCheap, Inc.11 Jul 202222 Aug 202311 Jul 2023
786bidonmyreno.infoGoDaddy.com, LLC19 Jul 2015-19 Jul 2016
787bidon.techGoDaddy.com, LLC29 Sep 201529 Sep 201529 Sep 2016
788bidolumatbaa.comGoDaddy.com, LLC8 Dec 20248 Dec 20248 Dec 2025
789bidoluhediye.comİsimtescil Bilişim A.Ş.22 May 202410 Jan 202522 May 2027
790bidolusatis.comNamesilo, LLC13 Oct 201914 Oct 201913 Oct 2020
791bidolubilgi.netİsimtescil Bilişim A.Ş.20 Mar 202321 Mar 202520 Mar 2026
792bidoul.bizGandi SAS28 Jul 201528 Jul 201527 Jul 2016
793bidor.netNameCheap, Inc.27 Jul 201527 Jun 202427 Jul 2025
794bidonlabor.comWild West Domains, LLC30 Sep 201530 Sep 201530 Sep 2016
795bidohouse.comHostinger, UAB9 Nov 20237 Nov 20249 Nov 2025
796bidocx.comHiChina Zhicheng Technology Limited28 Jul 201529 Jul 201628 Jul 2017
797bidoofcraft.comGoDaddy.com, LLC29 Jul 201529 Jul 201529 Jul 2016
798bidonway.comBigRock Solutions Ltd.29 Jul 201529 Jul 201529 Jul 2016
799bidoluilan.comIHS Telekom, Inc.23 Jun 202423 Aug 202423 Jun 2025
800bidoshop.netMat Bao Trading & Service Company Limited d/b/a Ma…1 Oct 20151 Dec 20151 Oct 2018
801bidourproject.comGoDaddy.com, LLC30 Jul 201530 Jul 201530 Jul 2016
802bidonme4.comAtak Domain Hosting Internet d/b/a Atak Teknoloji9 Jun 20219 Jun 20219 Jun 2022
803bidover.comGoDaddy.com, LLC16 Nov 201612 Nov 202416 Nov 2025
804bidopener.com1&1 Internet AG2 Aug 20152 Aug 20152 Aug 2016
805bidons4life.comGoDaddy.com, LLC4 Aug 20154 Aug 20154 Aug 2017
806bidosandal.comGoDaddy.com, LLC5 Aug 20155 Aug 20155 Aug 2016
807bidonlighthouse.comGoDaddy.com, LLC5 Aug 20155 Aug 20155 Aug 2016
808bidonpreowned.comGoDaddy.com, LLC8 Aug 20158 Aug 20158 Aug 2016
809bidoia.infoTucows Domains Inc.7 Aug 201511 Aug 20177 Aug 2018
810bidout.netGoDaddy.com, LLC6 Aug 202217 Sep 20236 Aug 2023
811bidongwang.comBeijing Sanfront Information Technology Co., Ltd13 Dec 2016-13 Dec 2017
812bidollars.comGoDaddy.com, LLC4 Oct 20154 Oct 20154 Oct 2016
813bidollar.comNameKing.com Inc.22 Dec 202228 Feb 202522 Dec 2025
814bidonatoz.comGoDaddy.com, LLC6 Oct 20157 Oct 20156 Oct 2017
815bidohomes.comeNom, Inc.7 Oct 20157 Oct 20157 Oct 2016
816bidonsweetdreamsbycarol.xyzNameCheap, Inc.8 Oct 20158 Oct 20158 Oct 2016
817bidozmoda.netNics Telekomünikasyon Ticaret Ltd. Şti.8 Oct 20158 Oct 20158 Oct 2016
818bidozmoda.comNics Telekomünikasyon Ticaret Ltd. Şti.8 Oct 20158 Oct 20158 Oct 2016
819bidonbites.comregister.com, Inc.8 Oct 20158 Sep 20248 Oct 2025
820bidouyan.infoGoDaddy.com, LLC12 Oct 201513 Oct 201612 Oct 2017
821bidonjaunea.comNetwork Solutions, LLC11 Oct 201511 Oct 201511 Oct 2016
822bidonstudio.xyzNameCheap, Inc.13 Oct 201513 Oct 201513 Oct 2016
823bidonthishouse.comGoDaddy.com, LLC13 Oct 202013 Oct 202013 Oct 2025
824bidonlinestl.comGoDaddy.com, LLC13 Oct 201527 Apr 202515 Apr 2026
825bidong-mall.comWest263 International Limited28 Dec 201628 Dec 201628 Dec 2017
826bidoatwaled.winPDR Ltd. d/b/a PublicDomainRegistry.com14 Oct 2015-13 Oct 2016
827bidongolf.comNamestop LLC2 Jan 20253 Jan 20252 Jan 2026
828bidonginfo.comGoDaddy.com, LLC22 Dec 20193 Mar 202422 Dec 2023
829bidonwood.comeNom, Inc.15 Oct 201516 Sep 201615 Oct 2017
830bidonmyminerals.comGoDaddy.com, LLC16 Oct 201516 Oct 201516 Oct 2016
831bidoprice.comShanghai Meicheng Technology Information Co., Ltd22 Dec 201722 Dec 201722 Dec 2018
832bidostudio.netMelbourne IT, Ltd19 Oct 201519 Oct 201519 Oct 2016
833bidolumekan.comNics Telekomünikasyon Ticaret Ltd. Şti.19 Oct 201519 Oct 201519 Oct 2016
834bidouilleurslibristes.orgDynadot, LLC7 Apr 20257 Apr 20257 Apr 2026
835bidonlocalservices.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Oct 201527 Oct 201622 Oct 2017
836bidonbit.comGoDaddy.com, LLC22 Oct 201522 Oct 201522 Oct 2016
837bidongme.xyzHostinger, UAB23 Oct 201523 Oct 201523 Oct 2016
838bidonyourbrand.comGoDaddy.com, LLC25 Oct 201525 Oct 201525 Oct 2016
839bidomdirect.comGoDaddy.com, LLC21 Jul 20231 Oct 202421 Jul 2024
840bidog.xyzNamesilo, LLC1 Feb 20246 Apr 20251 Feb 2025
841bidontrips.comGoDaddy.com, LLC27 Oct 201527 Oct 201527 Oct 2016
842bidoptimizer.solutionsGoogle, Inc.28 Oct 20151 Nov 201928 Oct 2020
843bidouyan.xyzChengdu West Dimension Digital Technology Co., Ltd…31 Oct 2015-31 Oct 2016
844bidonhomenow.comGoDaddy.com, LLC2 Nov 20152 Nov 20152 Nov 2016
845bidokkespoldajabar.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Nov 20152 Nov 20152 Nov 2016
846bidorbuybit.comTucows Domains Inc.3 Nov 20157 Nov 20173 Nov 2017
847bidoiamello.comMoniker Online Services LLC6 Jun 202421 Jun 20246 Jun 2025
848bidoctors.netDOMAIN NAME NETWORK PTY LTD7 May 202218 Jun 20237 May 2023
849bidozo.comGoDaddy.com, LLC5 Nov 201530 Oct 20245 Nov 2025
850bidohka.comGMO Internet Inc.5 Nov 20156 Oct 20165 Nov 2017
851bidolphin.reviewAlpnames Limited6 Nov 20157 Nov 20155 Nov 2016
852bidonhomenowfast.comTucows Domains Inc.7 Nov 20157 Nov 20157 Nov 2016
853bidorbuy.durbanTucows Domains Inc.4 Nov 20148 Nov 20154 Nov 2016
854bidorbuy.capetownTucows Domains Inc.4 Nov 20148 Nov 20154 Nov 2016
855bidong.xinAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…9 Nov 2015-9 Nov 2016
856bidonmyrtlebeach.comMarkMonitor Inc.9 Nov 201514 Mar 202515 Apr 2026
857bidool.comBeijing Lanhai Jiye Technology Co., Ltd18 Oct 202427 Mar 202518 Oct 2025
858bidolukurabiye.comTucows Domains Inc.11 Nov 201515 Nov 201711 Nov 2017
859bidogold.comInternet Domain Services BS Corp11 Nov 201511 Nov 201511 Nov 2016
860bidontalk.comGoDaddy.com, LLC12 Nov 201512 Nov 201512 Nov 2016
861bidown.xyzPDR Ltd. d/b/a PublicDomainRegistry.com13 Nov 201513 Nov 201513 Nov 2016
862bidosell.comGoDaddy.com, LLC9 Feb 20249 Feb 20259 Feb 2026
863bidoncito.comDattatec.com SRL14 Nov 201514 Nov 201614 Nov 2017
864bidolusaglik.comTucows Domains Inc.17 Nov 201510 Nov 201617 Nov 2017
865bidolap.netNics Telekomünikasyon Ticaret Ltd. Şti.18 Nov 201528 Jan 202518 Nov 2024
866bidorium.comDomain.com, LLC20 Nov 20155 Nov 202420 Nov 2025
867bidoncondos.comGoDaddy.com, LLC20 Nov 201520 Nov 201520 Nov 2016
868bidonboats.comGoDaddy.com, LLC12 Sep 20184 Sep 202412 Sep 2025
869bidongrill.comRegister.it SPA22 Nov 201525 Dec 201622 Nov 2017
870bidofbids.comBigRock Solutions Ltd.22 Nov 20151 Nov 201622 Nov 2017
871bidonvapes.comName.com, Inc.24 Nov 201524 Nov 201524 Nov 2016
872bidonn.orgNetwork Solutions, LLC25 Nov 201525 Nov 201525 Nov 2016
873bidostreachmarkcream.comGoDaddy.com, LLC29 Nov 201529 Nov 201529 Nov 2017
874bidolusu.netFBS Inc.28 Nov 201528 Nov 201528 Nov 2016
875bidostreachmarkcream.usGoDaddy.com, LLC29 Nov 20159 Jan 201728 Nov 2016
876bidok.netHiChina Zhicheng Technology Limited6 Nov 201926 Aug 20226 Nov 2026
877bidovenezia.comTucows Domains Inc.28 Nov 20072 Dec 201528 Nov 2016
878bidon-tech.comHosting Ukraine LLC1 Dec 201521 Mar 20241 Dec 2025
879bidolukupon.comNics Telekomünikasyon Ticaret Ltd. Şti.1 Dec 20151 Dec 20151 Dec 2016
880bidofferbuy.comHongkong Domain Name Information Management Co., L…13 Nov 202117 Nov 202212 Nov 2022
881bidonstorageunits.orgGoDaddy.com, LLC5 Dec 20155 Dec 20155 Dec 2016
882bidonstorageunits.infoGoDaddy.com, LLC5 Dec 2015-5 Dec 2016
883bidostretchmarkcream.comGoDaddy.com, LLC6 Dec 20156 Dec 20156 Dec 2017
884bidonstorageunits.netGoDaddy.com, LLC5 Dec 201516 Dec 20245 Dec 2025
885bidonstorageunits.comGoDaddy.com, LLC5 Dec 201516 Dec 20245 Dec 2025
886bidoncards.netTucows Domains Inc.6 Dec 20156 Dec 20156 Dec 2016
887bidoncards.comGoDaddy.com, LLC24 May 202325 May 202424 May 2025
888bidolusinema.comenom421, Incorporated21 Feb 20246 Apr 202521 Feb 2025
889bidoution.xyzNameCheap, Inc.7 Dec 20157 Dec 20157 Dec 2016
890bidorbuydomains.comOVH sas7 Dec 20157 Dec 20157 Dec 2016
891bidonpallets.comGoDaddy.com, LLC9 Dec 20159 Dec 20249 Dec 2026
892bidonpallet.comGoDaddy.com, LLC9 Dec 20159 Dec 20249 Dec 2026
893bidonweb.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Jan 20198 Jan 20198 Jan 2020
894bidocumentations.comGoDaddy.com, LLC10 Dec 201511 Dec 202310 Dec 2025
895bidoffer.bizGoDaddy.com, LLC11 Dec 201511 Dec 201510 Dec 2016
896bidouyanzhiliao.comAdomainofyourown.com LLC1 Dec 20201 Dec 20201 Dec 2021
897bidostrechmarkcreams.comregister.com, Inc.14 Dec 201514 Dec 201514 Dec 2016
898bidostretchmarkcreams.comregister.com, Inc.14 Dec 201515 Dec 201514 Dec 2016
899bidocean.bidGoDaddy.com, LLC14 Dec 201519 Dec 202413 Dec 2025
900bidonmyservice.netWild West Domains, LLC15 Dec 201515 Dec 201515 Dec 2016
901bidorwalk.comregister.com, Inc.16 Dec 201516 Dec 201516 Dec 2016
902bidoluavm.comNics Telekomünikasyon Ticaret Ltd. Şti.17 Mar 202217 Mar 202517 Mar 2026
903bidonhousenow.comGoDaddy.com, LLC17 Dec 201517 Dec 201517 Dec 2016
904bidosd.dateAlpnames Limited17 Dec 2015-16 Dec 2016
905bidonaride.netGoDaddy.com, LLC20 Dec 201520 Dec 201520 Dec 2016
906bidonaride.infoGoDaddy.com, LLC20 Dec 2015-20 Dec 2016
907bidopts.comGoDaddy.com, LLC19 Dec 201519 Dec 201519 Dec 2016
908bidonaride.comNameCheap, Inc.28 Dec 202329 Nov 202428 Dec 2025
909bidonaride.orgGoDaddy.com, LLC20 Dec 201520 Dec 201520 Dec 2016
910bidosef.ovhOVH sas21 Dec 201521 Dec 201521 Dec 2016
911bidoo.xyzGoDaddy.com, LLC21 Mar 201922 Mar 202521 Mar 2026
912bido-studio.comNameCheap, Inc.20 Oct 20174 Dec 202120 Oct 2022
913bidouilleries.comHostinger, UAB15 Dec 20222 Aug 202415 Dec 2025
914bidouille-et-poucette.comInternet Domain Services BS Corp26 May 20196 Aug 202426 May 2024
915bidolukutu.orgGoDaddy.com, LLC24 Dec 201524 Dec 201524 Dec 2016
916bidolukutu.netGoDaddy.com, LLC24 Dec 201524 Dec 201524 Dec 2016
917bidolukutu.infoGoDaddy.com, LLC24 Dec 2015-24 Dec 2016
918bidolukutu.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Nov 202310 Dec 202426 Nov 2025
919bidorbuyexcursions.comeNom, Inc.28 Dec 201528 Dec 201528 Dec 2016
920bidolumama.comPearlNamingService.com LLC2 Jun 202414 Mar 20252 Jun 2025
921bidongxuetang.comXin Net Technology Corporation30 Dec 201530 Dec 201530 Dec 2016
922bidon.onlineGoDaddy.com, LLC22 Jun 201726 Jul 201722 Jun 2018
923bidonmybodywork.comWebfusion Ltd.4 Jan 20164 Jan 20164 Jan 2018
924bidobutiko.comNameWeb BVBA5 Jan 20165 Jan 20185 Jan 2018
925bidon.racingPDR Ltd. d/b/a PublicDomainRegistry.com5 Jan 20166 Jan 20164 Jan 2017
926bidonbooking.comGoDaddy.com, LLC2 Jun 20175 Jun 20242 Jun 2027
927bidonmydata.comGoDaddy.com, LLC9 Jan 201610 Jan 20259 Jan 2026
928bidonyourenergy.comGoDaddy.com, LLC10 Jan 201610 Jan 201610 Jan 2017
929bidoludizayn.comRealtime Register B.V.10 Jan 201610 Jan 201610 Jan 2017
930bidouille.topGandi SAS11 Jan 201611 Jan 201611 Jan 2017
931bidonreturns.comGoDaddy.com, LLC11 Jul 202322 Sep 202411 Jul 2024
932bidol.comNamesilo, LLC8 Jan 200429 Apr 20258 Jan 2026
933bidonreturns.usGoDaddy.com, LLC11 Jan 201611 Jan 201610 Jan 2018
934bidori.linkAlpnames Limited13 Jan 201623 Feb 201713 Jan 2017
935bidostar.comBeijing Lanhai Jiye Technology Co., Ltd13 Jan 201629 Mar 202513 Jan 2026
936bidocalo.comHosting Concepts B.V. dba Openprovider13 Jan 201614 Jan 201713 Jan 2018
937bidopo.netNameSecure L.L.C.30 Jul 202311 Sep 202430 Jul 2024
938bidorbuyonline.comHosting Concepts B.V. dba Openprovider15 Jan 201627 Mar 202515 Jan 2025
939bidolu.xyzNics Telekomünikasyon Ticaret Ltd. Şti.24 Oct 20223 Jan 202424 Oct 2023
940bidonthisproperty.comGoDaddy.com, LLC3 Aug 20218 Aug 20243 Aug 2026
941bidonseizedassets.comGoDaddy.com, LLC15 Oct 201815 Oct 201815 Oct 2019
942bidonforeclosures.comDomainarmada.com LLC17 Jan 201617 Jan 201617 Jan 2017
943bidon9.comGoDaddy.com, LLC19 Jan 201620 Sep 202219 Jan 2026
944bido-studio.mobiPDR Ltd. d/b/a PublicDomainRegistry.com19 Jan 201619 Jan 201619 Jan 2017
945bidonwun.comGoDaddy.com, LLC22 Jan 201622 Jan 201622 Jan 2017
946bidoyum.comNics Telekomünikasyon Ticaret Ltd. Şti.20 Jan 201620 Jan 201620 Jan 2019
947bidouji.comeName Technology Co., Ltd.21 Jan 201620 Dec 201621 Jan 2018
948bidonweed.comGoogle, Inc.19 Mar 20225 Mar 202519 Mar 2026
949bidonbuds.comGoDaddy.com, LLC29 Oct 201910 Jan 202529 Oct 2024
950bidonsale.comGoDaddy.com, LLC22 Feb 20225 Apr 202322 Feb 2023
951bidollar.netTucows Domains Inc.26 Jan 201630 Jan 201726 Jan 2017
952bidonmichigan.comGoDaddy.com, LLC27 Jan 201627 Jan 201627 Jan 2017
953bidolugeek.comHongkong Domain Name Information Management Co., L…7 Jul 20217 Jul 20217 Jul 2022
954bidonchina.comDomain.com, LLC28 Jan 201628 Jan 201628 Jan 2017
955bidofchina.comDomain.com, LLC28 Jan 201628 Jan 201628 Jan 2017
956bidouilles.photosOVH sas29 Jan 201627 Mar 202429 Jan 2024
957bidouilles.photoOVH sas29 Jan 201621 Jan 201729 Jan 2018
958bidouille.photosOVH sas29 Jan 201627 Mar 202429 Jan 2024
959bidouille.photoOVH sas29 Jan 201621 Jan 201729 Jan 2018
960bidorbuytoday.comGoDaddy.com, LLC29 Jan 201629 Jan 201629 Jan 2017
961bidosya.comGoDaddy.com, LLC3 Apr 20253 Apr 20253 Apr 2026
962bidou.xyzGoDaddy.com, LLC31 Jul 202311 Sep 202431 Jul 2024
963bidonspace.comGoDaddy.com, LLC1 Feb 20161 Feb 20161 Feb 2017
964bidolutercume.comFBS Inc.1 Feb 20162 Feb 20161 Feb 2017
965bidolugrup.comNics Telekomünikasyon Ticaret Ltd. Şti.23 Oct 20222 Jan 202423 Oct 2023
966bidoluegitim.comSquarespace Domains LLC15 Apr 202411 Apr 202515 Apr 2026
967bidots.comKey-Systems GmbH9 Jul 20219 Jul 20219 Jul 2022
968bidogame.comBeijing Lanhai Jiye Technology Co., Ltd8 Oct 20239 Oct 20248 Oct 2025
969bidore.netGoDaddy.com, LLC4 Feb 20164 Feb 20164 Feb 2017
970bidore.comTurnCommerce, Inc. DBA NameBright.com20 Oct 202123 Aug 202220 Oct 2025
971bidonthisboat.comNetwork Solutions, LLC5 Feb 20165 Mar 20174 Feb 2018
972bidonspaces.comGoDaddy.com, LLC5 Feb 20165 Feb 20165 Feb 2017
973bidonbabes.comDropCatch.com 459 LLC5 Feb 20166 Feb 20175 Feb 2018
974bidoluoyuncak.comRealtime Register B.V.28 Apr 20239 Jul 202428 Apr 2024
975bidolumalzemee.comNics Telekomünikasyon Ticaret Ltd. Şti.5 Feb 20165 Feb 20165 Feb 2017
976bidonlaw.usGoDaddy.com, LLC11 Feb 201611 Feb 201710 Feb 2018
977bidonlaw.orgGoDaddy.com, LLC11 Feb 201613 Jul 202411 Feb 2026
978bidonlaw.netGoDaddy.com, LLC11 Feb 201612 Feb 202411 Feb 2026
979bidonlaw.comGoDaddy.com, LLC11 Feb 201620 Sep 202211 Feb 2026
980bidoldur.comFBS Inc.27 Aug 20201 Jun 202127 Aug 2025
981bidogal.comİsimtescil Bilişim A.Ş.27 Nov 20195 Nov 202427 Nov 2025
982bidonfushion.comKey-Systems GmbH10 Feb 20163 Aug 201610 Feb 2018
983bidolutasarim.netFBS Inc.10 Feb 201610 Feb 201610 Feb 2017
984bidonandco44.comNetwork Solutions, LLC13 Feb 201613 Feb 201613 Feb 2018
985bidoia.xyzHostinger, UAB12 Nov 202325 Jan 202512 Nov 2024
986bidonline.xyzXin Net Technology Corporation17 Apr 202316 Jun 202417 Apr 2024
987bidolu.siteDynadot, LLC26 Apr 20211 May 202126 Apr 2022
988bidonmeds.comLiquidNet Ltd.12 Apr 202512 Apr 202512 Apr 2026
989bidolusite.comİsimtescil Bilişim A.Ş.14 Feb 201614 Feb 202514 Feb 2026
990bidoludur.comMelbourne IT, Ltd5 May 20175 May 20175 May 2018
991bidong123.comHiChina Zhicheng Technology Limited7 May 20197 May 20197 May 2020
992bidosolid.comMat Bao Trading & Service Company Limited d/b/a Ma…16 Feb 201612 Feb 202516 Feb 2026
993bidonward.comGoDaddy.com, LLC16 Feb 201631 Jan 202516 Feb 2026
994bidou-kyoushitu.comNetowl, Inc.17 Feb 201626 Jan 201717 Feb 2018
995bidondentalservices.comGoDaddy.com, LLC18 Feb 201619 Feb 202518 Feb 2026
996bidonadentist.comGoDaddy.com, LLC18 Feb 201619 Feb 202518 Feb 2026
997bidodisha.comGoDaddy.com, LLC18 Feb 201618 Feb 201618 Feb 2017
998bidonbricks.orgGandi SAS20 Feb 201620 Feb 201620 Feb 2017
999bidonbricks.netAmazon Registrar, Inc.20 Feb 201620 Feb 201620 Feb 2017
1000bidonbricks.comGoDaddy.com, LLC2 Sep 20242 Sep 20242 Sep 2025

Displaying 1,000 out of 5,738 domains starting with the keyword "BIDO". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=bido

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now