With support for 
Keyword: BAKER
Reverse Whois » KEYWORD [baker ] { 47,468 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | baker.edu | - | 26 Feb 1992 | 10 Apr 2017 | 31 Jul 2018 |
| 2 | baker.com | Network Solutions, LLC | 11 Jan 1994 | 10 Jan 2022 | 10 Jan 2032 |
| 3 | baker.pro | Epik Inc. | 16 Oct 2020 | 30 Nov 2024 | 16 Oct 2025 |
| 4 | baker.info | Easyspace LTD | 12 Sep 2001 | 18 Aug 2024 | 12 Sep 2025 |
| 5 | baker.supply | GoDaddy.com, LLC | 25 Jun 2014 | 5 Apr 2025 | 25 Jun 2025 |
| 6 | baker.gop | Minds + Machines Registrar Limited | 7 Jul 2014 | 7 Jul 2014 | 7 Jul 2015 |
| 7 | baker.institute | CSC Corporate Domains, Inc. | 24 Jul 2014 | 30 Jun 2024 | 24 Jul 2025 |
| 8 | baker.voting | RegistryGate GmbH | 23 Jul 2014 | - | 23 Jul 2015 |
| 9 | baker.university | 1API GmbH | 30 Jul 2014 | 31 Jul 2014 | 30 Jul 2015 |
| 10 | baker.technology | Network Solutions, LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 11 | baker.capital | Dynadot, LLC | 25 Oct 2014 | 26 Oct 2014 | 25 Oct 2015 |
| 12 | baker.world | GoDaddy.com, LLC | 1 Apr 2016 | 2 Apr 2025 | 1 Apr 2026 |
| 13 | baker.construction | eNom, Inc. | 9 Jan 2015 | 11 Mar 2017 | 9 Jan 2018 |
| 14 | baker.berlin | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 24 Oct 2020 | 27 Dec 2022 | 24 Oct 2025 |
| 15 | baker.life | Xiamen ChinaSource Internet Service Co., Ltd. | 24 Aug 2022 | 28 Aug 2024 | 24 Aug 2025 |
| 16 | baker.property | Uniregistrar Corp | 31 Jan 2015 | 17 Mar 2017 | 31 Jan 2018 |
| 17 | baker.ninja | Tucows Domains Inc. | 22 Jul 2020 | 26 Jul 2024 | 22 Jul 2025 |
| 18 | baker.graphics | GoDaddy.com, LLC | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 19 | baker.global | GoDaddy.com, LLC | 16 Jun 2016 | 21 Oct 2024 | 16 Jun 2025 |
| 20 | baker.partners | GoDaddy.com, LLC | 20 Jun 2022 | 31 Aug 2023 | 20 Jun 2023 |
| 21 | baker.financial | GoDaddy.com, LLC | 23 Oct 2023 | 7 Dec 2024 | 23 Oct 2025 |
| 22 | baker.accountants | Super Registry Inc. | 19 Mar 2015 | 19 Mar 2015 | 19 Mar 2016 |
| 23 | baker.recipes | Dynadot, LLC | 11 Oct 2024 | 16 Oct 2024 | 11 Oct 2025 |
| 24 | baker.management | NameCheap, Inc. | 20 Mar 2024 | 25 Mar 2024 | 20 Mar 2029 |
| 25 | baker.community | GoDaddy.com, LLC | 3 Apr 2015 | 14 Jun 2023 | 3 Apr 2023 |
| 26 | baker.wales | Mesh Digital Limited | 23 Nov 2022 | 9 Jun 2024 | 23 Nov 2027 |
| 27 | baker.moscow | Regional Network Information Center, JSC dba RU-CE… | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 28 | baker.legal | GoDaddy.com, LLC | 31 Mar 2015 | 1 Apr 2025 | 31 Mar 2026 |
| 29 | baker.pics | Reserved for non-billable transactions where Regis… | 15 Jun 2024 | - | 15 Jun 2025 |
| 30 | baker.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 31 | baker.rocks | NameCheap, Inc. | 12 Sep 2016 | 18 Aug 2024 | 12 Sep 2025 |
| 32 | baker.bio | Key-Systems, LLC | 24 Apr 2015 | 20 May 2015 | 24 Apr 2016 |
| 33 | baker.amsterdam | Metaregistrar BV Applications | 29 May 2015 | 27 Nov 2024 | 29 May 2025 |
| 34 | baker.wtf | NameCheap, Inc. | 14 Aug 2020 | 20 Jul 2024 | 14 Aug 2025 |
| 35 | baker.sexy | eNom, Inc. | 26 May 2015 | 2 May 2017 | 26 May 2018 |
| 36 | baker.pub | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Sep 2016 | 3 Mar 2018 | 10 Sep 2019 |
| 37 | baker.beer | CloudFlare, Inc. | 7 Jul 2015 | 22 Jan 2023 | 7 Jul 2029 |
| 38 | baker.help | Uniregistrar Corp | 11 Jul 2015 | 11 Jul 2015 | 11 Jul 2016 |
| 39 | baker.wang | eName Technology Co., Ltd. | 21 Jul 2015 | 14 Jun 2017 | 21 Jul 2018 |
| 40 | baker.ink | NameCheap, Inc. | 8 Feb 2025 | 13 Feb 2025 | 8 Feb 2026 |
| 41 | baker.systems | NameCheap, Inc. | 5 Aug 2015 | 11 Jul 2024 | 5 Aug 2025 |
| 42 | baker.support | CloudFlare, Inc. | 5 Aug 2015 | 11 Jul 2024 | 5 Aug 2025 |
| 43 | baker.coffee | CloudFlare, Inc. | 6 Aug 2015 | 12 Jul 2024 | 6 Aug 2025 |
| 44 | baker.tech | CloudFlare, Inc. | 14 Aug 2015 | 31 Aug 2023 | 14 Aug 2029 |
| 45 | baker.party | NameCheap, Inc. | 29 Mar 2019 | 14 Apr 2024 | 29 Mar 2024 |
| 46 | baker.industries | Tucows Domains Inc. | 19 Aug 2015 | 23 Aug 2024 | 19 Aug 2025 |
| 47 | baker.church | Network Solutions, LLC | 21 May 2020 | 5 Jul 2024 | 21 May 2025 |
| 48 | baker.furniture | Regional Network Information Center, JSC dba RU-CE… | 16 Sep 2023 | 20 Sep 2024 | 16 Sep 2025 |
| 49 | baker.football | GoDaddy.com, LLC | 19 Sep 2015 | 3 Nov 2019 | 19 Sep 2020 |
| 50 | baker.center | Chengdu West Dimension Digital Technology Co., Ltd… | 9 Jan 2022 | 9 Jan 2024 | 9 Jan 2025 |
| 51 | baker.foundation | Network Solutions, LLC | 28 Oct 2022 | 12 Dec 2024 | 28 Oct 2025 |
| 52 | baker.xn--6qq986b3xl | Bizcn.com, Inc. | 13 Nov 2015 | 13 Nov 2015 | 13 Nov 2016 |
| 53 | baker.work | CloudFlare, Inc. | 18 Mar 2025 | 23 Mar 2025 | 18 Mar 2026 |
| 54 | baker.law | 101domain, Inc. | 28 Oct 2015 | 3 Sep 2024 | 28 Oct 2025 |
| 55 | baker.city | DNSPod, Inc. | 18 Apr 2021 | 21 Apr 2025 | 18 Apr 2026 |
| 56 | baker.love | NameCheap, Inc. | 11 Oct 2023 | 16 Sep 2024 | 11 Oct 2025 |
| 57 | baker.ovh | OVH sas | 30 Aug 2024 | 4 Sep 2024 | 30 Aug 2025 |
| 58 | baker.red | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 8 Jan 2016 | 22 Feb 2025 | 8 Jan 2035 |
| 59 | baker.plus | - | 15 Jun 2024 | 30 Aug 2024 | 15 Jun 2025 |
| 60 | baker.vin | Uniregistrar Corp | 11 Feb 2016 | 3 Feb 2025 | 11 Feb 2026 |
| 61 | baker.press | NameCheap, Inc. | 2 Mar 2016 | 2 Mar 2016 | 2 Mar 2017 |
| 62 | baker.ren | - | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 63 | baker.today | GoDaddy.com, LLC | 12 Sep 2021 | 27 Oct 2024 | 12 Sep 2025 |
| 64 | baker.cloud | Porkbun, LLC | 20 Apr 2016 | 5 Apr 2025 | 20 Apr 2026 |
| 65 | baker.college | GoDaddy.com, LLC | 9 Mar 2020 | 10 Mar 2025 | 9 Mar 2026 |
| 66 | baker.photo | NameCheap, Inc. | 29 Mar 2019 | 29 Mar 2019 | 29 Mar 2020 |
| 67 | baker.works | GoDaddy.com, LLC | 9 May 2016 | 16 Jul 2024 | 9 May 2025 |
| 68 | baker.xin | - | 23 Apr 2016 | 23 Apr 2016 | 23 Apr 2017 |
| 69 | baker.vip | Chengdu West Dimension Digital Technology Co., Ltd… | 20 May 2016 | 10 Jul 2024 | 20 May 2025 |
| 70 | baker.ltd | Chengdu West Dimension Digital Technology Co., Ltd… | 7 Sep 2024 | 24 Nov 2024 | 7 Sep 2025 |
| 71 | baker.team | eNom, Inc. | 29 Jun 2016 | 3 Jun 2024 | 29 Jun 2025 |
| 72 | baker.ventures | GoDaddy.com, LLC | 7 May 2014 | 2 Jul 2024 | 7 May 2025 |
| 73 | baker.gallery | GoDaddy.com, LLC | 20 Feb 2014 | 30 Jun 2024 | 20 Feb 2026 |
| 74 | baker.photography | GoDaddy.com, LLC | 12 Feb 2014 | 29 Jun 2024 | 12 Feb 2026 |
| 75 | baker.lol | NameCheap, Inc. | 20 Sep 2018 | 14 Nov 2024 | 20 Sep 2025 |
| 76 | baker.international | Go Montenegro Domains, LLC | 9 Apr 2014 | 10 Apr 2025 | 9 Apr 2026 |
| 77 | baker.house | - | 23 Mar 2025 | 28 Mar 2025 | 23 Mar 2026 |
| 78 | baker.host | - | 13 Jul 2016 | 13 Jul 2016 | 13 Jul 2017 |
| 79 | baker.solutions | Dynadot, LLC | 11 Jun 2024 | 9 Mar 2025 | 11 Jun 2025 |
| 80 | baker.email | Go Montenegro Domains, LLC | 23 Mar 2014 | 6 Jun 2024 | 23 Mar 2026 |
| 81 | baker.in | Dynadot, LLC | 3 May 2012 | 4 May 2025 | 3 May 2025 |
| 82 | baker.jobs | Name Share, Inc. | 4 Feb 2010 | 20 Mar 2016 | 4 Feb 2017 |
| 83 | baker.marketing | Porkbun, LLC | 27 Mar 2024 | 7 Apr 2025 | 27 Mar 2026 |
| 84 | baker.properties | - | 21 Nov 2023 | 1 Feb 2025 | 21 Nov 2024 |
| 85 | baker.condos | GoDaddy.com, LLC | 4 Jun 2014 | 4 Mar 2025 | 4 Jun 2025 |
| 86 | baker.cool | GoDaddy.com, LLC | 5 Apr 2018 | 6 Apr 2025 | 5 Apr 2026 |
| 87 | baker.consulting | CloudFlare, Inc. | 5 Mar 2021 | 28 Jan 2025 | 5 Mar 2026 |
| 88 | baker.biz | Easyspace LTD | 27 Mar 2002 | 1 Apr 2019 | 26 Mar 2029 |
| 89 | baker.group | eNom, Inc. | 19 Dec 2018 | 19 Mar 2024 | 19 Dec 2025 |
| 90 | baker.science | NameCheap, Inc. | 13 Jul 2018 | 18 Jun 2019 | 13 Jul 2020 |
| 91 | baker.men | Porkbun, LLC | 17 Nov 2017 | 3 Jan 2025 | 17 Nov 2025 |
| 92 | baker.holdings | Tucows Domains Inc. | 20 Sep 2016 | 24 Sep 2024 | 20 Sep 2025 |
| 93 | baker.express | GoDaddy.com, LLC | 27 Sep 2016 | 11 Nov 2019 | 27 Sep 2020 |
| 94 | baker.tools | GoDaddy.com, LLC | 24 Jan 2019 | 10 Mar 2025 | 24 Jan 2026 |
| 95 | baker.rentals | Google, Inc. | 15 Feb 2023 | 6 Feb 2025 | 15 Feb 2026 |
| 96 | baker.limited | eNom, Inc. | 9 Oct 2016 | 20 Nov 2017 | 9 Oct 2017 |
| 97 | baker.fyi | CloudFlare, Inc. | 28 Dec 2024 | 2 Jan 2025 | 28 Dec 2025 |
| 98 | baker.net | Network Solutions, LLC | 28 May 1997 | 28 Mar 2024 | 27 May 2027 |
| 99 | baker.org | Network Solutions, LLC | 27 Jun 1994 | 1 Jul 2022 | 26 Jun 2032 |
| 100 | baker.us | GoDaddy.com, LLC | 20 Apr 2002 | 20 Apr 2025 | 19 Apr 2026 |
| 101 | baker.xxx | - | 1 Dec 2011 | 30 Jan 2012 | 1 Dec 2021 |
| 102 | baker.xyz | GoDaddy.com, LLC | 2 Jun 2014 | 29 Aug 2024 | 2 Jun 2025 |
| 103 | baker.tel | Global Domains International, Inc. DBA DomainCostC… | 24 Apr 2012 | 8 Jun 2024 | 23 Apr 2025 |
| 104 | baker.by | - | 16 Apr 2010 | 4 Apr 2025 | 20 Apr 2027 |
| 105 | baker.be | - | 21 Jul 2003 | - | - |
| 106 | baker.cc | Dynadot, LLC | 24 Oct 2017 | 24 Oct 2023 | 24 Oct 2026 |
| 107 | baker.engineer | NameCheap, Inc. | 26 Oct 2016 | 1 Oct 2024 | 26 Oct 2025 |
| 108 | baker.ca | Namespro Solutions Inc. | 7 Apr 2010 | 3 Apr 2025 | 7 Apr 2026 |
| 109 | baker.de | - | - | 27 Feb 2019 | - |
| 110 | baker.fr | 1API GmbH | 3 Jun 2004 | 30 Nov 2024 | 9 Oct 2025 |
| 111 | baker.it | Acens Technologies, S.L.U. | 14 Nov 2003 | 30 Nov 2024 | 14 Nov 2025 |
| 112 | baker.kr | - | 13 Mar 2007 | 17 Oct 2017 | 13 Mar 2018 |
| 113 | baker.me | GoDaddy.com, LLC | 29 Apr 2008 | 22 Jun 2024 | 29 Apr 2025 |
| 114 | baker.com.pl | - | 18 Jan 2015 | 15 Jan 2017 | 18 Jan 2018 |
| 115 | baker.pl | - | 9 Jul 2010 | 21 Nov 2024 | 9 Jul 2025 |
| 116 | baker.pw | eNom, Inc. | 3 Dec 2012 | 18 Oct 2016 | 31 Mar 2017 |
| 117 | baker.co.uk | - | 24 Dec 2002 | 4 Jul 2024 | 24 Dec 2030 |
| 118 | baker.guru | Google, Inc. | 23 Mar 2021 | 2 Jun 2024 | 23 Mar 2026 |
| 119 | baker.tv | Fabulous.com Pty Ltd. | 2 Mar 2016 | 16 Apr 2025 | 2 Mar 2026 |
| 120 | baker.digital | eNom, Inc. | 17 Mar 2017 | 20 Mar 2025 | 17 Mar 2026 |
| 121 | baker.education | Google, Inc. | 10 Apr 2017 | 31 Mar 2025 | 10 Apr 2026 |
| 122 | baker.zone | Automattic Inc. | 13 May 2019 | 23 Apr 2025 | 13 May 2026 |
| 123 | baker.media | GoDaddy.com, LLC | 28 May 2017 | 24 Jul 2024 | 28 May 2025 |
| 124 | baker.mobi | GoDaddy.com, LLC | 8 Jun 2017 | 24 Jul 2024 | 8 Jun 2026 |
| 125 | baker.estate | GoDaddy.com, LLC | 18 Jun 2017 | 6 Jan 2018 | 18 Jun 2018 |
| 126 | baker.us.com | eNom, Inc. | 27 Dec 2005 | 8 Jan 2025 | 27 Dec 2025 |
| 127 | baker.watch | Name.com, Inc. | 28 Nov 2023 | 22 Nov 2024 | 28 Nov 2024 |
| 128 | baker.uk | - | 10 Jun 2014 | 4 Jul 2024 | 10 Jun 2031 |
| 129 | baker.me.uk | - | 14 Jan 2002 | 4 Jul 2024 | 14 Jan 2031 |
| 130 | baker.org.uk | - | 23 Oct 2003 | 4 Jul 2024 | 23 Oct 2029 |
| 131 | baker.company | Google, Inc. | 31 Jul 2023 | 21 Jul 2024 | 31 Jul 2025 |
| 132 | baker.place | GoDaddy.com, LLC | 28 Nov 2023 | 3 Dec 2023 | 28 Nov 2025 |
| 133 | baker.energy | Network Solutions, LLC | 2 Mar 2018 | 6 Jan 2025 | 2 Mar 2026 |
| 134 | baker.coach | eNom, Inc. | 27 Oct 2020 | 24 Oct 2024 | 27 Oct 2025 |
| 135 | baker.restaurant | GoDaddy.com, LLC | 25 Apr 2018 | 7 May 2020 | 25 Apr 2021 |
| 136 | baker.expert | CloudFlare, Inc. | 4 Dec 2024 | 9 Dec 2024 | 4 Dec 2025 |
| 137 | baker.tips | Tucows Domains Inc. | 6 Dec 2020 | 10 Dec 2021 | 6 Dec 2022 |
| 138 | baker.network | Namesilo, LLC | 6 Jun 2018 | 7 Jan 2024 | 6 Jun 2025 |
| 139 | baker.engineering | GoDaddy.com, LLC | 26 Jun 2018 | 10 Aug 2024 | 26 Jun 2025 |
| 140 | baker.farm | Google, Inc. | 4 Dec 2020 | 4 Dec 2023 | 4 Dec 2024 |
| 141 | baker.dog | GoDaddy.com, LLC | 28 Jul 2018 | 2 Aug 2018 | 28 Jul 2020 |
| 142 | baker.mba | NameCheap, Inc. | 27 Sep 2018 | 2 Sep 2024 | 27 Sep 2025 |
| 143 | baker.credit | NameCheap, Inc. | 27 Sep 2018 | 2 Sep 2024 | 27 Sep 2025 |
| 144 | baker.photos | Google, Inc. | 11 Nov 2018 | 2 Nov 2024 | 11 Nov 2025 |
| 145 | baker.kitchen | Google, Inc. | 5 Oct 2022 | 5 Oct 2024 | 5 Oct 2025 |
| 146 | baker.dev | Google, Inc. | 14 Oct 2022 | 5 Oct 2024 | 14 Oct 2025 |
| 147 | baker.services | GoDaddy.com, LLC | 29 Dec 2022 | 12 Feb 2025 | 29 Dec 2026 |
| 148 | baker.shoes | - | 15 Jun 2024 | 12 Dec 2024 | 15 Jun 2025 |
| 149 | baker.gold | NameCheap, Inc. | 29 Mar 2019 | 11 May 2024 | 29 Mar 2024 |
| 150 | baker.fund | - | 15 Jun 2024 | 30 Aug 2024 | 15 Jun 2025 |
| 151 | baker.investments | NameCheap, Inc. | 29 Mar 2019 | 11 May 2024 | 29 Mar 2024 |
| 152 | baker.pictures | NameCheap, Inc. | 29 Mar 2019 | 11 May 2024 | 29 Mar 2024 |
| 153 | baker.clothing | NameCheap, Inc. | 29 Mar 2019 | 11 May 2024 | 29 Mar 2024 |
| 154 | baker.run | - | 15 Jun 2024 | 24 Sep 2024 | 15 Jun 2025 |
| 155 | baker.money | Dynadot, LLC | 15 Jun 2024 | 10 Feb 2025 | 15 Jun 2025 |
| 156 | baker.direct | - | 15 Jun 2024 | 12 Dec 2024 | 15 Jun 2025 |
| 157 | baker.enterprises | - | 15 Jun 2024 | 24 Sep 2024 | 15 Jun 2025 |
| 158 | baker.vacations | NameCheap, Inc. | 29 Mar 2019 | 11 May 2024 | 29 Mar 2024 |
| 159 | baker.academy | GoDaddy.com, LLC | 24 Oct 2019 | 14 Aug 2024 | 24 Oct 2025 |
| 160 | baker.training | GoDaddy.com, LLC | 24 Oct 2019 | 29 Oct 2019 | 24 Oct 2021 |
| 161 | baker.delivery | Limited Liability Company "Registrar of domain nam… | 22 Jan 2020 | 8 Mar 2025 | 22 Jan 2026 |
| 162 | baker.blue | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 28 Dec 2021 | 2 Jan 2022 | 28 Dec 2031 |
| 163 | baker.nrw | 1&1 Internet AG | 19 Dec 2019 | 2 Feb 2025 | 19 Dec 2025 |
| 164 | baker.computer | Google, Inc. | 16 Jun 2020 | 7 Jun 2024 | 16 Jun 2025 |
| 165 | baker.doctor | Blue Razor Domains, LLC | 2 Nov 2016 | 5 Nov 2024 | 2 Nov 2025 |
| 166 | baker.pizza | Google, Inc. | 10 Sep 2020 | 31 Aug 2024 | 10 Sep 2025 |
| 167 | baker.realty | Epik Inc. | 26 Sep 2020 | 14 Nov 2021 | 26 Sep 2022 |
| 168 | baker.productions | Google, Inc. | 25 May 2023 | 9 Jul 2024 | 25 May 2025 |
| 169 | baker.vote | NameCheap, Inc. | 4 Aug 2023 | 10 Jul 2024 | 4 Aug 2025 |
| 170 | baker.contact | Porkbun, LLC | 9 Dec 2020 | 10 Dec 2024 | 9 Dec 2025 |
| 171 | baker.fish | Google, Inc. | 20 Dec 2020 | 20 Dec 2023 | 20 Dec 2024 |
| 172 | baker.finance | Dynadot, LLC | 19 Jul 2024 | 10 Feb 2025 | 19 Jul 2025 |
| 173 | baker.gent | Register NV dba Register.eu | 3 Mar 2021 | 3 Mar 2025 | 3 Mar 2025 |
| 174 | baker.guide | NameCheap, Inc. | 19 Apr 2021 | 19 Apr 2025 | 19 Apr 2026 |
| 175 | baker.cleaning | Google, Inc. | 3 Aug 2021 | 3 Aug 2021 | 3 Aug 2022 |
| 176 | baker.town | Google, Inc. | 1 Dec 2021 | 28 Nov 2024 | 1 Dec 2025 |
| 177 | baker.ag | GoDaddy.com, LLC | 29 Oct 2021 | 13 Dec 2024 | 29 Oct 2025 |
| 178 | baker.ru.com | NameKing.com Inc. | 21 Mar 2022 | 20 May 2022 | 21 Mar 2023 |
| 179 | baker.show | GoDaddy.com, LLC | 25 Apr 2024 | 10 May 2025 | 25 Apr 2026 |
| 180 | baker.st | - | 17 Aug 2001 | 4 Jul 2022 | 16 Aug 2023 |
| 181 | baker.equipment | - | 2 Jan 2024 | 2 Jan 2024 | 2 Jan 2025 |
| 182 | baker.net.nz | - | 4 Dec 2000 | 31 Oct 2022 | - |
| 183 | baker.live | GoDaddy.com, LLC | 22 Dec 2020 | 25 Apr 2025 | 22 Dec 2025 |
| 184 | baker.blog | 1API GmbH | 15 Nov 2022 | 29 Dec 2022 | 15 Nov 2023 |
| 185 | baker.nz | - | 28 Nov 2018 | 3 Nov 2023 | - |
| 186 | baker.studio | Google, Inc. | 20 May 2020 | 4 Jul 2024 | 20 May 2025 |
| 187 | baker.social | GoDaddy.com, LLC | 16 Dec 2022 | 13 Jul 2024 | 16 Dec 2032 |
| 188 | baker.software | NameCheap, Inc. | 27 Dec 2022 | 2 Dec 2024 | 27 Dec 2025 |
| 189 | baker.ooo | Google, Inc. | 27 Dec 2022 | 17 Jan 2025 | 27 Dec 2025 |
| 190 | baker.eu.com | - | 27 Jun 2000 | 16 Aug 2024 | 27 Jun 2026 |
| 191 | baker.land | GoDaddy.com, LLC | 10 Jan 2023 | 24 Feb 2025 | 10 Jan 2026 |
| 192 | baker.ac | CommuniGal Communication Ltd. | 30 Sep 2024 | 5 Oct 2024 | 30 Sep 2025 |
| 193 | baker.af | Gandi SAS | 1 Feb 2018 | 12 Feb 2024 | 1 Feb 2027 |
| 194 | baker.best | OVH sas | 15 Jan 2019 | 1 Apr 2025 | 15 Jan 2026 |
| 195 | baker.builders | NameCheap, Inc. | 14 Feb 2017 | 29 Mar 2025 | 14 Feb 2025 |
| 196 | baker.army | NameCheap, Inc. | 7 Feb 2020 | 13 Jan 2025 | 7 Feb 2026 |
| 197 | baker.asia | GoDaddy.com, LLC | 22 Nov 2007 | 6 Jan 2025 | 22 Nov 2025 |
| 198 | baker.net.au | - | - | 9 Jun 2024 | - |
| 199 | baker.bond | Dynadot, LLC | 12 Dec 2021 | 22 Jan 2023 | 12 Dec 2022 |
| 200 | baker.bot | 101domain, Inc. | 6 Aug 2020 | 8 Jun 2024 | 6 Aug 2025 |
| 201 | baker.com.pe | - | - | - | - |
| 202 | baker.cafe | GoDaddy.com, LLC | 6 Sep 2020 | 6 Sep 2023 | 6 Sep 2024 |
| 203 | baker.camp | Porkbun, LLC | 26 Apr 2019 | 14 Oct 2024 | 26 Apr 2026 |
| 204 | baker.pt | - | - | - | - |
| 205 | baker.casa | NameCheap, Inc. | 23 May 2021 | 28 Apr 2024 | 23 May 2025 |
| 206 | baker.cash | NameCheap, Inc. | 27 Sep 2018 | 2 Sep 2024 | 27 Sep 2025 |
| 207 | baker.app | NameKing.com Inc. | 6 Feb 2023 | 23 Mar 2025 | 6 Feb 2026 |
| 208 | baker.co | Tucows Domains Inc. | 26 Aug 2010 | 25 Nov 2024 | 25 Aug 2025 |
| 209 | baker.ie | - | 3 Apr 1997 | 30 Mar 2025 | 4 Apr 2026 |
| 210 | baker.aero | 101domain, Inc. | 28 Oct 2021 | 4 Sep 2024 | 28 Oct 2025 |
| 211 | baker.cpa | EnCirca, Inc. | 9 Nov 2021 | 15 Oct 2024 | 9 Nov 2025 |
| 212 | baker.earth | GoDaddy.com, LLC | 11 Apr 2019 | 17 Apr 2025 | 11 Apr 2026 |
| 213 | baker.games | Xiamen ChinaSource Internet Service Co., Ltd. | 7 Mar 2023 | 11 May 2024 | 7 Mar 2024 |
| 214 | baker.haus | Name.com, Inc. | 1 Jun 2020 | 15 May 2024 | 1 Jun 2025 |
| 215 | baker.homes | Global Domains International, Inc. DBA DomainCostC… | 23 Jun 2020 | 5 Sep 2024 | 23 Jun 2025 |
| 216 | baker.io | NameCheap, Inc. | 6 Jul 2012 | 11 Jun 2024 | 6 Jul 2025 |
| 217 | baker.jp | - | 18 Feb 2003 | 1 Mar 2025 | 28 Feb 2026 |
| 218 | baker.link | NameCheap, Inc. | 28 Oct 2021 | 8 Nov 2023 | 28 Oct 2025 |
| 219 | baker.ly | - | 13 Aug 2024 | 18 Aug 2024 | 13 Aug 2025 |
| 220 | baker.market | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Nov 2020 | 30 Nov 2023 | 29 Nov 2024 |
| 221 | baker.nyc | GoDaddy.com, LLC | 13 May 2017 | 19 May 2024 | 13 May 2025 |
| 222 | baker.org.nz | - | 14 Apr 2009 | 31 Oct 2022 | - |
| 223 | baker.wedding | GoDaddy.com, LLC | 17 Jul 2019 | 23 Jul 2024 | 17 Jul 2025 |
| 224 | baker.vc | GoDaddy.com, LLC | 20 Nov 2023 | 23 Jan 2025 | 20 Nov 2025 |
| 225 | baker.sale | GoDaddy.com, LLC | 5 Nov 2019 | 16 Jan 2025 | 5 Nov 2024 |
| 226 | baker.paris | OVH sas | 22 May 2023 | 14 Apr 2025 | 22 May 2025 |
| 227 | baker.vet | eNom, Inc. | 28 Apr 2021 | 2 Apr 2025 | 28 Apr 2026 |
| 228 | baker.co.nz | - | 24 Jul 2018 | 30 Jun 2024 | - |
| 229 | baker.cam | NameCheap, Inc. | 31 Aug 2023 | 12 Oct 2024 | 31 Aug 2024 |
| 230 | baker.capetown | Tucows Domains Inc. | 31 Aug 2023 | 2 Aug 2024 | 31 Aug 2025 |
| 231 | baker.realtor | Name Share, Inc. | 17 Sep 2018 | 18 Aug 2024 | 17 Sep 2025 |
| 232 | baker.rip | Porkbun, LLC | 4 Aug 2022 | 9 Aug 2022 | 4 Aug 2027 |
| 233 | baker.ro | - | 3 Oct 2018 | - | 1 Oct 2027 |
| 234 | baker.cl | Key-Systems GmbH | 6 Aug 1999 | - | 2 Sep 2030 |
| 235 | baker.cn | - | 27 Mar 2004 | - | 27 Mar 2026 |
| 236 | baker.co.in | - | 15 Oct 2009 | 24 Aug 2022 | 15 Oct 2029 |
| 237 | baker.co.jp | - | 24 Sep 2013 | 1 Oct 2024 | - |
| 238 | baker.com.au | - | - | 24 Oct 2023 | - |
| 239 | baker.com.br | - | 24 Feb 2010 | 27 Feb 2025 | 24 Feb 2026 |
| 240 | baker.com.cn | - | 4 Apr 2006 | - | 4 Apr 2026 |
| 241 | baker.fit | GoDaddy.com, LLC | 17 Aug 2020 | 28 Sep 2024 | 17 Aug 2024 |
| 242 | baker.id.au | - | - | 1 Jun 2024 | - |
| 243 | baker.la | - | 7 Apr 2016 | 28 Sep 2024 | 7 Apr 2026 |
| 244 | baker.nl | - | 1 Apr 1998 | 1 Nov 2017 | - |
| 245 | baker.directory | GoDaddy.com, LLC | 7 Sep 2023 | 22 Oct 2024 | 7 Sep 2025 |
| 246 | baker.za.com | NameKing.com Inc. | 30 Jun 2023 | 14 Aug 2024 | 30 Jun 2024 |
| 247 | baker.tax | Tucows Domains Inc. | 4 Oct 2023 | 24 Sep 2024 | 4 Oct 2025 |
| 248 | baker.mortgage | Name.com, Inc. | 12 Oct 2023 | 24 Nov 2024 | 12 Oct 2024 |
| 249 | baker.dance | - | 11 Feb 2025 | 17 Mar 2025 | 11 Feb 2026 |
| 250 | baker.supplies | - | 18 Nov 2023 | 18 Nov 2023 | 18 Nov 2024 |
| 251 | baker.catering | Name.com, Inc. | 28 Nov 2023 | 22 Nov 2024 | 28 Nov 2024 |
| 252 | baker.repair | Name.com, Inc. | 28 Nov 2023 | 22 Nov 2024 | 28 Nov 2024 |
| 253 | baker.careers | GoDaddy.com, LLC | 5 Dec 2023 | 19 Jan 2025 | 5 Dec 2025 |
| 254 | baker.chat | GoDaddy.com, LLC | 23 Dec 2023 | 6 Feb 2025 | 23 Dec 2025 |
| 255 | baker.clinic | NameCheap, Inc. | 24 Jan 2024 | 10 Jan 2025 | 24 Jan 2026 |
| 256 | baker.insure | GoDaddy.com, LLC | 29 Jan 2024 | 17 Oct 2024 | 29 Jan 2029 |
| 257 | baker.im | - | - | - | 11 Apr 2026 |
| 258 | baker.agency | GoDaddy.com, LLC | 23 Mar 2024 | 22 Jan 2025 | 23 Mar 2026 |
| 259 | baker.lat | Porkbun, LLC | 27 Mar 2024 | 8 Apr 2025 | 27 Mar 2026 |
| 260 | baker.ru | - | 20 Nov 2000 | - | 22 Nov 2025 |
| 261 | baker.su | - | 13 May 2021 | - | 13 May 2025 |
| 262 | baker.se | - | 20 Feb 2003 | 28 Jan 2025 | 20 Feb 2026 |
| 263 | baker.diy | - | 2 Jun 2024 | 10 Oct 2024 | 2 Jun 2025 |
| 264 | baker.eu | - | - | - | - |
| 265 | baker.monster | Chengdu West Dimension Digital Technology Co., Ltd… | 9 Nov 2024 | 15 Dec 2024 | 9 Nov 2025 |
| 266 | baker.bz | Regional Network Information Center, JSC dba RU-CE… | 20 Aug 2023 | 4 Oct 2024 | 20 Aug 2025 |
| 267 | baker.care | NameCheap, Inc. | 23 Jan 2025 | 28 Jan 2025 | 23 Jan 2026 |
| 268 | baker.com.co | NameCheap, Inc. | 20 Mar 2024 | 25 Mar 2024 | 20 Mar 2029 |
| 269 | baker.sh | Porkbun, LLC | 1 Mar 2020 | 9 Aug 2024 | 1 Mar 2031 |
| 270 | baker.cx | - | 17 Jun 2024 | 22 Jun 2024 | 17 Jun 2025 |
| 271 | baker.ng | - | 15 Nov 2023 | 6 Nov 2024 | 15 Nov 2025 |
| 272 | baker.ws | GoDaddy.com, LLC | 22 Mar 2022 | 23 Mar 2025 | 22 Mar 2026 |
| 273 | baker.ma | - | 13 Dec 2022 | 29 Nov 2024 | 13 Dec 2025 |
| 274 | baker.qa | - | - | - | - |
| 275 | baker.hu | - | 17 May 2000 | - | - |
| 276 | bakerlist.com | TurnCommerce, Inc. DBA NameBright.com | 22 Jul 2016 | 21 Aug 2024 | 22 Jul 2024 |
| 277 | bakersgas.com | GoDaddy.com, LLC | 28 May 1999 | 12 Oct 2022 | 28 May 2026 |
| 278 | bakersfieldcollege.edu | - | 7 Jan 2002 | 20 Apr 2017 | 31 Jul 2018 |
| 279 | bakertilly.co.uk | - | - | 23 Jun 2024 | 27 Jun 2025 |
| 280 | bakerboyeronline.com | Domain.com, LLC | 29 May 2009 | 9 May 2024 | 29 May 2025 |
| 281 | bakerssquare.com | Network Solutions, LLC | 3 Mar 1999 | 2 Jan 2025 | 3 Mar 2028 |
| 282 | bakertilly.com | eNom, Inc. | 21 Mar 2000 | 23 Jan 2024 | 21 Mar 2026 |
| 283 | bakeri.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 1998 | 7 Apr 2025 | 19 Apr 2026 |
| 284 | bakershoes.com | Amazon Registrar, Inc. | 18 Feb 2000 | 15 Jan 2025 | 18 Feb 2026 |
| 285 | bakertillyberk.com | Hosting Concepts B.V. dba Openprovider | 13 Dec 2006 | 13 Dec 2024 | 13 Dec 2025 |
| 286 | baker-group.net | Hosting Ukraine LLC | 8 Oct 2009 | 21 Mar 2024 | 8 Oct 2025 |
| 287 | bakerross.co.uk | - | 27 Mar 1998 | 7 Jun 2024 | 27 Mar 2026 |
| 288 | bakera.jp | - | 4 Mar 2005 | 1 Apr 2025 | 31 Mar 2026 |
| 289 | bakerdonelson.com | GoDaddy.com, LLC | 30 Oct 1998 | 19 Oct 2023 | 29 Oct 2028 |
| 290 | bakersoven.in | - | 23 Nov 2009 | 24 Apr 2024 | 23 Nov 2025 |
| 291 | bakeryland.co.th | - | 1 Mar 2010 | 23 Nov 2023 | 28 Feb 2026 |
| 292 | baker-taylor.com | Network Solutions, LLC | 10 Aug 1995 | 15 Aug 2023 | 9 Aug 2031 |
| 293 | bakerlindsey.com | Cronon AG | 23 Jun 2021 | 23 Jun 2021 | 23 Jun 2022 |
| 294 | bakersfieldmarathon.com | GoDaddy.com, LLC | 26 Sep 2018 | 27 Sep 2024 | 26 Sep 2025 |
| 295 | bakerplayblog.com | FastDomain Inc. | 18 Feb 2012 | 18 Feb 2012 | 18 Feb 2013 |
| 296 | bakeryandsnacks.com | GoDaddy.com, LLC | 16 Jan 2003 | 20 Dec 2024 | 16 Jan 2026 |
| 297 | bakerboysdist.com | DreamHost, LLC | 13 Mar 2008 | 10 Feb 2025 | 13 Mar 2026 |
| 298 | bakerlab.org | Domain.com, LLC | 18 Jun 2001 | 10 Mar 2023 | 18 Jun 2027 |
| 299 | bakersdelight.com.au | - | - | 21 Jul 2024 | - |
| 300 | bakersfieldbug.com | DropCatch.com 1389 LLC | 13 Jul 2018 | 13 Jul 2018 | 13 Jul 2019 |
| 301 | bakerskateboards.com | Gandi SAS | 28 Mar 2001 | 15 Feb 2025 | 28 Mar 2027 |
| 302 | bakerframework.com | GoDaddy.com, LLC | 25 Oct 2010 | 20 Jan 2025 | 25 Oct 2025 |
| 303 | bakerfurniture.com | GoDaddy.com, LLC | 15 Jul 1996 | 14 Jul 2024 | 14 Jul 2025 |
| 304 | bakersfieldnow.com | Brandsight, Inc. | 29 Jun 2004 | 14 Nov 2023 | 29 Jun 2026 |
| 305 | bakeru.edu | - | 11 Jul 1994 | 3 Dec 2015 | 31 Jul 2017 |
| 306 | bakermckenzie.com | Network Solutions, LLC | 15 Jan 1999 | 16 Nov 2023 | 15 Jan 2026 |
| 307 | bakersroyale.com | FastDomain Inc. | 30 Dec 2009 | 14 Dec 2024 | 30 Dec 2025 |
| 308 | bakerstreet.tv | BigRock Solutions Ltd. | 2 Jun 2011 | 8 Jun 2024 | 2 Jun 2025 |
| 309 | bakeryequipment.com | GoDaddy.com, LLC | 28 Jan 1997 | 13 Sep 2022 | 29 Jan 2031 |
| 310 | bakerhughesdirect.com | Key-Systems GmbH | 12 May 2000 | 11 Apr 2025 | 12 May 2026 |
| 311 | bakerandsoars.com | Register.it SPA | 15 Feb 2013 | 3 Feb 2025 | 15 Feb 2026 |
| 312 | bakerandspiceme.com | NameCheap, Inc. | 18 Feb 2009 | 11 Jul 2024 | 18 Feb 2026 |
| 313 | bakerbettie.com | Wild West Domains, LLC | 7 Jan 2012 | 8 Dec 2024 | 7 Jan 2026 |
| 314 | bakerbotts.com | Network Solutions, LLC | 28 Apr 1995 | 29 Feb 2024 | 29 Apr 2029 |
| 315 | bakerbynature.com | NameCheap, Inc. | 10 Mar 2011 | 26 Feb 2021 | 9 Mar 2026 |
| 316 | bakerdays.com | Webfusion Ltd. | 20 Jul 2011 | 21 Jul 2024 | 20 Jul 2025 |
| 317 | bakerdist.com | Network Solutions, LLC | 3 Jan 1997 | 3 Nov 2021 | 2 Jan 2027 |
| 318 | bakerella.com | GoDaddy.com, LLC | 28 Jan 2008 | 25 Jan 2024 | 28 Jan 2026 |
| 319 | bakerenogkokken.no | - | 16 Jan 2013 | 16 Jan 2013 | - |
| 320 | bakerette.com | GoDaddy.com, LLC | 4 Feb 2011 | 5 Feb 2025 | 4 Feb 2026 |
| 321 | bakerhughes.com | Key-Systems GmbH | 25 Jun 1996 | 23 May 2024 | 24 Jun 2025 |
| 322 | bakeridi.edu.au | Experian Services Corp. | - | 14 Jan 2014 | - |
| 323 | bakerinstitute.org | register.com, Inc. | 24 Jul 2000 | 17 Oct 2024 | 24 Jul 2027 |
| 324 | bakerita.com | GoDaddy.com, LLC | 7 Sep 2010 | 27 Aug 2024 | 7 Sep 2027 |
| 325 | bakerlaw.com | Network Solutions, LLC | 24 Jul 1996 | 25 Apr 2022 | 23 Jul 2025 |
| 326 | bakermarketingservices.com | Tucows Domains Inc. | 15 Jul 2011 | 30 Jun 2024 | 15 Jul 2025 |
| 327 | bakermen.com | Key-Systems GmbH | 8 Feb 2010 | 3 Feb 2025 | 8 Feb 2026 |
| 328 | bakerpartyrentals.com | GoDaddy.com, LLC | 26 Apr 2000 | 18 Sep 2022 | 26 Apr 2028 |
| 329 | bakerpublishinggroup.com | Network Solutions, LLC | 1 Mar 2004 | 15 Jan 2025 | 1 Mar 2027 |
| 330 | bakerross.de | - | - | 1 Dec 2021 | - |
| 331 | bakers-corner.com.au | - | - | 31 Mar 2025 | - |
| 332 | bakersdozenandapolloxiv.com | GoDaddy.com, LLC | 6 Nov 2019 | 7 Nov 2024 | 6 Nov 2025 |
| 333 | bakersfield.com | GoDaddy.com, LLC | 29 Oct 1995 | 28 Oct 2024 | 28 Oct 2025 |
| 334 | bakersfield.net | GoDaddy.com, LLC | 5 Sep 1996 | 4 Sep 2024 | 4 Sep 2025 |
| 335 | bakersfieldbusinessguide.com | - | 27 May 2023 | 26 Apr 2025 | 27 May 2025 |
| 336 | bakersfieldtacos.com | NameCheap, Inc. | 6 Oct 2014 | 6 Sep 2024 | 6 Oct 2025 |
| 337 | bakersfieldwebring.com | Realtime Register B.V. | 21 Apr 2024 | 22 Apr 2025 | 21 Apr 2026 |
| 338 | bakersinn.com | GoDaddy.com, LLC | 27 Mar 2018 | 26 Mar 2025 | 27 Mar 2026 |
| 339 | bakersplus.com | Network Solutions, LLC | 23 Sep 2002 | 25 Jul 2023 | 23 Sep 2025 |
| 340 | bakersshoes.com | Network Solutions, LLC | 12 Nov 1999 | 19 Jul 2023 | 12 Nov 2028 |
| 341 | bakersville.in | GoDaddy.com, LLC | 15 Jul 2011 | 14 Feb 2023 | 15 Jul 2025 |
| 342 | bakertillyinternational.com | Easyspace LTD | 19 Jun 2001 | 31 Jan 2025 | 19 Jun 2025 |
| 343 | bakerviewconsulting.com | NameCheap, Inc. | 20 Nov 2011 | 21 Oct 2024 | 20 Nov 2025 |
| 344 | bakerybite.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Feb 2023 | 23 Mar 2025 | 16 Feb 2026 |
| 345 | bakerybits.co.uk | - | 9 Aug 2009 | 10 Jul 2024 | 9 Aug 2025 |
| 346 | bakeryinfo.co.uk | - | 18 Jul 2006 | 27 Jun 2024 | 18 Jul 2025 |
| 347 | bakerymagazine.com | GoDaddy.com, LLC | 7 Dec 2010 | 8 Dec 2022 | 7 Dec 2025 |
| 348 | bakerymailer.com | GoDaddy.com, LLC | 19 Sep 2013 | 31 Oct 2024 | 19 Sep 2024 |
| 349 | bakeryskill.com | GoDaddy.com, LLC | 8 Oct 2014 | 19 Nov 2024 | 8 Oct 2024 |
| 350 | bakersfieldcity.us | NEUSTAR RESERVE ACCOUNT A|US RESERVE|GDAVIDSO | 18 Apr 2002 | 18 Feb 2025 | 27 May 2102 |
| 351 | bakerybandit.com | Wild West Domains, LLC | 27 Jul 2024 | 31 Dec 2024 | 27 Jul 2025 |
| 352 | bakersfieldcaliforniaclassifieds.com | Wild West Domains, LLC | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 353 | bakerhughestrs.com | MarkMonitor Inc. | 21 Oct 2014 | 10 Sep 2024 | 21 Oct 2025 |
| 354 | bakercustomtileca.com | GoDaddy.com, LLC | 27 Jul 2022 | 8 Oct 2023 | 27 Jul 2023 |
| 355 | bakercrest.com | Hostinger, UAB | 21 Nov 2024 | 21 Jan 2025 | 21 Nov 2025 |
| 356 | bakerconstructionnoblesville.com | GoDaddy.com, LLC | 22 Oct 2014 | 2 Nov 2024 | 22 Oct 2025 |
| 357 | bakerannie.com | eNom, Inc. | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 358 | bakersfieldstorage.net | GoDaddy.com, LLC | 20 Oct 2014 | 20 Oct 2014 | 20 Oct 2015 |
| 359 | bakertillyberk.nl | - | 13 Dec 2006 | 27 Feb 2021 | - |
| 360 | bakerymachines-magazin.ru | - | - | - | - |
| 361 | bakeryhaccp.com | PSI-USA, Inc. dba Domain Robot | 21 Jun 2023 | 20 Jun 2024 | 21 Jun 2024 |
| 362 | bakerydryriver.com | TurnCommerce, Inc. DBA NameBright.com | 23 Oct 2014 | 29 Sep 2017 | 22 Oct 2018 |
| 363 | bakersberry.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 364 | bakergetriebe.com | Cronon AG | 22 Oct 2014 | 11 Dec 2024 | 22 Oct 2025 |
| 365 | bakerhaus.com | PSI-USA, Inc. dba Domain Robot | 3 Jul 2011 | 22 Aug 2024 | 3 Jul 2025 |
| 366 | bakershoe.com | CloudFlare, Inc. | 20 Nov 1999 | 5 Nov 2024 | 20 Nov 2025 |
| 367 | bakerychina.com | HiChina Zhicheng Technology Limited | 10 Aug 2012 | 8 Jul 2024 | 10 Aug 2025 |
| 368 | bakercaitlin.us | Launchpad, Inc. | 21 Oct 2014 | 21 Oct 2014 | 20 Oct 2015 |
| 369 | bakerperkins.com | Key-Systems GmbH | 16 Mar 1998 | 5 Jan 2025 | 15 Mar 2026 |
| 370 | bakersmart.co.in | Key-Systems GmbH | 9 Oct 2020 | 23 Nov 2024 | 9 Oct 2025 |
| 371 | bakershop.it | - | 3 Feb 2012 | 4 Feb 2025 | 19 Jan 2026 |
| 372 | bakersclearinghouse.com | Tucows Domains Inc. | 24 Oct 2014 | 28 Oct 2015 | 24 Oct 2016 |
| 373 | bakers-cakes.com | Tucows Domains Inc. | 23 Oct 2014 | 27 Oct 2015 | 23 Oct 2016 |
| 374 | bakeribygget-massasje.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 375 | bakerengineeringcorp.com | Tucows Domains Inc. | 20 Oct 2013 | 24 Oct 2014 | 20 Oct 2015 |
| 376 | baker-guide.com | 1API GmbH | 23 Oct 2014 | 20 Mar 2020 | 23 Oct 2025 |
| 377 | bakertilly.de | - | - | 12 Aug 2021 | - |
| 378 | bakeria.ch | - | - | - | - |
| 379 | bakerxchange.com | Network Solutions, LLC | 12 Apr 2006 | 11 Feb 2025 | 12 Apr 2026 |
| 380 | bakermckenzie.co.jp | - | 6 Aug 2012 | 1 Sep 2024 | - |
| 381 | bakershoes.es | - | - | - | - |
| 382 | baker-street.co.za | Commerce Island, Inc. | 8 Mar 2002 | - | - |
| 383 | bakerboyer.com | Domain.com, LLC | 14 Jul 1997 | 21 Apr 2025 | 11 May 2026 |
| 384 | bakerymba.com | 1&1 Internet AG | 24 Oct 2014 | 15 Feb 2018 | 24 Oct 2018 |
| 385 | bakerydirectonline.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2019 |
| 386 | bakersfieldmonumentcompany.com | GoDaddy.com, LLC | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 387 | bakersfield-es.com | - | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2017 |
| 388 | bakerexchange.com | TurnCommerce, Inc. DBA NameBright.com | 9 Jan 2016 | 3 Jan 2021 | 9 Jan 2026 |
| 389 | bakerevolution.com | 1&1 Internet AG | 24 Oct 2014 | 25 Oct 2024 | 24 Oct 2025 |
| 390 | bakereditor.com | register.com, Inc. | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2016 |
| 391 | bakerycrafts.com | Network Solutions, LLC | 5 Aug 1996 | 5 Jun 2021 | 4 Aug 2026 |
| 392 | bakersfieldatlas.com | GoDaddy.com, LLC | 25 May 2014 | 25 May 2015 | 25 May 2016 |
| 393 | bakersanonymous.com | Annulet LLC | 15 Jul 2016 | 1 Sep 2024 | 15 Jul 2025 |
| 394 | bakerviewwellnesscentre.org | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 395 | bakersfieldhealingarts.info | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 396 | bakerville.co | GoDaddy.com, LLC | 27 May 2013 | 6 May 2017 | 26 May 2018 |
| 397 | bakeryofdenver.com | GoDaddy.com, LLC | 26 May 2012 | 27 May 2015 | 26 May 2016 |
| 398 | bakersmanbk.com | GoDaddy.com, LLC | 26 May 2014 | 27 May 2015 | 26 May 2016 |
| 399 | bakersmanbrooklyn.com | GoDaddy.com, LLC | 26 May 2014 | 27 May 2015 | 26 May 2016 |
| 400 | bakerband.org | Wild West Domains, LLC | 26 May 2014 | 7 Jun 2015 | 26 May 2016 |
| 401 | bakersfieldbankrates.com | GoDaddy.com, LLC | 26 May 2011 | 27 May 2015 | 26 May 2016 |
| 402 | bakersheadquarters.com | GoDaddy.com, LLC | 27 May 2009 | 28 May 2015 | 27 May 2016 |
| 403 | bakercityphotobooth.com | GoDaddy.com, LLC | 27 May 2013 | 28 May 2015 | 27 May 2016 |
| 404 | bakercityphotoboothrental.com | GoDaddy.com, LLC | 27 May 2013 | 28 May 2015 | 27 May 2016 |
| 405 | bakeryroom.com | Annulet LLC | 14 Aug 2015 | 30 Sep 2024 | 14 Aug 2025 |
| 406 | bakershq.com | Tucows Domains Inc. | 29 Feb 2016 | 9 Apr 2020 | 28 Feb 2020 |
| 407 | bakersbabybarn.com | GoDaddy.com, LLC | 9 Oct 2013 | 4 May 2015 | 9 Oct 2015 |
| 408 | bakersfieldbestagent.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2015 | 28 May 2016 |
| 409 | bakerstreetindia.com | GoDaddy.com, LLC | 28 May 2010 | 29 May 2015 | 28 May 2016 |
| 410 | bakersfieldwrapfactory.com | GoDaddy.com, LLC | 30 Jun 2013 | 29 May 2015 | 28 May 2016 |
| 411 | bakersfieldhousevalues.com | GoDaddy.com, LLC | 11 Jul 2018 | 11 Jul 2018 | 11 Jul 2019 |
| 412 | bakersfieldautowraps.com | GoDaddy.com, LLC | 30 Jun 2013 | 29 May 2015 | 28 May 2016 |
| 413 | bakerycheff.com | GoDaddy.com, LLC | 29 May 2014 | 30 May 2015 | 29 May 2016 |
| 414 | bakerybestfriends.com | GoDaddy.com, LLC | 25 Oct 2014 | 6 Jan 2025 | 25 Oct 2024 |
| 415 | bakersdozenbox.com | GoDaddy.com, LLC | 27 Jun 2018 | 8 Sep 2024 | 27 Jun 2024 |
| 416 | bakerieseastlansing.com | Tucows Domains Inc. | 22 Oct 2010 | 26 Oct 2014 | 22 Oct 2015 |
| 417 | bakerboydonuts.com | Domain.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 418 | bakery3d.com | Cosmotown, Inc. | 14 Apr 2024 | 4 Apr 2025 | 14 Apr 2025 |
| 419 | bakerspalate.com | GoDaddy.com, LLC | 19 Sep 2022 | 1 Dec 2023 | 19 Sep 2023 |
| 420 | bakersbestbreadmix.com | GoDaddy.com, LLC | 31 May 2013 | 1 Jun 2015 | 31 May 2016 |
| 421 | bakersfieldbanners.com | 1&1 Internet AG | 22 Aug 2019 | 22 Aug 2019 | 22 Aug 2025 |
| 422 | bakerwebsitedesign.com | GoDaddy.com, LLC | 3 Jun 2011 | 4 Jun 2015 | 3 Jun 2016 |
| 423 | bakersfieldautoinsuranceusa.com | Wild West Domains, LLC | 4 Jun 2013 | 4 Jun 2015 | 4 Jun 2016 |
| 424 | bakerlogistics.us | GoDaddy.com, LLC | 4 Jun 2014 | 4 Jun 2014 | 3 Jun 2015 |
| 425 | bakersfieldnursinghomeabuselawyer.com | GoDaddy.com, LLC | 22 May 2009 | 23 May 2015 | 22 May 2016 |
| 426 | bakersfieldirregulars.com | Wild West Domains, LLC | 23 May 2013 | 24 May 2015 | 23 May 2016 |
| 427 | bakerfeistpsychology.com | GoDaddy.com, LLC | 21 May 2012 | 22 May 2015 | 21 May 2016 |
| 428 | bakeryfarmstand.com | GoDaddy.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 429 | bakerybagsmanufacturer.com | GoDaddy.com, LLC | 26 Oct 2014 | 17 Sep 2022 | 26 Oct 2025 |
| 430 | bakerberries.com | GoDaddy.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 431 | bakeratthebar.com | GoDaddy.com, LLC | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2016 |
| 432 | bakersfieldnursinghomeabuseattorney.com | GoDaddy.com, LLC | 22 May 2009 | 23 May 2015 | 22 May 2016 |
| 433 | bakersfieldjuniorrollerderby.com | GoDaddy.com, LLC | 23 May 2014 | 23 May 2015 | 23 May 2016 |
| 434 | bakersfieldrestaurantexpo.com | GoDaddy.com, LLC | 21 May 2014 | 22 May 2015 | 21 May 2016 |
| 435 | bakersfieldtaxi.info | GoDaddy.com, LLC | 14 Jun 2018 | 15 Jun 2019 | 14 Jun 2020 |
| 436 | baker-propertygroup.com | GoDaddy.com, LLC | 23 May 2013 | 24 May 2015 | 23 May 2016 |
| 437 | bakersfielddailydeals.com | GoDaddy.com, LLC | 22 May 2010 | 23 May 2015 | 22 May 2016 |
| 438 | bakerboyhostingsolutions.com | GoDaddy.com, LLC | 4 Jun 2014 | 5 Jun 2015 | 4 Jun 2016 |
| 439 | bakerjobauctions.com | GoDaddy.com, LLC | 5 Jun 2013 | 5 Jun 2015 | 5 Jun 2016 |
| 440 | bakersfieldplumbing.biz | GoDaddy.com, LLC | 5 Jun 2012 | 5 Jun 2014 | 4 Jun 2015 |
| 441 | bakersfieldplumbing.info | GoDaddy.com, LLC | 5 Jun 2012 | 5 Jun 2015 | 5 Jun 2016 |
| 442 | bakersfieldplumbing.ws | - | - | - | - |
| 443 | bakersfieldplumbing.mobi | GoDaddy.com, LLC | 5 Jun 2012 | 6 Jun 2015 | 5 Jun 2016 |
| 444 | bakersfieldabovegroundpools.com | TierraNet Inc. d/b/a DomainDiscover | 1 Oct 2018 | 25 Sep 2024 | 2 Oct 2026 |
| 445 | bakerscientific.com | NameCheap, Inc. | 23 Aug 2015 | 23 Jun 2024 | 23 Aug 2025 |
| 446 | bakerychic.com | GoDaddy.com, LLC | 6 Jun 2014 | 6 Jun 2015 | 6 Jun 2016 |
| 447 | bakerpond.org | GoDaddy.com, LLC | 5 Jun 2010 | 17 Jun 2015 | 5 Jun 2016 |
| 448 | bakerboyzracing.info | GoDaddy.com, LLC | 6 Jun 2012 | 6 Jun 2015 | 6 Jun 2016 |
| 449 | bakersfieldspeedweek.com | GoDaddy.com, LLC | 27 May 2009 | 8 Jun 2015 | 27 May 2016 |
| 450 | bakersfieldpost.com | Beijing Lanhai Jiye Technology Co., Ltd | 15 Dec 2023 | 16 Dec 2024 | 15 Dec 2025 |
| 451 | bakersfieldstar.com | Whiteglove Domains, Incorporated | 22 Dec 2023 | 7 Mar 2025 | 22 Dec 2024 |
| 452 | bakerton.com | GoDaddy.com, LLC | 10 Dec 2014 | 11 Dec 2024 | 10 Dec 2025 |
| 453 | bakertimes.com | Dynadot, LLC | 5 Apr 2024 | 5 Apr 2025 | 5 Apr 2026 |
| 454 | bakercreekresort.com | GoDaddy.com, LLC | 4 Aug 2009 | 5 Aug 2024 | 4 Aug 2025 |
| 455 | bakerradio.com | GoDaddy.com, LLC | 14 Jul 2006 | 28 Feb 2025 | 14 Jul 2025 |
| 456 | bakersfieldgaragedoorrepair.com | GoDaddy.com, LLC | 21 Jun 2023 | 22 Jun 2024 | 21 Jun 2025 |
| 457 | bakersfieldlawfirm.com | Tucows Domains Inc. | 10 Oct 2017 | 12 Aug 2024 | 10 Oct 2025 |
| 458 | bakersfieldaccident.com | GoDaddy.com, LLC | 1 Jan 2014 | 1 May 2015 | 1 Jan 2016 |
| 459 | bakerautomotive.com | CSC Corporate Domains, Inc. | 17 Jul 2005 | 14 Jul 2024 | 17 Jul 2025 |
| 460 | bakeryboutique.co | GoDaddy.com, LLC | 15 Jul 2013 | 21 May 2015 | 14 Jul 2015 |
| 461 | bakerfinancialservices.com | eNom, Inc. | 20 May 2010 | 17 May 2024 | 20 May 2025 |
| 462 | bakerflooring.com | GoDaddy.com, LLC | 9 Jun 2020 | 17 Feb 2025 | 9 Jun 2025 |
| 463 | bakerhealth.com | eNom, Inc. | 14 Oct 2010 | 10 Oct 2024 | 14 Oct 2025 |
| 464 | bakermiddle.com | eNom, Inc. | 28 Jan 2011 | 23 Jan 2017 | 28 Jan 2018 |
| 465 | bakerydreams.com | GoDaddy.com, LLC | 23 Mar 2021 | 23 Mar 2025 | 23 Mar 2026 |
| 466 | bakeryshow.com | eNom, Inc. | 12 Jun 2012 | 13 Jun 2024 | 12 Jun 2025 |
| 467 | bakeryboys.com | GoDaddy.com, LLC | 1 Feb 2009 | 19 Dec 2024 | 1 Feb 2026 |
| 468 | bakerappliance.com | Dynadot, LLC | 6 Aug 2021 | 14 Nov 2024 | 6 Aug 2025 |
| 469 | bakerart.com | GoDaddy.com, LLC | 20 Nov 2019 | 17 Feb 2025 | 20 Nov 2025 |
| 470 | bakerheating.com | eNom, Inc. | 28 May 2009 | 25 May 2024 | 28 May 2025 |
| 471 | bakersfood.com | - | 4 Jul 2023 | 6 Jul 2024 | 4 Jul 2025 |
| 472 | bakerthomas.com | eNom, Inc. | 28 Feb 2011 | 8 Mar 2025 | 28 Feb 2026 |
| 473 | bakerfinancial.com | eNom, Inc. | 24 Feb 2005 | 8 Mar 2025 | 24 Feb 2026 |
| 474 | bakerydelights.com | eNom, Inc. | 2 Jul 2007 | 4 Jul 2024 | 2 Jul 2025 |
| 475 | bakercity.club | NameCheap, Inc. | 18 Jan 2017 | 15 Feb 2017 | 17 Jan 2018 |
| 476 | bakeryvillagenj.com | FastDomain Inc. | 27 Oct 2014 | 12 Oct 2024 | 27 Oct 2025 |
| 477 | bakervalleyhomes.com | TurnCommerce, Inc. DBA NameBright.com | 30 Sep 2012 | 31 Aug 2022 | 30 Sep 2025 |
| 478 | bakersfieldassociates.com | Wix.com Ltd. | 15 Aug 2024 | 15 Aug 2024 | 15 Aug 2025 |
| 479 | bakersfieldalarmsystems.com | Automattic Inc. | 27 May 2017 | 27 May 2017 | 27 May 2018 |
| 480 | bakerpre.com | GoDaddy.com, LLC | 27 May 2020 | 27 May 2020 | 27 May 2021 |
| 481 | bakerpestcontrolinc.com | Network Solutions, LLC | 27 Oct 2014 | 17 Sep 2024 | 27 Oct 2025 |
| 482 | bakermoran.com | 1&1 Internet AG | 27 Oct 2014 | 12 Mar 2025 | 27 Oct 2025 |
| 483 | bakerhillstables.com | GoDaddy.com, LLC | 13 Nov 2020 | 19 Nov 2024 | 13 Nov 2026 |
| 484 | bakerdesignandbuild.com | Tucows Domains Inc. | 27 Oct 2014 | 7 Dec 2024 | 27 Oct 2024 |
| 485 | bakertowing.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 17 Oct 2024 | 17 Oct 2024 | 17 Oct 2025 |
| 486 | bakersfield-ca.net | GoDaddy.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2016 |
| 487 | bakerbodyshop.net | 1&1 Internet AG | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 488 | bakermods.com | GoDaddy.com, LLC | 28 Jul 2003 | 20 May 2015 | 28 Jul 2015 |
| 489 | bakerdozen.info | GoDaddy.com, LLC | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 490 | bakersfieldoptometrist.com | Dynadot, LLC | 13 Nov 2020 | 13 Nov 2020 | 13 Nov 2021 |
| 491 | bakeryitalia.com | Register.it SPA | 3 May 2024 | 3 May 2024 | 3 May 2025 |
| 492 | bakerinstitute.com | GoDaddy.com, LLC | 26 Jan 2010 | 28 Feb 2025 | 26 Jan 2026 |
| 493 | bakeryphiladelphia.com | Namesilo, LLC | 6 Jun 2018 | 6 Jun 2024 | 6 Jun 2025 |
| 494 | bakersfieldbariatric.com | GoDaddy.com, LLC | 29 Jun 2016 | 29 Jun 2016 | 29 Jun 2019 |
| 495 | bakersfieldnailsalons.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Jun 2018 | 26 Jun 2018 | 26 Jun 2019 |
| 496 | bakersfieldstainedglass.com | GoDaddy.com, LLC | 5 Nov 2010 | 6 Nov 2014 | 5 Nov 2015 |
| 497 | bakersfieldalum.com | GoDaddy.com, LLC | 11 Oct 2007 | 23 Dec 2024 | 11 Oct 2024 |
| 498 | bakergrad.com | GoDaddy.com, LLC | 26 Mar 2016 | 9 Apr 2025 | 26 Mar 2026 |
| 499 | bakerhughes.co | NameKing.com Inc. | 14 Jul 2021 | 30 Aug 2023 | 14 Jul 2025 |
| 500 | bakerfamilydental.com | GoDaddy.com, LLC | 13 Mar 2022 | 14 Mar 2025 | 13 Mar 2026 |
| 501 | bakerydesserts.com | Hostinger, UAB | 17 Oct 2024 | 17 Dec 2024 | 17 Oct 2025 |
| 502 | bakercreekseedcompany.com | TurnCommerce, Inc. DBA NameBright.com | 25 Dec 2022 | 16 Mar 2024 | 25 Dec 2025 |
| 503 | bakercreekheirloomseedcompany.com | DropCatch.com 621 LLC | 25 Jan 2016 | 26 Jan 2017 | 25 Jan 2018 |
| 504 | bakercreekseedcatalog.com | GoDaddy.com, LLC | 8 Nov 2014 | 27 Mar 2015 | 8 Nov 2015 |
| 505 | bakerypops.com | GoDaddy.com, LLC | 5 Apr 2014 | 7 Mar 2015 | 5 Apr 2016 |
| 506 | bakeryshopchicago.com | Go Canada Domains, LLC | 8 Jan 2015 | 27 Jan 2015 | 8 Jan 2016 |
| 507 | bakersbarn.com | One.com A/S | 8 Jun 2000 | 4 Jun 2024 | 8 Jun 2025 |
| 508 | bakersfielddaily.com | Dynadot, LLC | 18 Nov 2023 | 12 Dec 2024 | 18 Nov 2025 |
| 509 | bakerymart.com | GoDaddy.com, LLC | 25 Feb 2007 | 4 Mar 2025 | 25 Feb 2026 |
| 510 | bakerykings.com | TurnCommerce, Inc. DBA NameBright.com | 13 Oct 2018 | 23 Dec 2024 | 13 Oct 2024 |
| 511 | bakersfiledfilmfestival.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 512 | bakeracres.com | eNom, Inc. | 29 Sep 2010 | 26 Sep 2024 | 29 Sep 2025 |
| 513 | bakerbody.com | Hangzhou AiMing Network Co., LTD | 19 Jul 2021 | 19 Jul 2021 | 19 Jul 2022 |
| 514 | bakercommunication.com | eNom, Inc. | 19 May 2009 | 17 May 2024 | 19 May 2025 |
| 515 | bakersunion.com | eNom, Inc. | 8 Dec 2010 | 30 Nov 2024 | 8 Dec 2025 |
| 516 | bakerpainting.com | eNom, Inc. | 23 Jan 2011 | 30 Jan 2025 | 23 Jan 2026 |
| 517 | bakerykitchen.com | GoDaddy.com, LLC | 7 Mar 2014 | 8 Mar 2025 | 7 Mar 2026 |
| 518 | bakeryandrestaurant.com | eNom, Inc. | 22 Dec 2012 | 27 Dec 2024 | 22 Dec 2025 |
| 519 | bakersgully.com | eNom, Inc. | 27 Dec 2012 | 27 Dec 2024 | 27 Dec 2025 |
| 520 | bakerypaper.com | Squarespace Domains LLC | 25 Sep 2023 | 11 Sep 2024 | 25 Sep 2025 |
| 521 | bakerappraisals.com | eNom, Inc. | 30 Dec 2012 | 27 Dec 2024 | 30 Dec 2025 |
| 522 | bakerywest.com | Epik Inc. | 4 Mar 2006 | 13 Mar 2025 | 4 Mar 2026 |
| 523 | bakersbodyshop.us | 1&1 Internet AG | 27 Oct 2014 | - | 26 Oct 2015 |
| 524 | bakerpre.org | eNom, Inc. | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 525 | bakermoran.net | 1&1 Internet AG | 27 Oct 2014 | 2 Nov 2017 | 27 Oct 2025 |
| 526 | bakercitychristian.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 527 | bakeryexchange.com | GoDaddy.com, LLC | 7 May 1999 | 28 Feb 2025 | 7 May 2025 |
| 528 | bakerhughescareers.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 10 Nov 2021 | 11 Nov 2024 | 10 Nov 2024 |
| 529 | bakercraft.net | Wild West Domains, LLC | 1 Mar 2008 | 9 Feb 2025 | 1 Mar 2026 |
| 530 | bakerydisplay.com | GoDaddy.com, LLC | 31 Mar 2004 | 21 Apr 2023 | 31 Mar 2028 |
| 531 | bakerpros.com | GoDaddy.com, LLC | 30 Nov 2013 | 28 Feb 2025 | 30 Nov 2025 |
| 532 | bakerexport.com | GoDaddy.com, LLC | 5 Sep 2013 | 3 May 2015 | 5 Sep 2015 |
| 533 | bakerclassiccars.com | GoDaddy.com, LLC | 27 Jun 2000 | 8 Aug 2024 | 27 Jun 2025 |
| 534 | bakeryconcepts.com | Annulet LLC | 30 Jan 2003 | 19 Mar 2025 | 30 Jan 2026 |
| 535 | bakeru.com | TurnCommerce, Inc. DBA NameBright.com | 3 May 2014 | 17 Jun 2020 | 3 May 2025 |
| 536 | bakera.com | - | 26 Jun 2011 | 8 May 2024 | 26 Jun 2025 |
| 537 | bakersfieldtattooremoval.com | GoDaddy.com, LLC | 29 Jan 2017 | 30 Jan 2025 | 29 Jan 2027 |
| 538 | bakersfield-realestate.com | GoDaddy.com, LLC | 29 Mar 2021 | 26 Oct 2022 | 29 Mar 2026 |
| 539 | bakersfield3dprinting.com | Dynadot, LLC | 1 Aug 2019 | 1 Aug 2019 | 1 Aug 2020 |
| 540 | bakeryflour.com | GoDaddy.com, LLC | 16 Nov 2009 | 13 Feb 2025 | 16 Nov 2025 |
| 541 | bakeryedibles.com | NameCheap, Inc. | 4 Feb 2021 | - | 4 Feb 2022 |
| 542 | bakerslounge.com | GoDaddy.com, LLC | 13 May 2011 | 30 Jun 2024 | 13 May 2025 |
| 543 | bakersfielddisabilityattorneys.com | GoDaddy.com, LLC | 16 Sep 2014 | 21 Apr 2015 | 16 Sep 2015 |
| 544 | bakersfieldprobateattorneys.com | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 545 | bakersfieldfamilylawfirm.com | register.com, Inc. | 7 Aug 2019 | 8 Aug 2024 | 7 Aug 2025 |
| 546 | bakersfieldcriminaldefenselawyer.com | GoDaddy.com, LLC | 16 Mar 2022 | 17 Mar 2024 | 16 Mar 2026 |
| 547 | bakersfielddrunkdrivingattorney.com | GoDaddy.com, LLC | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 548 | bakersfieldautoaccidentlawyer.com | Dynadot12 LLC | 26 Apr 2021 | 27 Apr 2021 | 26 Apr 2022 |
| 549 | bakersfieldpatentlaw.com | GoDaddy.com, LLC | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 550 | bakersrestaurant.com | GoDaddy.com, LLC | 2 Aug 2008 | 13 Jul 2024 | 2 Aug 2025 |
| 551 | bakersfieldagent.com | GoDaddy.com, LLC | 13 Jan 2013 | 17 Jan 2025 | 13 Jan 2026 |
| 552 | bakersfieldherbs.com | GoDaddy.com, LLC | 2 Dec 2008 | 19 Apr 2015 | 2 Dec 2015 |
| 553 | bakersracksupply.com | GoDaddy.com, LLC | 6 Jul 2011 | 24 May 2015 | 6 Jul 2015 |
| 554 | bakerydeals.com | GoDaddy.com, LLC | 11 Dec 2007 | 12 Dec 2023 | 11 Dec 2025 |
| 555 | bakermayfield.com | Wild West Domains, LLC | 20 Aug 2013 | 28 Nov 2024 | 20 Aug 2025 |
| 556 | bakerymill.com | GoDaddy.com, LLC | 21 Apr 2008 | 29 Aug 2023 | 21 Apr 2026 |
| 557 | bakersfieldfarmersmarket.com | GoDaddy.com, LLC | 12 Oct 2020 | 10 Nov 2022 | 12 Oct 2032 |
| 558 | bakerspillsolutions.com | Tucows Domains Inc. | 26 Oct 2006 | 30 Oct 2014 | 26 Oct 2015 |
| 559 | bakerboysoutdoors.com | GoDaddy.com, LLC | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 560 | bakerblowereng.com | Namesilo, LLC | 19 Dec 2018 | 20 Dec 2018 | 19 Dec 2019 |
| 561 | bakersheaven.net | - | 27 Nov 2023 | 29 Jan 2025 | 27 Nov 2024 |
| 562 | bakersfieldtreeservice.com | Dynadot, LLC | 2 Jun 2018 | 5 Jun 2024 | 2 Jun 2025 |
| 563 | bakersfieldtreeservices.com | NameKing.com Inc. | 18 Nov 2024 | 28 Feb 2025 | 18 Nov 2025 |
| 564 | bakersfieldsalon.com | GoDaddy.com, LLC | 31 Aug 2024 | 31 Aug 2024 | 31 Aug 2025 |
| 565 | bakersrackco.com | - | 23 Jul 2022 | 24 Aug 2023 | 23 Jul 2023 |
| 566 | bakerrys.com | GoDaddy.com, LLC | 5 Sep 2012 | 26 Aug 2024 | 5 Sep 2025 |
| 567 | baker-media.com | GoDaddy.com, LLC | 30 Mar 2014 | 10 Mar 2025 | 30 Mar 2026 |
| 568 | bakerelease.com | Key-Systems GmbH | 16 Oct 2024 | 22 Jan 2025 | 16 Oct 2025 |
| 569 | bakersfield-towingservice.info | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 570 | bakerysupplies.org | Dynadot, LLC | 10 Jan 2022 | 4 Aug 2022 | 10 Jan 2023 |
| 571 | bakerybistro.com | eNom, Inc. | 3 Sep 2013 | 31 Aug 2024 | 3 Sep 2025 |
| 572 | bakersfieldcahouses.com | GoDaddy.com, LLC | 7 Jul 2009 | 23 Apr 2015 | 7 Jul 2015 |
| 573 | bakerscentsandmore.com | GoDaddy.com, LLC | 2 Jul 2008 | 3 Jul 2015 | 2 Jul 2016 |
| 574 | bakercalifornia.com | GoDaddy.com, LLC | 30 Aug 2006 | 31 Aug 2024 | 30 Aug 2025 |
| 575 | bakerygadsden.com | eNom, Inc. | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 576 | bakersvillecaskets.com | GoDaddy.com, LLC | 30 Oct 2014 | 8 Oct 2016 | 30 Oct 2017 |
| 577 | bakersvillecasket.com | GoDaddy.com, LLC | 30 Oct 2014 | 8 Oct 2016 | 30 Oct 2017 |
| 578 | bakerstoparaguay.com | 1&1 Internet AG | 30 Oct 2014 | 31 Oct 2017 | 30 Oct 2018 |
| 579 | bakersguildcafe.com | FastDomain Inc. | 30 Oct 2014 | 30 Oct 2017 | 30 Oct 2018 |
| 580 | bakeriesking.com | TurnCommerce, Inc. DBA NameBright.com | 15 Mar 2020 | 9 Mar 2021 | 15 Mar 2025 |
| 581 | bakeryflours.com | GoDaddy.com, LLC | 16 Nov 2009 | 13 Feb 2025 | 16 Nov 2025 |
| 582 | bakerstreetresidence.com | GoDaddy.com, LLC | 7 Nov 2013 | 26 Dec 2014 | 7 Nov 2015 |
| 583 | bakerycategory.com | GoDaddy.com, LLC | 2 Oct 2009 | 13 Feb 2025 | 2 Oct 2025 |
| 584 | bakerresearch.com | GoDaddy.com, LLC | 8 Apr 2005 | 10 Apr 2025 | 8 Apr 2026 |
| 585 | bakery-around-envious.net | GMO Internet Inc. | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 586 | bakerymachines.net | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 7 Oct 2016 | 13 Mar 2025 | 7 Oct 2025 |
| 587 | bakersfieldfamilydentist.com | GoDaddy.com, LLC | 17 Mar 2015 | 15 Feb 2025 | 17 Mar 2026 |
| 588 | bakermobilya.com | GoDaddy.com, LLC | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 589 | bakersfieldgoldbuyers.com | Metaregistrar BV Applications | 4 Aug 2024 | 3 Oct 2024 | 4 Aug 2025 |
| 590 | bakerybargains.com | GoDaddy.com, LLC | 19 Jan 2008 | 20 Jan 2024 | 19 Jan 2026 |
| 591 | bakeraviation.com | GoDaddy.com, LLC | 1 Apr 2003 | 2 Apr 2025 | 1 Apr 2026 |
| 592 | bakeryovens.net | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 593 | bakerbuildingcare.net | eNom, Inc. | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 594 | bakerstown.com | eNom, Inc. | 9 Nov 2002 | 8 Nov 2024 | 9 Nov 2025 |
| 595 | bakeryo.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 7 Mar 2025 | 7 Mar 2025 | 7 Mar 2026 |
| 596 | bakershell.com | Soaring Eagle Domains, LLC | 25 Sep 2021 | 25 Sep 2021 | 25 Sep 2022 |
| 597 | bakersfieldbud.com | GoDaddy.com, LLC | 9 Mar 2019 | 9 Mar 2025 | 9 Mar 2027 |
| 598 | bakersfieldbuds.com | GoDaddy.com, LLC | 7 Dec 2013 | 1 Jan 2015 | 7 Dec 2015 |
| 599 | bakersfieldcannabis.com | GoDaddy.com, LLC | 7 Dec 2013 | 18 Feb 2025 | 7 Dec 2024 |
| 600 | bakerycakeslasvegas.com | Wild West Domains, LLC | 7 May 2013 | 8 May 2015 | 7 May 2016 |
| 601 | bakersfieldlocksmith.com | GoDaddy.com, LLC | 31 Jan 2011 | 4 Dec 2023 | 31 Jan 2029 |
| 602 | bakersfieldpersonalinjuryattorney.com | Go China Domains, LLC | 13 Apr 2011 | 14 Apr 2025 | 13 Apr 2026 |
| 603 | bakersfieldredlion.com | Wild West Domains, LLC | 17 Sep 2003 | 28 Aug 2024 | 17 Sep 2025 |
| 604 | bakersovens.com | Uniregistrar Corp | 30 Aug 2008 | 31 Aug 2024 | 30 Aug 2025 |
| 605 | bakercountyfl.com | GoDaddy.com, LLC | 29 Oct 2002 | 9 Oct 2024 | 29 Oct 2025 |
| 606 | bakersfieldautoglass.net | GoDaddy.com, LLC | 19 Nov 2012 | 1 Dec 2014 | 19 Nov 2015 |
| 607 | bakersheriff.org | Network Solutions, LLC | 3 Apr 2000 | 28 Oct 2024 | 3 Apr 2026 |
| 608 | bakeright.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Jan 2007 | 23 Nov 2024 | 9 Jan 2026 |
| 609 | bakerypoint.com | Dynadot, LLC | 26 May 2015 | 8 Jul 2023 | 26 May 2029 |
| 610 | bakersfieldrealty.com | GoDaddy.com, LLC | 4 Apr 2000 | 20 Sep 2022 | 2 Feb 2026 |
| 611 | bakervilleuniversity.com | GoDaddy.com, LLC | 27 Dec 2021 | 28 Feb 2025 | 27 Dec 2025 |
| 612 | bakerwooddriftboats.com | NameKing.com Inc. | 15 Mar 2009 | 26 Apr 2025 | 15 Mar 2026 |
| 613 | bakerconcrete.jobs | Name Share, Inc. | 7 Jan 2012 | 7 Jan 2019 | 7 Jan 2020 |
| 614 | bakersandandgravel.com | Beijing Lanhai Jiye Technology Co., Ltd | 7 Jul 2021 | 8 Jul 2023 | 7 Jul 2024 |
| 615 | bakerit.com | GoDaddy.com, LLC | 23 Dec 2024 | 21 Mar 2025 | 23 Dec 2026 |
| 616 | bakernissan.com | Network Solutions, LLC | 20 Jun 2002 | 21 Apr 2024 | 20 Jun 2029 |
| 617 | bakersice.com | GoDaddy.com, LLC | 23 Mar 2006 | 3 Mar 2025 | 23 Mar 2026 |
| 618 | bakerboy.com | GoDaddy.com, LLC | 5 May 1996 | 22 Apr 2025 | 3 Nov 2025 |
| 619 | bakeries-forsale.com | Wild West Domains, LLC | 19 Jan 2005 | 5 Mar 2015 | 19 Jan 2016 |
| 620 | bakerfarmsgreens.com | GoDaddy.com, LLC | 29 Mar 2013 | 10 Apr 2025 | 29 Mar 2026 |
| 621 | bakerdistrict.com | Annulet LLC | 12 Nov 2018 | 30 Dec 2024 | 12 Nov 2025 |
| 622 | bakersfield247.com | GoDaddy.com, LLC | 23 Jan 2005 | 22 Jan 2025 | 23 Jan 2026 |
| 623 | bakersfieldairportlimo.com | GoDaddy.com, LLC | 15 Aug 2008 | 16 Aug 2014 | 15 Aug 2015 |
| 624 | bakersfieldsupport.com | GoDaddy.com, LLC | 4 Jan 2009 | 19 Apr 2015 | 4 Jan 2016 |
| 625 | bakerspower.com | GoDaddy.com, LLC | 28 Oct 2008 | 1 Nov 2024 | 28 Oct 2029 |
| 626 | bakerymix.com | GoDaddy.com, LLC | 2 May 2006 | 3 May 2024 | 2 May 2025 |
| 627 | bakeryscience.com | GoDaddy.com, LLC | 24 Feb 2007 | 25 Feb 2025 | 24 Feb 2026 |
| 628 | bakerscreekkarting.org | Wild West Domains, LLC | 4 Jun 2015 | 9 Apr 2025 | 4 Jun 2025 |
| 629 | bakersfieldchamber.org | Name.com, Inc. | 17 Apr 2000 | 20 Apr 2025 | 17 Apr 2026 |
| 630 | bakersfieldhyundai.com | GoDaddy.com, LLC | 28 Apr 2009 | 26 Oct 2022 | 1 Nov 2027 |
| 631 | bakercounty.org | Network Solutions, LLC | 30 Nov 1999 | 5 Oct 2022 | 30 Nov 2027 |
| 632 | bakercorp.com | GoDaddy.com, LLC | 6 May 2005 | 20 Dec 2024 | 6 May 2026 |
| 633 | bakersrosin.com | Tucows Domains Inc. | 25 Aug 2007 | 22 Oct 2024 | 25 Aug 2025 |
| 634 | bakersservice.net | GoDaddy.com, LLC | 18 Oct 2011 | 11 Feb 2025 | 18 Oct 2025 |
| 635 | baker-harris.com | Network Solutions, LLC | 23 May 2000 | 24 Mar 2024 | 23 May 2027 |
| 636 | bakersfieldautointeriors.com | Launchpad, Inc. | 18 Mar 2023 | 20 Mar 2025 | 18 Mar 2026 |
| 637 | bakerydelivered.com | DROPCATCH.COM 765 LLC | 25 Apr 2022 | 26 Apr 2023 | 25 Apr 2024 |
| 638 | bakeryboulevard.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 14 Jul 2022 | 13 Sep 2024 | 14 Jul 2024 |
| 639 | bakeryblvd.com | Wix.com Ltd. | 22 Jun 2024 | 22 Jun 2024 | 22 Jun 2025 |
| 640 | bakeruedu.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 641 | bakertily.biz | Tucows Domains Inc. | 31 Oct 2014 | 3 Nov 2015 | 30 Oct 2015 |
| 642 | bakersframingart.com | Network Solutions, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2016 |
| 643 | bakersfieldlogodesign.com | - | - | - | - |
| 644 | bakersfieldcustomsigns.com | register.com, Inc. | 31 Oct 2014 | 9 Nov 2021 | 31 Oct 2026 |
| 645 | bakercattlecompany.com | Google, Inc. | 11 Jul 2017 | 11 Jul 2017 | 11 Jul 2018 |
| 646 | bakerbednar.com | Network Solutions, LLC | 3 Sep 2023 | 16 Oct 2024 | 3 Sep 2024 |
| 647 | bakerlakelodge.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Nov 2011 | 14 Oct 2016 | 30 Nov 2017 |
| 648 | baker-riechmann.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Aug 2004 | 12 Mar 2015 | 11 Aug 2015 |
| 649 | bakercountypress.com | GoDaddy.com, LLC | 24 Sep 2002 | 24 Sep 2024 | 24 Sep 2026 |
| 650 | bakersfieldkidsspeak.com | GoDaddy.com, LLC | 6 Aug 2007 | 16 Sep 2023 | 6 Aug 2023 |
| 651 | bakerboyzz.com | GoDaddy.com, LLC | 1 Dec 2013 | 4 May 2015 | 1 Dec 2015 |
| 652 | bakersfieldlightingsupply.com | GoDaddy.com, LLC | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 653 | bakersfieldcalif-edu.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Aug 1997 | 25 Jul 2017 | 28 Aug 2018 |
| 654 | bakercreek.com | GoDaddy.com, LLC | 26 May 1997 | 6 Sep 2022 | 25 May 2031 |
| 655 | bakerintl.com | Network Solutions, LLC | 26 May 1998 | 28 May 2024 | 25 May 2029 |
| 656 | bakerteam.com | GoDaddy.com, LLC | 8 Feb 1999 | 9 Jan 2024 | 8 Feb 2027 |
| 657 | bakerpool.com | eNom, Inc. | 6 Nov 1998 | 3 Jan 2023 | 5 Nov 2028 |
| 658 | bakersfieldbuyandsell.com | GoDaddy.com, LLC | 12 Nov 2009 | 12 Nov 2024 | 12 Nov 2025 |
| 659 | bakercadillac.org | MarkMonitor Inc. | 4 Jun 2012 | 3 May 2018 | 4 Jun 2019 |
| 660 | bakercustomjewelry.com | Google, Inc. | 29 Mar 2001 | 14 Mar 2025 | 29 Mar 2026 |
| 661 | bakerhouse1885.com | GoDaddy.com, LLC | 1 Mar 2010 | 2 Mar 2025 | 1 Mar 2026 |
| 662 | bakersfieldpride.org | 1&1 Internet AG | 25 Jan 2008 | 11 Mar 2025 | 25 Jan 2026 |
| 663 | bakermans.com | GoDaddy.com, LLC | 28 Oct 2001 | 17 Sep 2024 | 28 Oct 2025 |
| 664 | bakercysttreatment.com | GoDaddy.com, LLC | 30 Mar 2013 | 31 Mar 2015 | 30 Mar 2016 |
| 665 | bakerfhwichita.com | GoDaddy.com, LLC | 23 Mar 2012 | 28 Feb 2025 | 23 Mar 2026 |
| 666 | bakeryjobs.org | Key-Systems GmbH | 26 Aug 2014 | 16 Jan 2025 | 26 Aug 2025 |
| 667 | bakersfieldrealestateteam.com | GoDaddy.com, LLC | 21 Jun 2024 | 21 Jun 2024 | 21 Jun 2025 |
| 668 | bakersfieldhomeimprovement.com | GoDaddy.com, LLC | 21 Feb 2003 | 21 Feb 2025 | 21 Feb 2026 |
| 669 | bakerspd.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Sep 2000 | 26 Feb 2025 | 18 Sep 2025 |
| 670 | bakerscouche.com | OVH sas | 24 Apr 2013 | 25 Apr 2024 | 24 Apr 2025 |
| 671 | bakeryreformulation.com | Megazone Corp., dba HOSTING.KR | 13 Apr 2020 | 13 Apr 2020 | 13 Apr 2021 |
| 672 | bakerso.com | Porkbun, LLC | 1 Jun 2009 | 12 Nov 2024 | 1 Jun 2025 |
| 673 | bakersfieldfitbodyyoga.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Jun 2011 | 6 May 2014 | 23 Jun 2016 |
| 674 | bakerairguns.com | GoDaddy.com, LLC | 31 Jul 2013 | 6 Aug 2024 | 31 Jul 2025 |
| 675 | bakerpools.com | GoDaddy.com, LLC | 21 May 2002 | 1 Mar 2025 | 21 May 2025 |
| 676 | bakersfest.com | NameKing.com Inc. | 8 Apr 2015 | 22 Jun 2024 | 8 Apr 2024 |
| 677 | bakerynewyorkny.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 May 2012 | 25 Apr 2017 | 29 May 2018 |
| 678 | bakerskitchennewbern.com | Network Solutions, LLC | 15 Feb 2012 | 17 Dec 2024 | 15 Feb 2026 |
| 679 | bakerzimmerman.com | GoDaddy.com, LLC | 16 Mar 2002 | 16 Mar 2024 | 15 Mar 2026 |
| 680 | bakernet.com | Network Solutions, LLC | 18 Apr 1995 | 30 Oct 2023 | 19 Apr 2028 |
| 681 | bakercorp.net | Automattic Inc. | 26 Jan 2021 | 11 Aug 2023 | 26 Jan 2027 |
| 682 | bakercreekbistro.com | Hefei Juming Network Technology Co., Ltd | 29 Mar 2023 | 22 Apr 2025 | 29 Mar 2027 |
| 683 | bakerycases.net | Tucows Domains Inc. | 24 Dec 2024 | 24 Dec 2024 | 24 Dec 2025 |
| 684 | bakersjewelry.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Apr 2012 | 5 Apr 2025 | 5 Apr 2025 |
| 685 | bakerfuniture.com | GoDaddy.com, LLC | 12 Apr 2023 | 27 Apr 2024 | 12 Apr 2025 |
| 686 | bakerscandc.com | GoDaddy.com, LLC | 23 Jun 1997 | 29 Aug 2022 | 22 Jun 2025 |
| 687 | bakers-exchange.com | - | 26 Jan 2023 | 20 Jan 2025 | 26 Jan 2026 |
| 688 | bakerwatches.com | Key-Systems GmbH | 21 Sep 2015 | 21 Sep 2015 | 21 Sep 2016 |
| 689 | bakersthomasville.com | NameCheap, Inc. | 5 Sep 2017 | 6 Aug 2024 | 5 Sep 2025 |
| 690 | bakerysuwaneega.com | Tucows Domains Inc. | 11 Jun 2014 | 11 Jun 2014 | 11 Jun 2017 |
| 691 | bakerdrivetrain.com | Network Solutions, LLC | 18 May 2000 | 19 Mar 2024 | 18 May 2029 |
| 692 | bakerfuneralhomeofmoultrie.com | GoDaddy.com, LLC | 19 Jul 2011 | 20 Jul 2024 | 19 Jul 2025 |
| 693 | bakertargets.com | Tucows Domains Inc. | 12 Mar 2013 | 25 Feb 2025 | 12 Mar 2026 |
| 694 | bakerylasvegas.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Nov 2007 | 12 Mar 2015 | 17 Nov 2015 |
| 695 | bakersfieldfinancialplanner.com | GoDaddy.com, LLC | 6 Apr 2007 | 11 Apr 2025 | 6 Apr 2026 |
| 696 | bakersfieldrefinancing.com | GoDaddy.com, LLC | 8 Apr 2007 | 20 Jun 2015 | 8 Apr 2016 |
| 697 | bakersfieldbusinessbroker.com | GoDaddy.com, LLC | 6 Apr 2007 | 7 Apr 2025 | 6 Apr 2027 |
| 698 | bakersfieldinsuranceagent.com | GoDaddy.com, LLC | 6 Apr 2007 | 11 Apr 2025 | 6 Apr 2026 |
| 699 | bakersfieldbusinessbrokers.com | TurnCommerce, Inc. DBA NameBright.com | 28 Oct 2017 | 22 Oct 2020 | 28 Oct 2025 |
| 700 | bakersvilleflowers.com | - | - | - | - |
| 701 | bakerwatersystems.com | GoDaddy.com, LLC | 15 Sep 2011 | 10 Sep 2022 | 15 Sep 2026 |
| 702 | bakeries.us | Uniregistrar Corp | 1 Dec 2016 | 25 Dec 2016 | 30 Nov 2017 |
| 703 | bakersfieldpersonalinjuryattorneys.com | Dynadot6 LLC | 12 Sep 2024 | 12 Sep 2024 | 12 Sep 2025 |
| 704 | bakersfieldpersonalinjurylawyers.com | GoDaddy.com, LLC | 3 Apr 2019 | 4 Apr 2025 | 3 Apr 2026 |
| 705 | bakersbestflour.com | GoDaddy.com, LLC | 18 Oct 2010 | 8 May 2015 | 7 May 2016 |
| 706 | bakerybestflour.com | GoDaddy.com, LLC | 18 Oct 2010 | 8 May 2015 | 7 May 2018 |
| 707 | bakerwrapxp.com | GoDaddy.com, LLC | 20 Dec 2014 | 22 Dec 2014 | 20 Dec 2015 |
| 708 | bakersauto.com | Network Solutions, LLC | 9 Nov 1999 | 10 Sep 2021 | 9 Nov 2026 |
| 709 | bakercountyfl.org | Network Solutions, LLC | 23 May 2001 | 24 Jul 2022 | 23 May 2028 |
| 710 | bakerchevrolet.com | GoDaddy.com, LLC | 28 Dec 2000 | 14 Sep 2022 | 28 Dec 2025 |
| 711 | bakeryschools.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Feb 2006 | 1 Feb 2025 | 8 Feb 2026 |
| 712 | bakerathletic.com | Namesilo, LLC | 5 Apr 2019 | 22 Sep 2019 | 5 Apr 2020 |
| 713 | bakersfieldrealestateagent.com | GoDaddy.com, LLC | 1 Dec 2003 | 9 Dec 2024 | 1 Dec 2025 |
| 714 | bakerlawga.com | register.com, Inc. | 2 Nov 2014 | 20 Oct 2024 | 2 Nov 2026 |
| 715 | bakerhughesalumni.com | GoDaddy.com, LLC | 23 Jan 2017 | 23 Jan 2017 | 23 Jan 2018 |
| 716 | bakerbash.com | Tucows Domains Inc. | 20 Nov 2022 | 31 Jan 2024 | 20 Nov 2023 |
| 717 | bakersfieldeyedoc.com | TLDs LLC dba SRSplus | 28 Jun 2005 | 13 Jun 2024 | 28 Jun 2029 |
| 718 | bakerscartsupply.com | GoDaddy.com, LLC | 30 Nov 2005 | 12 Mar 2025 | 20 May 2027 |
| 719 | bakerpublicrelations.com | GoDaddy.com, LLC | 31 Aug 2007 | 31 Aug 2024 | 31 Aug 2025 |
| 720 | bakersribs.com | Network Solutions, LLC | 5 Jan 1999 | 7 Nov 2024 | 5 Jan 2030 |
| 721 | bakersfieldfamilyattorney.com | NameCheap, Inc. | 3 Dec 2016 | 3 Nov 2024 | 3 Dec 2025 |
| 722 | bakers.cc | CloudFlare, Inc. | 11 Mar 2019 | 20 Apr 2025 | 11 Mar 2025 |
| 723 | bakerskitchen.com | TurnCommerce, Inc. DBA NameBright.com | 21 May 2001 | 11 Jul 2021 | 21 May 2025 |
| 724 | bakersfieldblog.com | Fabulous.com Pty Ltd. | 14 Apr 2016 | 6 Dec 2016 | 14 Apr 2018 |
| 725 | bakeryummy.com | GoDaddy.com, LLC | 7 Aug 2013 | 18 Jul 2024 | 7 Aug 2025 |
| 726 | bakertransmission.com | GoDaddy.com, LLC | 3 May 2022 | 3 May 2022 | 3 May 2023 |
| 727 | bakersfieldmoldremoval.com | NameCheap, Inc. | 31 Mar 2023 | 26 Mar 2025 | 31 Mar 2026 |
| 728 | bakerbook.com | GoDaddy.com, LLC | 27 Nov 2004 | 29 Nov 2024 | 27 Nov 2025 |
| 729 | bakersignsandgraphics.net | Tucows Domains Inc. | 28 Oct 2011 | 1 Nov 2014 | 28 Oct 2015 |
| 730 | bakerstreetboz.com | Internet Domain Services BS Corp | 18 May 2021 | 18 May 2021 | 18 May 2022 |
| 731 | bakerbrandcommunications.com | Tucows Domains Inc. | 4 Jun 2012 | 8 Jun 2015 | 4 Jun 2016 |
| 732 | bakersfieldasianescort.com | Domain.com, LLC | 9 Jun 2011 | 12 Jun 2015 | 9 Jun 2016 |
| 733 | bakersfieldasianescorts.com | Domain.com, LLC | 9 Jun 2011 | 12 Jun 2015 | 9 Jun 2016 |
| 734 | bakerycloud.com | GoDaddy.com, LLC | 7 Jul 2011 | 24 Dec 2024 | 7 Jul 2025 |
| 735 | bakerymyanmar.com | GoDaddy.com, LLC | 14 Aug 2013 | 2 May 2015 | 14 Aug 2015 |
| 736 | bakeryyangon.com | GoDaddy.com, LLC | 14 Aug 2013 | 14 Aug 2013 | 14 Aug 2015 |
| 737 | bakertv.com | TurnCommerce, Inc. DBA NameBright.com | 3 Dec 2017 | 27 Nov 2020 | 3 Dec 2025 |
| 738 | bakerysonganh.com | - | - | - | - |
| 739 | bakeryclass.com | GoDaddy.com, LLC | 8 Aug 2011 | 9 Mar 2025 | 8 Aug 2025 |
| 740 | bakersprolawnraleigh.com | eNom, Inc. | 12 Jun 2013 | 13 Jun 2015 | 12 Jun 2016 |
| 741 | bakersfieldmortgagelenders.com | eNom, Inc. | 12 Jun 2014 | 13 Jun 2015 | 12 Jun 2016 |
| 742 | bakerlaw-az.com | enom451, Incorporated | 13 Apr 2024 | 15 Apr 2025 | 13 Apr 2026 |
| 743 | bakersfieldcalifornian.com | GoDaddy.com, LLC | 1 Dec 1998 | 1 Dec 2024 | 30 Nov 2025 |
| 744 | bakersfieldcity.info | Dynadot, LLC | 20 Mar 2007 | 20 Mar 2025 | 20 Mar 2026 |
| 745 | bakersfieldcondors.com | GoDaddy.com, LLC | 2 Jul 1998 | 1 Jul 2024 | 1 Jul 2025 |
| 746 | bakercityherald.com | GoDaddy.com, LLC | 10 Aug 1998 | 9 Aug 2024 | 9 Aug 2025 |
| 747 | bakersfieldspeedway.com | GKG.NET, INC. | 18 Jan 2000 | 20 Dec 2024 | 18 Jan 2026 |
| 748 | bakerauction.com | GoDaddy.com, LLC | 28 Jan 2000 | 1 Oct 2022 | 28 Jan 2027 |
| 749 | bakercity.net | Dynadot, LLC | 11 Apr 2007 | 12 Apr 2025 | 11 Apr 2026 |
| 750 | bakeras.com | GoDaddy.com, LLC | 15 Jun 2004 | 2 Sep 2022 | 15 Jun 2026 |
| 751 | bakerbonnigson.com | Above.com Pty Ltd. | 22 Mar 2002 | 5 Mar 2023 | 22 Mar 2026 |
| 752 | bakerchapel.org | NameCheap, Inc. | 17 Feb 2025 | 12 Mar 2025 | 17 Feb 2026 |
| 753 | bakercity.com | Network Solutions, LLC | 9 May 1997 | 14 May 2024 | 10 May 2029 |
| 754 | bakercountyteaparty.org | - | - | - | - |
| 755 | bakerfuneralberea.com | GoDaddy.com, LLC | 7 Jul 2009 | 8 Jul 2024 | 7 Jul 2025 |
| 756 | bakersfieldads.net | Domain.com, LLC | 27 Apr 2010 | 7 Apr 2025 | 27 Apr 2026 |
| 757 | bakersfieldcityacc.us | - | - | - | - |
| 758 | bakersfieldfreeways.us | GoDaddy.com, LLC | 13 Jan 2006 | 13 Jan 2017 | 12 Jan 2019 |
| 759 | bakersfieldhouseinvesting.com | GoDaddy.com, LLC | 26 Nov 2012 | 8 Dec 2014 | 26 Nov 2015 |
| 760 | bakerspride.com | Nom-iq Ltd. dba COM LAUDE | 10 Dec 1996 | 9 Mar 2025 | 9 Dec 2026 |
| 761 | bakerstevensparramore.com | GoDaddy.com, LLC | 27 Jan 2010 | 2 Apr 2024 | 27 Jan 2026 |
| 762 | bakerynouveau.com | register.com, Inc. | 16 Nov 2006 | 16 Aug 2021 | 16 Nov 2026 |
| 763 | bakeryproductions.com | Google, Inc. | 13 Jul 2023 | 28 Jun 2024 | 13 Jul 2025 |
| 764 | bakerite.co | GoDaddy.com, LLC | 7 Jun 2011 | 12 Jun 2015 | 6 Jun 2015 |
| 765 | bakerite.org | - | 13 May 2023 | 19 Jul 2024 | 13 May 2024 |
| 766 | bakersfieldteas.com | GoDaddy.com, LLC | 6 Jun 2014 | 7 Jun 2015 | 6 Jun 2016 |
| 767 | bakershusband.com | FastDomain Inc. | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 768 | bakerblues.com | GoDaddy.com, LLC | 21 Mar 2000 | 6 Jul 2024 | 5 Aug 2026 |
| 769 | bakerindustries.org | Network Solutions, LLC | 22 Aug 2000 | 6 Oct 2024 | 22 Aug 2025 |
| 770 | bakerboyzracing.com | GoDaddy.com, LLC | 6 Jun 2012 | 7 Jun 2015 | 6 Jun 2016 |
| 771 | bakerssquare-eclub.com | GoDaddy.com, LLC | 3 Feb 2025 | 10 Feb 2025 | 3 Feb 2026 |
| 772 | bakerite.biz | GoDaddy.com, LLC | 7 Jun 2011 | 7 Jun 2015 | 6 Jun 2015 |
| 773 | bakerite.mobi | GoDaddy.com, LLC | 7 Jun 2011 | 8 Jun 2015 | 7 Jun 2016 |
| 774 | bakersfieldspca.org | Network Solutions, LLC | 25 Mar 1999 | 17 Feb 2025 | 25 Mar 2028 |
| 775 | bakerite.info | NameCheap, Inc. | 23 Feb 2024 | 6 Apr 2025 | 23 Feb 2025 |
| 776 | baker-thompson.com | GoDaddy.com, LLC | 8 Jun 2012 | 8 Jun 2015 | 8 Jun 2016 |
| 777 | bakerpostfh.com | GoDaddy.com, LLC | 5 Feb 2008 | 9 Feb 2025 | 5 Feb 2027 |
| 778 | bakersfield.org | GoDaddy.com, LLC | 20 Apr 1999 | 21 Apr 2025 | 20 Apr 2026 |
| 779 | bakersfieldtrackclub.com | enom467, Incorporated | 21 Apr 2025 | 21 Apr 2025 | 21 Apr 2026 |
| 780 | bakersup.com | Namesilo, LLC | 7 Sep 2020 | 7 Sep 2020 | 7 Sep 2021 |
| 781 | bakeryclasses.com | NameKing.com Inc. | 20 Jan 2021 | 28 Feb 2025 | 20 Jan 2026 |
| 782 | bakerhometour.com | GoDaddy.com, LLC | 2 Nov 2014 | 17 Sep 2022 | 2 Nov 2031 |
| 783 | bakersbakery.biz | Namesilo, LLC | 1 Dec 2016 | 19 Mar 2025 | 30 Nov 2025 |
| 784 | bakersfieldgasprices.com | GoDaddy.com, LLC | 28 Jul 2000 | 1 Aug 2023 | 28 Jul 2026 |
| 785 | bakerbuilt.com | GoDaddy.com, LLC | 18 Jun 1997 | 17 Jun 2024 | 17 Jun 2025 |
| 786 | bakerysystem.net | GoDaddy.com, LLC | 9 Jun 2014 | 10 Jun 2015 | 9 Jun 2016 |
| 787 | bakerhughes.jobs | Name Share, Inc. | 27 Jul 2011 | 21 Mar 2016 | 27 Jul 2016 |
| 788 | bakerbaran.com | GoDaddy.com, LLC | 8 Jun 2012 | 8 Jun 2015 | 8 Jun 2016 |
| 789 | bakerstreetreviews.com | Namesilo, LLC | 27 Aug 2015 | 31 Jul 2017 | 27 Aug 2017 |
| 790 | bakersfield.jobs | Name Share, Inc. | 23 Aug 2024 | 23 Aug 2024 | 23 Aug 2025 |
| 791 | bakerfuneral.com | GoDaddy.com, LLC | 24 Mar 2006 | 28 Feb 2025 | 24 Mar 2027 |
| 792 | bakersdrivethru.com | Network Solutions, LLC | 5 Sep 1997 | 19 Aug 2023 | 4 Sep 2028 |
| 793 | bakerstuartmd.net | register.com, Inc. | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2015 |
| 794 | bakerauto.net | Google, Inc. | 26 Oct 2022 | 27 Oct 2023 | 26 Oct 2024 |
| 795 | bakerroadcarworks.com | GoDaddy.com, LLC | 10 Jun 2013 | 11 Jun 2015 | 10 Jun 2016 |
| 796 | bakerchiropractic.org | GoDaddy.com, LLC | 11 May 2006 | 13 Feb 2025 | 11 May 2026 |
| 797 | bakerandolive.com | GoDaddy.com, LLC | 25 Oct 2009 | 26 Oct 2024 | 25 Oct 2025 |
| 798 | bakeryingredients.net | GoDaddy.com, LLC | 10 Jun 2014 | 11 Jun 2015 | 10 Jun 2016 |
| 799 | bakersfieldsportsnet.us | GoDaddy.com, LLC | 12 Jun 2014 | 12 Jun 2014 | 11 Jun 2015 |
| 800 | bakersfieldsportsnetwork.net | GoDaddy.com, LLC | 12 Jun 2014 | 12 Jun 2015 | 12 Jun 2016 |
| 801 | bakersfieldfinancial.org | GoDaddy.com, LLC | 11 Jun 2013 | 23 Jun 2015 | 11 Jun 2016 |
| 802 | bakersfieldsportsnet.com | GoDaddy.com, LLC | 12 Jun 2014 | 12 Jun 2015 | 12 Jun 2016 |
| 803 | bakersfieldsports.net | GoDaddy.com, LLC | 12 Jun 2014 | 12 Jun 2015 | 12 Jun 2016 |
| 804 | bakersfieldsportsnetwork.us | GoDaddy.com, LLC | 12 Jun 2014 | 12 Jun 2014 | 11 Jun 2015 |
| 805 | bakerlionspride.com | eNom, Inc. | 11 May 2008 | 9 Apr 2025 | 11 May 2026 |
| 806 | bakerelectricsolar.com | Network Solutions, LLC | 15 Jan 2008 | 3 Feb 2023 | 15 Jan 2026 |
| 807 | bakersfieldsportsnetwork.com | GoDaddy.com, LLC | 7 Jan 2022 | 7 Jan 2022 | 7 Jan 2023 |
| 808 | bakerycakebox.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 24 Nov 2023 | 25 Nov 2024 | 24 Nov 2025 |
| 809 | bakeraw.com | NameCheap, Inc. | 24 Sep 2024 | 24 Sep 2024 | 24 Sep 2025 |
| 810 | bakerchocolatefactory-apts.com | Net-Chinese Co., Ltd. | 25 Jul 2022 | 25 Jul 2022 | 25 Jul 2023 |
| 811 | bakerlumberco.com | Key-Systems GmbH | 26 Nov 2022 | 8 Feb 2024 | 26 Nov 2023 |
| 812 | bakermaid.com | Tucows Domains Inc. | 28 Jun 2010 | 14 Jun 2024 | 28 Jun 2025 |
| 813 | bakersfieldobserved.com | eNom, Inc. | 24 Dec 2008 | 18 Dec 2024 | 24 Dec 2025 |
| 814 | bakerholtz.com | GoDaddy.com, LLC | 23 Apr 2012 | 1 May 2024 | 23 Apr 2027 |
| 815 | bakersfieldhighschool.org | GoDaddy.com, LLC | 5 Sep 2007 | 10 Jul 2024 | 5 Sep 2025 |
| 816 | bakersfieldeyeinstitute.com | GoDaddy.com, LLC | 11 Feb 2007 | 12 Feb 2025 | 11 Feb 2030 |
| 817 | bakermontana.us | GoDaddy.com, LLC | 27 Jun 2013 | 17 Jun 2024 | 26 Jun 2025 |
| 818 | bakerprecision.com | Network Solutions, LLC | 18 Jun 1998 | 5 Oct 2023 | 17 Jun 2025 |
| 819 | bakercoa.org | Porkbun, LLC | 4 Apr 2011 | 12 Nov 2024 | 4 Apr 2028 |
| 820 | bakerheritagemuseum.com | Network Solutions, LLC | 14 Mar 2008 | 13 Jan 2025 | 14 Mar 2026 |
| 821 | bakerynearme.org | Internet Domain Services BS Corp | 19 Nov 2014 | 20 Mar 2016 | 19 Nov 2017 |
| 822 | bakerandsons.com | eNom, Inc. | 16 Aug 2000 | 17 Jul 2024 | 16 Aug 2029 |
| 823 | bakerresidential.com | GoDaddy.com, LLC | 5 Mar 2003 | 6 Mar 2025 | 5 Mar 2026 |
| 824 | bakersfieldjetcenter.com | Network Solutions, LLC | 20 Dec 2007 | 21 Oct 2023 | 20 Dec 2025 |
| 825 | bakersfield-propertymanager.com | GoDaddy.com, LLC | 8 Mar 2010 | 9 Mar 2025 | 8 Mar 2026 |
| 826 | bakersfieldmedicalgroup.org | Network Solutions, LLC | 17 Sep 2013 | 8 Jan 2015 | 17 Sep 2016 |
| 827 | bakersfieldaidsproject.org | GoDaddy.com, LLC | 15 Jun 2006 | 10 Jun 2024 | 15 Jun 2025 |
| 828 | bakersfieldhearthospital.com | Brandsight, Inc. | 27 Jun 2000 | 22 Oct 2024 | 27 Jun 2026 |
| 829 | bakerspeppers.com | - | 22 Dec 2024 | 26 Dec 2024 | 22 Dec 2025 |
| 830 | bakershow.com | GoDaddy.com, LLC | 7 May 2013 | 8 May 2024 | 7 May 2026 |
| 831 | bakertirellc.com | eNom, Inc. | 5 Sep 2013 | 7 Aug 2024 | 5 Sep 2025 |
| 832 | bakerphotography.co | GoDaddy.com, LLC | 24 Jun 2011 | 5 Jul 2024 | 23 Jun 2025 |
| 833 | bakerandspicebakery.com | GMO Internet Inc. | 21 Dec 2016 | 18 Nov 2024 | 21 Dec 2025 |
| 834 | bakeryrepair.com | GoDaddy.com, LLC | 2 Sep 1999 | 3 Sep 2024 | 2 Sep 2025 |
| 835 | bakersfieldhomeking.com | GoDaddy.com, LLC | 1 Jun 2011 | 2 Jun 2023 | 1 Jun 2025 |
| 836 | bakerburg.org | GoDaddy.com, LLC | 5 Mar 2008 | 16 Apr 2025 | 5 Mar 2025 |
| 837 | bakersrackshack.com | GoDaddy.com, LLC | 4 Dec 2006 | 16 Apr 2015 | 4 Dec 2015 |
| 838 | bakersfieldcity.mobi | GoDaddy.com, LLC | 13 Aug 2007 | 27 Sep 2024 | 13 Aug 2026 |
| 839 | baker-online.com | Network Solutions, LLC | 13 Nov 1996 | 14 Oct 2024 | 12 Nov 2025 |
| 840 | bakermetalworksfl.com | GoDaddy.com, LLC | 5 Jan 2006 | 2 Sep 2024 | 5 Jan 2026 |
| 841 | bakerbluminfamilytree.com | pair Networks, Inc. d/b/a pairNIC | 8 Jun 2004 | 24 May 2024 | 8 Jun 2029 |
| 842 | bakerelections.com | GoDaddy.com, LLC | 19 Jan 2007 | 4 Sep 2022 | 19 Jan 2032 |
| 843 | bakerpartsandtowing.com | eNom, Inc. | 26 Sep 2014 | 11 Feb 2015 | 26 Sep 2015 |
| 844 | bakeraecom.com | DropCatch.com 555 LLC | 28 Aug 2019 | 28 Aug 2019 | 28 Aug 2020 |
| 845 | baker-miller.com | GoDaddy.com, LLC | 19 Feb 2003 | 20 Feb 2025 | 19 Feb 2028 |
| 846 | bakersfiedlcalifornian.com | - | - | - | - |
| 847 | bakersguide.com | CloudFlare, Inc. | 1 Dec 1999 | 22 Nov 2024 | 1 Dec 2025 |
| 848 | bakerzbella.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Aug 2017 | 22 Aug 2017 | 22 Aug 2018 |
| 849 | bakervu.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 850 | bakerspress.com | GoDaddy.com, LLC | 4 Nov 2014 | 15 Jan 2025 | 4 Nov 2024 |
| 851 | bakersfieldnotarypublic.com | eNom, Inc. | 6 Apr 2015 | 8 Mar 2025 | 6 Apr 2026 |
| 852 | bakersfieldelderlawyer.com | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2016 |
| 853 | bakerscornerpizza.com | DropCatch.com 1534 LLC | 7 Nov 2023 | 18 Dec 2024 | 7 Nov 2024 |
| 854 | bakerlocator.com | GoDaddy.com, LLC | 25 Jun 2022 | 24 May 2024 | 25 Jun 2025 |
| 855 | bakerkendallbash.com | register.com, Inc. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 856 | bakerexcavatingandhauling.com | GoDaddy.com, LLC | 24 Jan 2020 | 24 Jan 2020 | 24 Jan 2021 |
| 857 | bakerchina.com | - | 26 Jun 2024 | 26 Jun 2024 | 26 Jun 2025 |
| 858 | bakerandcoe.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 3 Nov 2014 | 13 Oct 2017 | 3 Nov 2018 |
| 859 | bakerssquare.jobs | Name.com, Inc. | 10 Jul 2013 | 10 Jul 2022 | 10 Jul 2023 |
| 860 | bakersbesthealth.com | Network Solutions, LLC | 3 Jan 2008 | 4 Nov 2024 | 3 Jan 2026 |
| 861 | bakerracingengines.com | GoDaddy.com, LLC | 21 Dec 2007 | 22 Dec 2024 | 21 Dec 2025 |
| 862 | bakersfieldpetfoodpantry.org | Network Solutions, LLC | 8 Dec 2009 | 16 May 2024 | 8 Dec 2026 |
| 863 | bakerfloral.com | MarkMonitor Inc. | 7 Nov 2002 | 6 Oct 2024 | 7 Nov 2025 |
| 864 | bakerpetroleumde.com | GoDaddy.com, LLC | 4 Mar 2010 | 27 Feb 2025 | 4 Mar 2026 |
| 865 | bakersfieldrugs.com | Network Solutions, LLC | 23 Feb 2000 | 25 Dec 2022 | 23 Feb 2026 |
| 866 | bakerancestry.org | eNom, Inc. | 21 Feb 2010 | 23 Jan 2022 | 21 Feb 2026 |
| 867 | bakersfieldvoice.com | GoDaddy.com, LLC | 28 Dec 2006 | 28 Dec 2024 | 28 Dec 2025 |
| 868 | bakerhometour.org | GoDaddy.com, LLC | 2 Nov 2014 | 29 Oct 2016 | 2 Nov 2018 |
| 869 | bakersfieldchristian.com | GoDaddy.com, LLC | 19 Jul 1999 | 20 Jul 2023 | 19 Jul 2031 |
| 870 | bakersfieldccc.org | Tucows Domains Inc. | 24 Sep 2013 | 14 Sep 2024 | 24 Sep 2025 |
| 871 | bakersfielddba.com | Launchpad, Inc. | 4 Apr 2007 | 20 Mar 2025 | 4 Apr 2026 |
| 872 | baker-street-studios.com | NameCheap, Inc. | 11 Nov 2004 | 17 Sep 2024 | 11 Nov 2025 |
| 873 | bakersamerican.com | GoDaddy.com, LLC | 25 May 2010 | 26 May 2024 | 25 May 2025 |
| 874 | bakersjournal.com | Tucows Domains Inc. | 3 Dec 1999 | 4 Nov 2024 | 3 Dec 2025 |
| 875 | bakersfieldmemorial.org | Network Solutions, LLC | 1 Aug 2003 | 19 Jun 2023 | 1 Aug 2026 |
| 876 | bakernorth.com | Tucows Domains Inc. | 16 Feb 2025 | 16 Feb 2025 | 16 Feb 2026 |
| 877 | bakerfacts.com | Cloud Yuqu LLC | 4 Aug 2020 | 4 Aug 2020 | 4 Aug 2021 |
| 878 | bakermfginc.com | Tucows Domains Inc. | 19 Mar 1999 | 19 Mar 2025 | 19 Mar 2026 |
| 879 | bakershardware.com | register.com, Inc. | 30 Jan 1999 | 31 Jan 2025 | 30 Jan 2026 |
| 880 | bakersrackdealers.com | GoDaddy.com, LLC | 22 May 2019 | 22 May 2019 | 22 May 2020 |
| 881 | bakerscyst.com | GoDaddy.com, LLC | 15 Nov 2001 | 16 Nov 2024 | 15 Nov 2025 |
| 882 | bakersandartists.com | GoDaddy.com, LLC | 20 Oct 2010 | 21 Oct 2024 | 20 Oct 2025 |
| 883 | bakersfieldrestaurant.com | NameCheap, Inc. | 24 Apr 2008 | 25 Apr 2025 | 24 Apr 2026 |
| 884 | bakersvillagegardencenter.com | GoDaddy.com, LLC | 8 Feb 2007 | 9 Feb 2025 | 8 Feb 2026 |
| 885 | bakerfhvc.com | GoDaddy.com, LLC | 30 Mar 2011 | 28 Feb 2025 | 30 Mar 2026 |
| 886 | bakerartistawards.org | Internet Domain Services BS Corp | 12 May 2008 | 14 Apr 2025 | 12 May 2026 |
| 887 | bakersdozeh.com | Annulet LLC | 31 Aug 2011 | 7 Jul 2016 | 31 Aug 2017 |
| 888 | bakersfieldgrocerydelivery.com | GoDaddy.com, LLC | 16 Jun 2011 | 15 Jun 2024 | 16 Jun 2025 |
| 889 | bakerfuneralservice.com | GoDaddy.com, LLC | 10 Nov 2005 | 11 Nov 2024 | 10 Nov 2025 |
| 890 | bakerimplement.com | Brandsight, Inc. | 2 Mar 2000 | 30 Jan 2025 | 2 Mar 2026 |
| 891 | bakeryunlimitedtoledo.com | GoDaddy.com, LLC | 1 Apr 2009 | 6 Apr 2025 | 1 Apr 2026 |
| 892 | bakersfieldalterations.com | Wild West Domains, LLC | 31 Oct 2011 | 1 Nov 2024 | 31 Oct 2025 |
| 893 | bakerautopartsmi.com | GoDaddy.com, LLC | 3 Mar 2006 | 18 Oct 2022 | 3 Mar 2029 |
| 894 | bakerytop.com | Flappy Domain, Inc | 4 May 2017 | 26 Aug 2017 | 4 May 2018 |
| 895 | bakerystickers.com | GoDaddy.com, LLC | 4 Nov 2014 | 5 Nov 2016 | 4 Nov 2017 |
| 896 | bakerylabel.com | GoDaddy.com, LLC | 3 Jan 2023 | 30 Dec 2024 | 3 Jan 2026 |
| 897 | bakeryearendcloseout.com | GoDaddy.com, LLC | 4 Nov 2014 | 5 Nov 2016 | 4 Nov 2017 |
| 898 | bakerybkk.com | GoDaddy.com, LLC | 1 Aug 2023 | 13 Oct 2024 | 1 Aug 2024 |
| 899 | bakery7.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Dec 2024 | 11 Dec 2024 | 9 Dec 2025 |
| 900 | bakersfieldwelcomeservice.com | Amazon Registrar, Inc. | 4 Nov 2014 | 1 Oct 2024 | 4 Nov 2025 |
| 901 | bakersfieldbrew.com | GoDaddy.com, LLC | 18 Mar 2021 | 30 May 2023 | 18 Mar 2023 |
| 902 | bakerrecord.com | GoDaddy.com, LLC | 1 Apr 2016 | 1 Apr 2016 | 1 Apr 2017 |
| 903 | bakerbonningson.com | GoDaddy.com, LLC | 21 Apr 2021 | 3 Jul 2023 | 21 Apr 2023 |
| 904 | baker2018.com | NameCheap, Inc. | 5 Nov 2014 | 8 Jan 2018 | 5 Nov 2020 |
| 905 | bakersfieldeconomicsclub.com | GoDaddy.com, LLC | 12 Jun 2012 | 13 Jun 2015 | 12 Jun 2016 |
| 906 | bakerelectric.org | Name.com, Inc. | 30 Aug 2015 | 13 Aug 2024 | 30 Aug 2025 |
| 907 | bakersfieldhousefinder.com | GoDaddy.com, LLC | 14 Sep 2017 | 15 Sep 2023 | 14 Sep 2025 |
| 908 | bakersfieldeconomicsclub.org | GoDaddy.com, LLC | 12 Jun 2012 | 24 Jun 2015 | 12 Jun 2016 |
| 909 | bakeryparadise.info | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 910 | bakerrecord.info | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 911 | bakersbay-condos.com | GoDaddy.com, LLC | 13 Jun 2014 | 14 Jun 2015 | 13 Jun 2016 |
| 912 | bakersfieldunits.com | GoDaddy.com, LLC | 15 Jun 2013 | 15 Jun 2015 | 15 Jun 2016 |
| 913 | bakersfielddentist.org | GoDaddy.com, LLC | 14 Jun 2010 | 9 Apr 2025 | 14 Jun 2025 |
| 914 | baker-dish.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 915 | baker-fam.net | Tucows Domains Inc. | 15 Aug 2013 | 19 Aug 2014 | 15 Aug 2015 |
| 916 | bakerbostonrealtygroup.com | GoDaddy.com, LLC | 18 Aug 2014 | 30 Oct 2024 | 18 Aug 2024 |
| 917 | bakerenergysolutions.com | 1&1 Internet AG | 18 Aug 2014 | 15 Feb 2018 | 18 Aug 2025 |
| 918 | bakerrecipe.com | Hostinger, UAB | 21 Oct 2024 | 21 Dec 2024 | 21 Oct 2025 |
| 919 | bakersfieldcolonics.com | GoDaddy.com, LLC | 7 Nov 2021 | 10 Aug 2024 | 7 Nov 2025 |
| 920 | bakersfieldpatio.com | TurnCommerce, Inc. DBA NameBright.com | 18 Aug 2014 | 26 Jul 2022 | 18 Aug 2025 |
| 921 | bakersfieldpatios.com | Tucows Domains Inc. | 18 Aug 2014 | 20 Jul 2024 | 18 Aug 2025 |
| 922 | bakersriseup.com | Wild West Domains, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 923 | bakerysupplies.info | GoDaddy.com, LLC | 18 Aug 2014 | 19 Aug 2017 | 18 Aug 2018 |
| 924 | bakersfieldhealthexchange.com | GoDaddy.com, LLC | 14 Jun 2013 | 15 Jun 2015 | 14 Jun 2016 |
| 925 | bakersfieldtherapist.com | - | 25 May 2021 | 23 Jun 2024 | 25 May 2025 |
| 926 | bakeryimage.com | GoDaddy.com, LLC | 15 Jun 2014 | 15 Jun 2015 | 15 Jun 2016 |
| 927 | bakerlemke.com | GoDaddy.com, LLC | 15 Jun 2014 | 16 Jun 2015 | 15 Jun 2016 |
| 928 | bakeryville.us | GoDaddy.com, LLC | 16 Jun 2011 | 16 Jun 2013 | 15 Jun 2015 |
| 929 | bakersfieldfamilylawattorney.com | 1&1 Internet AG | 5 Oct 2023 | 11 Dec 2023 | 5 Oct 2025 |
| 930 | bakersfieldsafehalloween.com | EvoPlus Ltd. | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 931 | bakeryville.info | GoDaddy.com, LLC | 16 Jun 2011 | 16 Jun 2015 | 16 Jun 2016 |
| 932 | bakeryville.org | GoDaddy.com, LLC | 16 Jun 2011 | 28 Jun 2015 | 16 Jun 2016 |
| 933 | bakeryville.mobi | GoDaddy.com, LLC | 16 Jun 2011 | 17 Jun 2015 | 16 Jun 2016 |
| 934 | bakerstreetsweets.com | FastDomain Inc. | 9 Jun 2020 | 9 Jun 2020 | 9 Jun 2021 |
| 935 | bakeryville.net | GoDaddy.com, LLC | 16 Jun 2011 | 17 Jun 2015 | 16 Jun 2016 |
| 936 | bakersfieldpoolservices.com | - | 1 Jan 2025 | 1 Jan 2025 | 1 Jan 2026 |
| 937 | bakerohana.com | GoDaddy.com, LLC | 18 Jun 2014 | 18 Jun 2015 | 18 Jun 2016 |
| 938 | bakersfield-pestcontrol.com | GoDaddy.com, LLC | 13 Jul 2018 | 14 Jul 2024 | 13 Jul 2025 |
| 939 | bakercbhs.org | - | - | - | - |
| 940 | bakergirlbakes.com | GoDaddy.com, LLC | 19 Jun 2014 | 20 Jun 2015 | 19 Jun 2016 |
| 941 | bakerautopartsmichigan.net | Tucows Domains Inc. | 20 Aug 2014 | 24 Aug 2015 | 20 Aug 2016 |
| 942 | bakerdynastynow.com | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 943 | bakersadvies.com | Key-Systems GmbH | 19 Aug 2014 | 18 Aug 2017 | 19 Aug 2018 |
| 944 | bakersfieldaddictiontreatment.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2024 | 20 Aug 2025 |
| 945 | bakersfieldusedautos.com | Amazon Registrar, Inc. | 18 Nov 2019 | 15 Oct 2024 | 18 Nov 2025 |
| 946 | bakersprojects.com | Hosting Concepts B.V. dba Openprovider | 19 Aug 2014 | 26 Apr 2025 | 19 Aug 2025 |
| 947 | bakeryorganics.com | NameCheap, Inc. | 5 Dec 2021 | 15 Feb 2024 | 5 Dec 2023 |
| 948 | bakerholics.com | GoDaddy.com, LLC | 19 Jun 2014 | 20 Jun 2015 | 19 Jun 2016 |
| 949 | bakersracksfunstore.com | GoDaddy.com, LLC | 19 Jun 2008 | 20 Jun 2015 | 19 Jun 2016 |
| 950 | bakerysora.com | Japan Registry Services Co., Ltd. | 6 Nov 2014 | 4 Nov 2024 | 6 Nov 2025 |
| 951 | bakerysky.com | Tucows Domains Inc. | 16 Feb 2021 | 20 Feb 2023 | 16 Feb 2024 |
| 952 | bakerybus.com | GoDaddy.com, LLC | 28 Jul 2018 | 28 Jul 2024 | 28 Jul 2025 |
| 953 | bakerstore.com | - | 21 Jan 2025 | 21 Jan 2025 | 21 Jan 2026 |
| 954 | bakersfieldwingchun.com | FastDomain Inc. | 5 Nov 2014 | 13 Mar 2016 | 5 Nov 2017 |
| 955 | bakersfieldcalfornian.com | Fabulous.com Pty Ltd. | 18 Oct 2005 | 19 Oct 2017 | 18 Oct 2017 |
| 956 | bakersandbutchers.com | PSI-USA, Inc. dba Domain Robot | 5 Nov 2014 | 25 Dec 2024 | 5 Nov 2025 |
| 957 | bakerportland.com | Register.it SPA | 5 Nov 2014 | 28 Oct 2024 | 5 Nov 2026 |
| 958 | bakercountrykitchen.com | GoDaddy.com, LLC | 5 Feb 2018 | 10 Feb 2020 | 5 Feb 2020 |
| 959 | bakerblackangus.com | GoDaddy.com, LLC | 17 Dec 2020 | 17 Dec 2020 | 17 Dec 2021 |
| 960 | bakeryplanet.ca | - | - | - | - |
| 961 | bakerfloorsanding.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 962 | bakersfieldtrees.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 963 | bakeryouth.com | TurnCommerce, Inc. DBA NameBright.com | 11 Sep 2016 | 21 Oct 2024 | 11 Sep 2024 |
| 964 | bakerconstructionjoplin.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 965 | bakerdev.com | TurnCommerce, Inc. DBA NameBright.com | 13 Sep 2016 | 21 Aug 2020 | 13 Sep 2025 |
| 966 | bakerenterprisellc.com | Automattic Inc. | 9 Jun 2022 | 20 May 2024 | 9 Jun 2025 |
| 967 | bakernj.com | GoDaddy.com, LLC | 24 Jun 2015 | 18 Sep 2022 | 24 Jun 2025 |
| 968 | bakerspondorganicdairy.com | register.com, Inc. | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 969 | bakersq.com | GoDaddy.com, LLC | 4 Dec 2024 | 4 Dec 2024 | 4 Dec 2027 |
| 970 | bakeryinma.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 971 | bakerycastle.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 972 | bakerrecord.net | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 973 | bakerandrhodesattorneysatlaw.com | Tucows Domains Inc. | 17 Aug 2010 | 20 Aug 2014 | 17 Aug 2015 |
| 974 | bakerfitness.net | Squarespace Domains LLC | 30 May 2022 | 29 Jun 2024 | 30 May 2024 |
| 975 | bakergreene.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2024 | 20 Aug 2025 |
| 976 | bakerhomes.info | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 977 | bakersbodyshop.com | - | 27 Sep 2016 | 27 Sep 2016 | 27 Sep 2017 |
| 978 | bakersfieldcarinsurancequotes.net | eNom, Inc. | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 979 | bakersfieldlibrary.org | eNom, Inc. | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 980 | bakersfieldnobankqualifyhomes.com | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 981 | bakersfieldpropertydeals.com | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 982 | bakersfieldseo.org | Dynadot, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 983 | bakersfitness.com | Tucows Domains Inc. | 9 Sep 2018 | 25 Aug 2024 | 9 Sep 2025 |
| 984 | bakershomefurniture.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2024 | 20 Aug 2026 |
| 985 | bakertillygreece.com | Papaki Ltd. | 20 Aug 2014 | 20 Aug 2024 | 20 Aug 2026 |
| 986 | bakertillygreece.net | Papaki Ltd. | 20 Aug 2014 | 20 Aug 2024 | 20 Aug 2025 |
| 987 | bakerwraps.com | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 988 | bakerycrates.com | Launchpad, Inc. | 1 May 2018 | 1 May 2018 | 1 May 2019 |
| 989 | bakerbuildingtx.com | GoDaddy.com, LLC | 2 Aug 2021 | 26 Nov 2024 | 2 Aug 2025 |
| 990 | bakergardner.com | register.com, Inc. | 12 Jan 2015 | 13 Jan 2025 | 12 Jan 2026 |
| 991 | bakerplumbing.com | Domain.com, LLC | 28 Apr 2003 | 2 Aug 2022 | 28 Apr 2026 |
| 992 | bakersfielddigital.com | GoDaddy.com, LLC | 19 Jun 2016 | 19 Jun 2024 | 19 Jun 2025 |
| 993 | bakersfieldhelpwanted.net | NameCheap, Inc. | 24 Nov 2023 | 25 Nov 2024 | 24 Nov 2025 |
| 994 | bakersfieldpressurepros.com | - | - | - | - |
| 995 | bakersfieldrealestatebroker.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 996 | bakersfieldrealestateclub.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 997 | bakerspaintless.com | Tucows Domains Inc. | 16 Apr 2020 | 20 Apr 2023 | 16 Apr 2024 |
| 998 | bakerspluscommunityrewards.com | Network Solutions, LLC | 12 Jan 2015 | 13 Nov 2024 | 12 Jan 2026 |
| 999 | bakerstoothpaste.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 1000 | bakervineyards.com | NameCheap, Inc. | 16 Mar 2020 | 16 Jan 2022 | 16 Mar 2027 |
Displaying 1,000 out of 47,468 domains starting with the keyword "BAKER". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=baker
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |