With support for 
Keyword: AUSA
Reverse Whois » KEYWORD [ausa ] { 3,984 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | ausa.org | GoDaddy.com, LLC | 7 Sep 1995 | 21 Oct 2025 | 6 Sep 2026 |
| 2 | ausa.com | GoDaddy.com, LLC | 29 Jul 1997 | 10 Feb 2026 | 28 Jul 2029 |
| 3 | ausa.org.uk | - | 9 May 2000 | 9 Apr 2026 | 9 May 2028 |
| 4 | ausa.parts | Key-Systems, LLC | 1 Jul 2014 | 12 Sep 2024 | 1 Jul 2024 |
| 5 | ausa.xyz | - | 16 Feb 2022 | 17 Feb 2026 | 16 Feb 2027 |
| 6 | ausa.info | One.com A/S | 9 Jun 2025 | 9 Feb 2026 | 9 Jun 2026 |
| 7 | ausa.video | eNom, Inc. | 20 Jan 2016 | 10 Jan 2017 | 20 Jan 2018 |
| 8 | ausa.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Mar 2016 | - | 1 Mar 2017 |
| 9 | ausa.net | GoDaddy.com, LLC | 28 Apr 1998 | 27 Apr 2025 | 27 Apr 2026 |
| 10 | ausa.us | Soluciones Corporativas IP, SLU | 22 May 2014 | 21 Apr 2015 | 21 May 2020 |
| 11 | ausa.cat | Nominalia Internet S.L. | 21 Apr 2006 | 5 Jun 2025 | 21 Apr 2026 |
| 12 | ausa.de | - | - | 4 Feb 2026 | - |
| 13 | ausa.org.nz | - | 28 Apr 2002 | 22 Aug 2025 | - |
| 14 | ausa.site | GMO Internet Inc. | 10 Jul 2018 | 10 Jul 2018 | 10 Jul 2019 |
| 15 | ausa.tech | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 11 Nov 2020 | - | 11 Nov 2021 |
| 16 | ausa.co.uk | - | 16 Sep 2018 | 3 Mar 2026 | 16 Sep 2026 |
| 17 | ausa.uk | - | 11 Oct 2022 | 8 Oct 2024 | 11 Oct 2025 |
| 18 | ausa.online | Network Solutions, LLC | 13 Mar 2018 | 13 Mar 2018 | 13 Mar 2019 |
| 19 | ausa.company | Dynadot, LLC | 17 Nov 2022 | 28 Dec 2025 | 17 Nov 2025 |
| 20 | ausa.biz | NameCheap, Inc. | 26 Mar 2019 | 1 Mar 2026 | 26 Mar 2027 |
| 21 | ausa.club | Porkbun, LLC | 18 Jan 2020 | 18 Jan 2020 | 18 Jan 2021 |
| 22 | ausa.center | One.com A/S | 18 Dec 2020 | 18 Dec 2020 | 18 Dec 2021 |
| 23 | ausa.pet | GoDaddy.com, LLC | 4 May 2022 | 4 May 2023 | 4 May 2024 |
| 24 | ausa.cc | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 8 Jul 2023 | 8 Jul 2025 | 8 Jul 2026 |
| 25 | ausa.com.co | GoDaddy.com, LLC | 18 Aug 2011 | 19 Aug 2024 | 17 Aug 2027 |
| 26 | ausa.store | GoDaddy.com, LLC | 24 Sep 2025 | 19 Mar 2026 | 24 Sep 2026 |
| 27 | ausa.business | Dynadot, LLC | 17 Nov 2022 | 1 Jan 2026 | 17 Nov 2026 |
| 28 | ausa.org.au | - | - | 21 Jul 2025 | - |
| 29 | ausa.app | GoDaddy.com, LLC | 16 Jun 2022 | 28 Jul 2025 | 16 Jun 2025 |
| 30 | ausa.army | Google, Inc. | 1 Jul 2021 | 1 Jul 2023 | 1 Jul 2024 |
| 31 | ausa.be | - | 28 Dec 2005 | - | - |
| 32 | ausa.com.pe | - | - | - | - |
| 33 | ausa.com.br | - | 18 Dec 2024 | 13 Jan 2026 | 18 Dec 2026 |
| 34 | ausa.cl | - | 22 Oct 2018 | - | 22 Oct 2026 |
| 35 | ausa.vip | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 1 Jan 2019 | 17 Oct 2025 | 1 Jan 2029 |
| 36 | ausa.dev | GoDaddy.com, LLC | 5 Jul 2020 | 10 Oct 2025 | 5 Jul 2026 |
| 37 | ausa.co.in | GoDaddy.com, LLC | 6 May 2019 | 30 May 2025 | 6 May 2026 |
| 38 | ausa.it | Soluciones Corporativas IP, SLU | 12 Dec 2001 | 11 Dec 2025 | 25 Nov 2026 |
| 39 | ausa.link | Network Solutions, LLC | 18 Sep 2021 | 25 Jul 2024 | 18 Sep 2026 |
| 40 | ausa.lt | - | 8 Aug 2014 | - | 9 Aug 2027 |
| 41 | ausa.news | NameCheap, Inc. | 4 May 2020 | 4 May 2023 | 4 May 2024 |
| 42 | ausa.website | NameCheap, Inc. | 4 Jan 2026 | 1 Feb 2026 | 4 Jan 2027 |
| 43 | ausa.cn | - | 21 Jun 2005 | - | 21 Jun 2026 |
| 44 | ausa.email | Gandi SAS | 24 Jul 2023 | 6 Sep 2024 | 24 Jul 2024 |
| 45 | ausa.org.in | Dynadot, LLC | 30 Nov 2022 | 30 Nov 2023 | 30 Nov 2023 |
| 46 | ausa.co | - | 30 Mar 2014 | 2 Apr 2023 | 29 Mar 2024 |
| 47 | ausa.services | register.com, Inc. | 22 Sep 2023 | 6 Nov 2024 | 22 Sep 2025 |
| 48 | ausa.me | Porkbun, LLC | 13 Oct 2022 | 25 Oct 2023 | 13 Oct 2024 |
| 49 | ausa.express | Namesilo, LLC | 17 Dec 2023 | 23 Jan 2025 | 17 Dec 2024 |
| 50 | ausa.com.pl | - | 10 Jul 2000 | 28 Oct 2025 | 9 Jul 2026 |
| 51 | ausa.ru | - | 17 Mar 2022 | - | 17 Mar 2027 |
| 52 | ausa.su | - | 14 Jul 2014 | - | 14 Jul 2026 |
| 53 | ausa.sk | - | 7 Aug 2019 | 6 Nov 2025 | 7 Aug 2026 |
| 54 | ausa.com.au | - | - | 6 Mar 2026 | - |
| 55 | ausa.nz | - | 26 Mar 2020 | 9 Mar 2026 | - |
| 56 | ausa.se | - | 22 May 2014 | 29 Apr 2025 | 22 May 2026 |
| 57 | ausa.io | Tucows Domains Inc. | 18 Nov 2024 | 16 Mar 2026 | 18 Nov 2026 |
| 58 | ausa.web.id | Reserved | 18 Dec 2024 | - | 18 Dec 2026 |
| 59 | ausa.my.id | Reserved | 18 Dec 2024 | 20 Dec 2025 | 18 Dec 2026 |
| 60 | ausa.global | GoDaddy.com, LLC | 28 Jan 2025 | 14 Mar 2026 | 28 Jan 2027 |
| 61 | ausa.pro | Dynadot, LLC | 15 Feb 2025 | 26 Apr 2026 | 15 Feb 2026 |
| 62 | ausa.fr | OVH sas | 17 Apr 2008 | 16 Dec 2025 | 14 Jul 2026 |
| 63 | ausa.life | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jun 2025 | 6 Aug 2025 | - |
| 64 | ausa.ac | NameCheap, Inc. | 21 Aug 2025 | 26 Aug 2025 | 21 Aug 2027 |
| 65 | ausa.education | Hostinger, UAB | 14 Sep 2025 | - | - |
| 66 | ausa.one | Namesilo, LLC | 19 Dec 2025 | 17 Feb 2026 | 19 Dec 2026 |
| 67 | ausa.work | Automattic Inc. | 1 Feb 2026 | 6 Feb 2026 | 1 Feb 2027 |
| 68 | ausa.info.pl | - | 22 Apr 2025 | 22 Apr 2025 | - |
| 69 | ausa.scot | Tucows Domains Inc. | 11 Mar 2026 | 11 Mar 2026 | 11 Mar 2027 |
| 70 | ausa.ai | GoDaddy.com, LLC | 24 Oct 2024 | 2 Apr 2025 | 24 Oct 2026 |
| 71 | ausa.eus | 1&1 Internet AG | 20 Apr 2026 | 20 Apr 2026 | 20 Apr 2027 |
| 72 | ausangate.net | Hostinger, UAB | 27 Mar 2026 | 27 Mar 2026 | 27 Mar 2027 |
| 73 | ausaserver.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 May 2008 | 9 May 2025 | 15 May 2026 |
| 74 | ausante.com | NameCheap, Inc. | 14 Nov 2008 | 15 Oct 2025 | 14 Nov 2026 |
| 75 | ausairport.com | GoDaddy.com, LLC | 14 Jun 2000 | 29 Nov 2025 | 14 Jun 2026 |
| 76 | ausafe.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Sep 2010 | 6 Sep 2017 | 6 Sep 2018 |
| 77 | ausairpower.net | Melbourne IT, Ltd | 23 Oct 2004 | 19 Oct 2025 | 23 Oct 2028 |
| 78 | ausays.com | NameCheap, Inc. | 27 Mar 2024 | 25 Feb 2026 | 27 Mar 2027 |
| 79 | ausadvertising.com.au | - | - | 18 Aug 2025 | - |
| 80 | ausaf.pk | - | 1 Jan 2013 | - | 1 Jan 2015 |
| 81 | ausaid.gov.au | Department-of-domains, LLC | - | 5 Feb 2014 | - |
| 82 | ausameetings.org | GoDaddy.com, LLC | 4 Aug 2012 | 18 Sep 2025 | 4 Aug 2026 |
| 83 | ausaudit.com | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 28 May 2021 | 1 Apr 2025 | 28 May 2026 |
| 84 | ausacompany.com | NameCheap, Inc. | 26 Jul 2012 | 3 Jul 2025 | 26 Jul 2026 |
| 85 | ausasiaminerals.com | Cloud Yuqu LLC | 25 Mar 2021 | 25 Mar 2021 | 25 Mar 2022 |
| 86 | ausansrival.com | Tucows Domains Inc. | 23 Oct 2014 | 27 Oct 2015 | 23 Oct 2016 |
| 87 | ausablechasm.com | Network Solutions, LLC | 29 Jan 1999 | 30 Nov 2025 | 29 Jan 2027 |
| 88 | ausamarok.com.au | - | - | 28 Jan 2026 | - |
| 89 | ausadmission.in | Dynadot, LLC | 28 May 2023 | 3 Sep 2025 | 28 May 2027 |
| 90 | ausable-cvb.info | GMO Internet Inc. | 5 Apr 2016 | 5 Apr 2016 | 5 Apr 2017 |
| 91 | ausarmanagement.com | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 92 | ausarian.com | GoDaddy.com, LLC | 27 Mar 2019 | 14 Mar 2026 | 27 Mar 2027 |
| 93 | ausabletowing.com | GoDaddy.com, LLC | 24 Oct 2014 | 25 Oct 2025 | 24 Oct 2027 |
| 94 | ausabletowing.info | GoDaddy.com, LLC | 24 Oct 2014 | 8 Dec 2025 | 24 Oct 2027 |
| 95 | ausass.com | DropCatch.com 1390 LLC | 5 Sep 2018 | 5 Sep 2018 | 5 Sep 2019 |
| 96 | ausabletowing.org | GoDaddy.com, LLC | 24 Oct 2014 | 8 Dec 2025 | 24 Oct 2027 |
| 97 | ausabletowing.net | GoDaddy.com, LLC | 24 Oct 2014 | 25 Oct 2025 | 24 Oct 2027 |
| 98 | ausarian.org | Tucows Domains Inc. | 8 Jan 2015 | 22 Feb 2026 | 8 Jan 2027 |
| 99 | ausadian.com | GoDaddy.com, LLC | 11 Jan 2015 | 13 Jan 2025 | 11 Jan 2035 |
| 100 | ausablevalley.com | GoDaddy.com, LLC | 11 Jan 2010 | 15 Jan 2026 | 11 Jan 2027 |
| 101 | ausaintbenoit.com | eNom, Inc. | 4 Jul 2012 | 18 Jul 2017 | 4 Jul 2018 |
| 102 | ausav.com | Register.it SPA | 6 Oct 2024 | 19 Dec 2025 | 6 Oct 2026 |
| 103 | ausaumon.com | eNom, Inc. | 14 Jul 2011 | 19 Aug 2025 | 14 Jul 2026 |
| 104 | ausassist.com | Crazy Domains FZ-LLC | 20 Jan 2025 | 12 Jan 2026 | 20 Jan 2027 |
| 105 | ausamhomes.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 Mar 2023 | 17 Mar 2026 | 2 Mar 2027 |
| 106 | ausacegroup.com | HiChina Zhicheng Technology Limited | 27 Oct 2014 | 1 Dec 2016 | 27 Oct 2019 |
| 107 | ausarvoye.com | 1&1 Internet AG | 30 Oct 2014 | 12 Feb 2018 | 30 Oct 2018 |
| 108 | ausautotrade.com | GoDaddy.com, LLC | 28 Aug 2014 | 28 May 2015 | 28 Aug 2015 |
| 109 | ausalumini.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 110 | ausablecanoemarathon.org | Wild West Domains, LLC | 16 Feb 1998 | 16 Feb 2026 | 15 Feb 2027 |
| 111 | ausableriverqueen.com | TurnCommerce, Inc. DBA NameBright.com | 9 Jun 2010 | 3 Nov 2025 | 9 Jun 2026 |
| 112 | ausablerivertwoflyshop.com | GoDaddy.com, LLC | 12 Mar 2010 | 23 Apr 2026 | 12 Mar 2027 |
| 113 | ausapp.org | Web Commerce Communications Limited dba WebNic.cc | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 114 | ausatin-maroc.com | eNom, Inc. | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 115 | ausableriverrestaurant.com | NameCheap, Inc. | 22 May 2025 | 22 May 2025 | 22 May 2026 |
| 116 | ausaglac.info | GoDaddy.com, LLC | 14 Mar 2015 | 10 Mar 2026 | 14 Mar 2027 |
| 117 | ausailingclub.com | One Putt, Inc. | 6 Apr 2018 | 7 Apr 2018 | 6 Apr 2019 |
| 118 | ausactivewear.com | Crazy Domains FZ-LLC | 2 Nov 2014 | 16 Dec 2024 | 2 Nov 2024 |
| 119 | ausama.es | - | - | - | - |
| 120 | ausaarsenalofdemocracy.org | GoDaddy.com, LLC | 16 Sep 2011 | 31 Oct 2024 | 16 Sep 2026 |
| 121 | ausableriverqueenmi.com | Melbourne IT, Ltd | 19 May 2010 | 19 May 2015 | 19 May 2016 |
| 122 | ausabledesigns.com | Tucows Domains Inc. | 13 Feb 2009 | 29 Jan 2026 | 13 Feb 2027 |
| 123 | ausalumninigeria.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Nov 2014 | 3 Nov 2016 | 2 Nov 2017 |
| 124 | ausableriverqueen.net | Above.com Pty Ltd. | 19 Aug 2021 | 1 Jul 2023 | 19 Aug 2026 |
| 125 | ausaproduct.com | GoDaddy.com, LLC | 30 Dec 2016 | 30 Dec 2016 | 30 Dec 2017 |
| 126 | ausandroid.com | GoDaddy.com, LLC | 18 Jun 2014 | 18 Jun 2015 | 18 Jun 2016 |
| 127 | ausasiakeys.com | GoDaddy.com, LLC | 18 Jun 2013 | 19 Jun 2015 | 18 Jun 2016 |
| 128 | ausauctions.com | Dynadot4 LLC | 2 Jun 2022 | 12 Aug 2023 | 2 Jun 2023 |
| 129 | ausarians.com | Tucows Domains Inc. | 21 Jun 2013 | 21 Jun 2013 | 21 Jun 2017 |
| 130 | ausablecabin.com | NameCheap, Inc. | 13 Jan 2015 | 14 Dec 2025 | 13 Jan 2027 |
| 131 | ausave1.us | Internet.bs Corp. | 21 Aug 2014 | 21 Aug 2014 | 20 Aug 2015 |
| 132 | ausave2.us | Internet.bs Corp. | 21 Aug 2014 | 21 Aug 2014 | 20 Aug 2015 |
| 133 | ausave3.us | Internet.bs Corp. | 21 Aug 2014 | 21 Aug 2014 | 20 Aug 2015 |
| 134 | ausave4.us | Internet.bs Corp. | 21 Aug 2014 | 21 Aug 2014 | 20 Aug 2015 |
| 135 | ausave5.us | Internet.bs Corp. | 21 Aug 2014 | 21 Aug 2014 | 20 Aug 2015 |
| 136 | ausave6.us | Internet.bs Corp. | 21 Aug 2014 | 21 Aug 2014 | 20 Aug 2015 |
| 137 | ausartu.com | Tucows Domains Inc. | 12 Jul 2017 | 27 Jun 2025 | 12 Jul 2026 |
| 138 | ausanbeachfront.com | Tucows Domains Inc. | 5 Nov 2013 | 6 Nov 2025 | 5 Nov 2026 |
| 139 | ausableforestmilitia.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 140 | ausauk.com | Domainshype.com, Inc. | 26 Mar 2023 | 27 Mar 2025 | 26 Mar 2026 |
| 141 | ausablepress.com | Dynadot, LLC | 26 Apr 2026 | 26 Apr 2026 | 26 Apr 2027 |
| 142 | ausavil.org | Dinahosting s.l. | 7 Nov 2014 | 5 Nov 2025 | 7 Nov 2026 |
| 143 | ausamarisinvestment.com | Crazy Domains FZ-LLC | 24 Feb 2017 | 7 Mar 2019 | 24 Feb 2019 |
| 144 | ausante-thailand.com | - | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2017 |
| 145 | ausagency.com | GoDaddy.com, LLC | 25 Apr 2018 | 28 Jun 2025 | 25 Apr 2026 |
| 146 | ausableforestvolunteers.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2016 |
| 147 | ausalondecoiffure.com | Network Solutions, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 148 | ausastore.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2019 |
| 149 | ausaeducation.com | Tucows Domains Inc. | 5 Mar 2018 | 16 May 2023 | 5 Mar 2023 |
| 150 | ausartweb.com | Bizcn.com, Inc. | 1 Dec 2017 | 30 Nov 2017 | 1 Dec 2018 |
| 151 | ausastudy.com | Beijing Lanhai Jiye Technology Co., Ltd | 13 Sep 2014 | 15 Mar 2026 | 13 Sep 2026 |
| 152 | ausacademy.com | GoDaddy.com, LLC | 12 Sep 2014 | 27 Aug 2024 | 12 Sep 2026 |
| 153 | ausahoripur.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 154 | ausablekillings.com | 1&1 Internet AG | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 155 | ausasiaelite.com | Network Solutions, LLC | 2 Sep 2014 | 15 May 2024 | 2 Sep 2026 |
| 156 | ausavisa.com | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 157 | ausadios.com | NameCheap, Inc. | 4 Sep 2014 | 5 Aug 2025 | 4 Sep 2026 |
| 158 | ausangler.com | - | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2017 |
| 159 | ausapay.com | Google, Inc. | 11 Jul 2023 | 26 Jun 2025 | 11 Jul 2026 |
| 160 | ausautoparts.com | SBSNames, Incorporated | 24 Mar 2026 | 25 Mar 2026 | 24 Mar 2027 |
| 161 | ausasiainvest.com | Crazy Domains FZ-LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 162 | ausasiainvest.asia | Crazy Domains FZ-LLC | 18 Nov 2014 | - | 18 Nov 2015 |
| 163 | ausamericanmininglimited.com | Tucows Domains Inc. | 8 Sep 2014 | 12 Sep 2015 | 8 Sep 2016 |
| 164 | ausattachmentsolutions.com | Marcaria.com International, Inc. | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2016 |
| 165 | ausamaanwar.com | GoDaddy.com, LLC | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 166 | ausa-manipulatory.com | Tucows Domains Inc. | 11 Sep 2014 | 15 Sep 2022 | 11 Sep 2022 |
| 167 | ausa-voziky.com | Tucows Domains Inc. | 11 Sep 2014 | 15 Sep 2022 | 11 Sep 2022 |
| 168 | ausamanipulatory.com | Tucows Domains Inc. | 11 Sep 2014 | 15 Sep 2019 | 11 Sep 2019 |
| 169 | ausanconsultores.com | Mesh Digital Limited | 31 Aug 2004 | 1 Sep 2025 | 31 Aug 2026 |
| 170 | ausavoziky.com | Tucows Domains Inc. | 11 Sep 2014 | 15 Sep 2022 | 11 Sep 2022 |
| 171 | ausarez.com | GMO Internet Inc. | 16 Dec 2021 | 16 Dec 2021 | 16 Dec 2022 |
| 172 | ausaloon.com | Infomaniak Network SA | 17 Sep 2003 | 3 Sep 2025 | 17 Sep 2026 |
| 173 | ausasiatravel.com | GoDaddy.com, LLC | 20 Sep 2011 | 22 Sep 2025 | 20 Sep 2026 |
| 174 | ausarausetsocietyeurope.com | Domaingazelle.com LLC | 6 Apr 2022 | 2 May 2023 | 6 Apr 2024 |
| 175 | ausablecvb.com | Wild West Domains, LLC | 16 Oct 2014 | 27 May 2024 | 16 Oct 2029 |
| 176 | ausaca.com | GoDaddy.com, LLC | 17 Oct 2014 | 17 Oct 2023 | 17 Oct 2026 |
| 177 | ausabao.com | GoDaddy.com, LLC | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2019 |
| 178 | ausari.com | Synergy Wholesale Pty Ltd | 28 Apr 2025 | 28 Apr 2025 | 28 Apr 2026 |
| 179 | ausaquarium.com | eNom, Inc. | 26 Sep 2014 | 31 Aug 2016 | 26 Sep 2018 |
| 180 | ausa-forklifts.com | Launchpad, Inc. | 26 Sep 2014 | 8 Oct 2016 | 26 Sep 2017 |
| 181 | ausadhidaan.com | BigRock Solutions Ltd. | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 182 | ausar.net | Hostinger, UAB | 11 Jun 2025 | 11 Jun 2025 | 11 Jun 2026 |
| 183 | ausaidhealthcare.com | Network Solutions, LLC | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 184 | ausagroup.com | Dynadot, LLC | 26 Nov 2014 | 27 Nov 2025 | 26 Nov 2026 |
| 185 | ausacg.com | Hefei Juming Network Technology Co., Ltd | 7 May 2021 | 9 Jul 2024 | 7 May 2024 |
| 186 | ausamc.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Dec 2014 | 16 Feb 2016 | 4 Dec 2016 |
| 187 | ausasiano.com | Launchpad, Inc. | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 188 | ausandjusayido.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 189 | ausairportparkingapp.com | GoDaddy.com, LLC | 9 Dec 2014 | 10 Dec 2024 | 9 Dec 2029 |
| 190 | ausacasa.com | Cronon AG | 9 Dec 2014 | 10 Dec 2025 | 9 Dec 2026 |
| 191 | ausandjusayido.info | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 192 | ausablerivervacation.com | Tucows Domains Inc. | 13 Dec 2005 | 17 Dec 2022 | 13 Dec 2022 |
| 193 | ausablenbmercantile.com | GoDaddy.com, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 194 | ausartsagency.com | Launchpad, Inc. | 23 Dec 2014 | 23 Dec 2014 | 23 Dec 2015 |
| 195 | ausat.net | NameCheap, Inc. | 20 Mar 2017 | 19 Feb 2025 | 20 Mar 2027 |
| 196 | ausayaqui.com | Wild West Domains, LLC | 6 Apr 2016 | 6 Apr 2016 | 6 Apr 2017 |
| 197 | ausaus.com | Xiamen Nawang Technology Co., Ltd | 13 Jan 2026 | 13 Jan 2026 | 12 Jan 2027 |
| 198 | ausappbranding.com | GoDaddy.com, LLC | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2016 |
| 199 | ausaona.com | Xin Net Technology Corporation | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 200 | ausableriver4sale.xyz | Network Solutions, LLC | 27 Jul 2014 | 27 Jul 2014 | 27 Jul 2015 |
| 201 | ausableboats.xyz | Network Solutions, LLC | 26 Jul 2014 | 26 Jul 2014 | 26 Jul 2015 |
| 202 | ausaccess.help | Crazy Domains FZ-LLC | 4 Dec 2014 | 5 Dec 2014 | 4 Dec 2015 |
| 203 | ausasiagroup.fishing | Instra Corporation Pty Ltd. | 7 Dec 2014 | - | 7 Dec 2015 |
| 204 | ausasia.fishing | Instra Corporation Pty Ltd. | 7 Dec 2014 | - | 7 Dec 2015 |
| 205 | ausaleztoday.club | eNom, Inc. | 10 Dec 2014 | 11 Dec 2014 | 9 Dec 2015 |
| 206 | ausableforks.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 207 | ausairsupply.com | GoDaddy.com, LLC | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2016 |
| 208 | ausadipasal.com | Google, Inc. | 27 Feb 2019 | 12 Feb 2026 | 27 Feb 2027 |
| 209 | ausadhipasal.com | Google, Inc. | 11 May 2018 | 26 Apr 2025 | 11 May 2026 |
| 210 | ausadsl.info | GMO Internet Inc. | 26 Apr 2023 | 7 Jun 2024 | 26 Apr 2024 |
| 211 | ausassassinsclan.com | Dynamic Network Services, Inc. | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 212 | ausapdehaiti.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 213 | ausarians.org | Tucows Domains Inc. | 8 Jan 2015 | 12 Jan 2016 | 8 Jan 2017 |
| 214 | ausazombierun.com | DNSPod, Inc. | 5 Jun 2021 | 5 Jun 2021 | 5 Jun 2022 |
| 215 | ausamfreedom.com | GoDaddy.com, LLC | 11 Jan 2015 | 11 Jan 2015 | 11 Jan 2016 |
| 216 | ausayolsupurme.com | FBS Inc. | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 217 | ausaturkiye.com | FBS Inc. | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 218 | ausa-turkiye.com | FBS Inc. | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 219 | ausasiaindustries.com | TurnCommerce, Inc. DBA NameBright.com | 14 Jan 2015 | 8 Jan 2021 | 14 Jan 2027 |
| 220 | ausangatetrip.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Mar 2026 | 14 Mar 2026 | 14 Mar 2027 |
| 221 | ausaccounts.net | Crazy Domains FZ-LLC | 13 Jan 2015 | 24 Jan 2017 | 13 Jan 2017 |
| 222 | ausaccounts.info | Crazy Domains FZ-LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2017 |
| 223 | ausak.top | GuangDong NaiSiNiKe Information Technology Co Ltd. | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 224 | ausaka.xyz | GMO Internet Inc. | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 225 | ausahotels.review | Alpnames Limited | 4 Jul 2015 | - | 3 Jul 2016 |
| 226 | ausandohms.com | DNC Holdings, Inc. | 18 Jan 2015 | 18 Jan 2015 | 18 Jan 2016 |
| 227 | ausangateperutravel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 228 | ausableriverbirdboxco.com | Network Solutions, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 229 | ausaproxy.info | GoDaddy.com, LLC | 25 Jan 2015 | - | 25 Jan 2016 |
| 230 | ausastonewall.org | Google, Inc. | 25 Jan 2015 | 7 Feb 2017 | 25 Jan 2019 |
| 231 | ausarateam.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 232 | ausalonduchien.com | Register.it SPA | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 233 | ausacumass.com | GoDaddy.com, LLC | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 234 | ausagro.com | Crazy Domains FZ-LLC | 31 Jul 2016 | 8 Feb 2024 | 31 Jul 2027 |
| 235 | ausarchinteriors.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2017 |
| 236 | ausambisrael.com | Netowl, Inc. | 9 Nov 2017 | 9 Nov 2017 | 9 Nov 2018 |
| 237 | ausafrica.com | TurnCommerce, Inc. DBA NameBright.com | 28 Apr 2017 | 22 Apr 2020 | 28 Apr 2026 |
| 238 | ausalerts.com | Key-Systems GmbH | 9 Feb 2014 | 8 Feb 2026 | 9 Feb 2027 |
| 239 | ausadult.com | TurnCommerce, Inc. DBA NameBright.com | 1 May 2020 | 2 Jun 2024 | 1 May 2024 |
| 240 | ausaccts.com | Crazy Domains FZ-LLC | 11 Feb 2015 | 22 Feb 2017 | 11 Feb 2017 |
| 241 | ausacct.com | Crazy Domains FZ-LLC | 11 Feb 2015 | 22 Feb 2017 | 11 Feb 2017 |
| 242 | ausaccountants.com | Dynadot, LLC | 21 Feb 2020 | 2 Apr 2025 | 21 Feb 2025 |
| 243 | ausaccountant.com | Crazy Domains FZ-LLC | 11 Feb 2015 | 22 Feb 2017 | 11 Feb 2017 |
| 244 | ausairtexas.com | GoDaddy.com, LLC | 13 Feb 2015 | 13 Feb 2026 | 13 Feb 2027 |
| 245 | ausauvignon.com | 1&1 Internet AG | 16 Feb 2015 | 6 Jul 2023 | 16 Feb 2027 |
| 246 | ausaautoglass.com | FastDomain Inc. | 16 Feb 2015 | 16 Feb 2015 | 16 Feb 2016 |
| 247 | ausangatecircuit.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 248 | ausangate-peru.com | GoDaddy.com, LLC | 17 Feb 2015 | 18 Feb 2026 | 17 Feb 2027 |
| 249 | ausak.com | Top Pick Names LLC | 30 Sep 2025 | 1 Oct 2025 | 30 Sep 2026 |
| 250 | ausadultdirect.com | register.com, Inc. | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 251 | ausallmechanical.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 252 | ausablerivertradingpost.com | GoDaddy.com, LLC | 18 Feb 2015 | 1 Apr 2025 | 18 Feb 2025 |
| 253 | ausangatetrek.org | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 254 | ausauvignon.net | OVH sas | 16 Feb 2015 | 17 Jan 2017 | 16 Feb 2018 |
| 255 | ausafhussainwelfaretrust.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Feb 2015 | 25 Jan 2017 | 16 Feb 2018 |
| 256 | ausattitude.com | TPP Wholesale Pty Ltd. | 27 Feb 2015 | 28 Feb 2017 | 27 Feb 2019 |
| 257 | ausavondeprovence.com | Launchpad, Inc. | 27 Feb 2015 | 15 Jan 2025 | 27 Feb 2030 |
| 258 | ausabotfleuri.com | FastDomain Inc. | 2 Jun 2023 | 3 Jun 2025 | 2 Jun 2026 |
| 259 | ausasiamall.com | GoDaddy.com, LLC | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2017 |
| 260 | ausadi.com | Hostinger, UAB | 24 Nov 2025 | 24 Nov 2025 | 24 Nov 2026 |
| 261 | ausatrlianracinggreyhound.com | eNom, Inc. | 8 Mar 2015 | 8 Mar 2015 | 8 Mar 2016 |
| 262 | ausarenglish.com | Tucows Domains Inc. | 10 Feb 2019 | 31 Jan 2026 | 10 Feb 2027 |
| 263 | ausa-city.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 264 | ausablebotanicals.com | GoDaddy.com, LLC | 17 Jun 2023 | 17 Jun 2023 | 17 Jun 2028 |
| 265 | ausaus999.com | eNom, Inc. | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 266 | ausacu.com | Hosting Concepts B.V. dba Openprovider | 19 May 2021 | 19 May 2021 | 19 May 2022 |
| 267 | ausadven.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2016 |
| 268 | ausama.net | 1&1 Internet AG | 12 Mar 2015 | 13 Mar 2026 | 12 Mar 2027 |
| 269 | ausavinalifters.com | GoDaddy.com, LLC | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2017 |
| 270 | ausavinalifter.com | GoDaddy.com, LLC | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2017 |
| 271 | ausavinaclamps.com | GoDaddy.com, LLC | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2017 |
| 272 | ausavinaclamp.com | GoDaddy.com, LLC | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2017 |
| 273 | ausadana.com | GoDaddy.com, LLC | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 274 | ausatelehandlers.com | Melbourne IT, Ltd | 18 Mar 2015 | 14 Mar 2026 | 18 Mar 2027 |
| 275 | ausagents.com | DROPCATCH.COM 752 LLC | 19 Jun 2024 | 30 Aug 2025 | 19 Jun 2025 |
| 276 | ausaltmachneu.com | 1API GmbH | 5 Aug 2022 | 20 Nov 2025 | 5 Aug 2026 |
| 277 | ausartfinder.com | GoDaddy.com, LLC | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 278 | ausapi.org | NameCheap, Inc. | 28 May 2016 | 3 May 2025 | 28 May 2026 |
| 279 | ausatristate.org | Network Solutions, LLC | 15 Mar 2015 | 18 Feb 2025 | 15 Mar 2027 |
| 280 | ausangateaway.com | Name.com, Inc. | 22 Mar 2015 | 30 Mar 2017 | 22 Mar 2018 |
| 281 | ausatmen.org | PSI-USA, Inc. dba Domain Robot | 23 Mar 2015 | 23 Mar 2025 | 23 Mar 2026 |
| 282 | ausatmen.net | World4You Internet Services GmbH | 23 Mar 2015 | 23 May 2025 | 23 Mar 2025 |
| 283 | ausatmen.info | PSI-USA, Inc. dba Domain Robot | 23 Mar 2015 | 23 Mar 2025 | 23 Mar 2026 |
| 284 | ausaboriginalart.com | Key-Systems GmbH | 26 Mar 2015 | 4 Feb 2026 | 26 Mar 2027 |
| 285 | ausanthems.com | Porkbun, LLC | 26 Mar 2015 | 25 Mar 2026 | 26 Mar 2027 |
| 286 | ausaakenya.org | Crazy Domains FZ-LLC | 3 Mar 2011 | 22 Mar 2015 | 3 Mar 2016 |
| 287 | ausa-fairfaxlee.org | eNom, Inc. | 1 Mar 2015 | 13 Apr 2017 | 1 Mar 2018 |
| 288 | ausaapt.com | Crazy Domains FZ-LLC | 27 Aug 2015 | 7 Sep 2017 | 27 Aug 2017 |
| 289 | ausatmen.com | TurnCommerce, Inc. DBA NameBright.com | 28 Mar 2015 | 14 Mar 2020 | 28 Mar 2027 |
| 290 | ausaquatoriums.com | DropCatch.com 660 LLC | 29 Mar 2015 | 30 Mar 2017 | 29 Mar 2018 |
| 291 | ausaquamation.com | GlamDomains LLC | 29 Mar 2015 | 30 Mar 2017 | 29 Mar 2018 |
| 292 | ausana.com | TurnCommerce, Inc. DBA NameBright.com | 29 Mar 2015 | 3 Nov 2025 | 29 Mar 2026 |
| 293 | ausafairfaxlee.org | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Jun 2017 | 13 Aug 2017 | 14 Jun 2018 |
| 294 | ausange.com | Tucows Domains Inc. | 29 Mar 2012 | 2 Apr 2015 | 29 Mar 2016 |
| 295 | ausamsoldier.com | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 296 | ausairtx.com | Namesilo, LLC | 27 Jun 2024 | 27 Aug 2025 | 27 Jun 2025 |
| 297 | ausairtex.com | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 298 | ausagranollers.com | Network Solutions, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2017 |
| 299 | ausagrivet.com | GoDaddy.com, LLC | 4 Apr 2015 | 4 Apr 2015 | 4 Apr 2017 |
| 300 | ausamp.com | NameCheap, Inc. | 17 Sep 2022 | 29 Oct 2023 | 17 Sep 2023 |
| 301 | ausagel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Mar 2005 | 24 Mar 2026 | 28 Mar 2027 |
| 302 | ausapphire.com | TPP Wholesale Pty Ltd. | 8 Apr 2015 | 14 Jun 2017 | 8 Apr 2019 |
| 303 | ausahealing.com | GoDaddy.com, LLC | 26 Dec 2020 | 26 Dec 2020 | 26 Dec 2021 |
| 304 | ausavinalifters.us | GoDaddy.com, LLC | 6 Apr 2015 | 6 Apr 2015 | 5 Apr 2016 |
| 305 | ausavinalifters.net | GoDaddy.com, LLC | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2016 |
| 306 | ausavinaclamps.us | GoDaddy.com, LLC | 6 Apr 2015 | 6 Apr 2015 | 5 Apr 2016 |
| 307 | ausavinaclamps.net | GoDaddy.com, LLC | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2016 |
| 308 | ausavina.us | GoDaddy.com, LLC | 6 Apr 2015 | 6 Apr 2015 | 5 Apr 2016 |
| 309 | ausavina.net | GoDaddy.com, LLC | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2016 |
| 310 | ausaokai.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Nov 2016 | 18 Nov 2017 | 18 Nov 2017 |
| 311 | ausablerivertobacco.org | Network Solutions, LLC | 31 Aug 2015 | 30 Oct 2015 | 31 Aug 2017 |
| 312 | ausa-er.org | Mesh Digital Limited | 31 Aug 2015 | 1 Aug 2017 | 31 Aug 2018 |
| 313 | ausargrouprealty.com | GoDaddy.com, LLC | 3 Sep 2015 | 3 Sep 2015 | 3 Sep 2016 |
| 314 | ausagistment.com | GoDaddy.com, LLC | 3 Sep 2015 | 3 Sep 2024 | 3 Sep 2027 |
| 315 | ausanieite.com | GoDaddy.com, LLC | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2016 |
| 316 | ausales-rayban.com | Chengdu West Dimension Digital Technology Co., Ltd… | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 317 | ausairoftx.com | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 318 | ausage.info | GoDaddy.com, LLC | 10 Apr 2015 | - | 10 Apr 2016 |
| 319 | ausaintvincent-goutrens.com | - | - | - | - |
| 320 | ausamas.com | Crazy Domains FZ-LLC | 16 Apr 2015 | 27 Apr 2017 | 16 Apr 2017 |
| 321 | ausaint.com | Tucows Domains Inc. | 13 Apr 2013 | 17 Apr 2015 | 13 Apr 2016 |
| 322 | ausarenergy.org | Gandi SAS | 5 Sep 2015 | 4 Jul 2025 | 5 Sep 2026 |
| 323 | ausarenergy.net | Gandi SAS | 5 Sep 2015 | 30 Jun 2025 | 5 Sep 2026 |
| 324 | ausarenergy.com | Gandi SAS | 5 Sep 2015 | 30 Jun 2025 | 5 Sep 2026 |
| 325 | ausarenergy.biz | Gandi SAS | 5 Sep 2015 | 4 Jul 2025 | 4 Sep 2026 |
| 326 | ausar-energy.org | Gandi SAS | 5 Sep 2015 | 4 Jul 2025 | 5 Sep 2026 |
| 327 | ausar-energy.net | Gandi SAS | 5 Sep 2015 | 30 Jun 2025 | 5 Sep 2026 |
| 328 | ausar-energy.biz | Gandi SAS | 5 Sep 2015 | 4 Jul 2025 | 4 Sep 2026 |
| 329 | ausaff.com | GoDaddy.com, LLC | 18 Jul 2016 | 18 Jun 2024 | 18 Jul 2026 |
| 330 | ausaviationguide.com | NetRegistry Pty Ltd. | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2017 |
| 331 | ausamiiqo.com | Tucows Domains Inc. | 6 Sep 2015 | 10 Sep 2017 | 6 Sep 2017 |
| 332 | ausadults.net | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 333 | ausafahmad.info | CommuniGal Communication Ltd. | 28 Jun 2023 | 28 Jun 2024 | 28 Jun 2024 |
| 334 | ausanteshop.com | Register NV dba Register.eu | 21 Apr 2015 | 20 Apr 2017 | 21 Apr 2018 |
| 335 | ausaviationguide.net | NetRegistry Pty Ltd. | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2017 |
| 336 | ausaair.com | NameKing.com Inc. | 24 Apr 2015 | 16 Mar 2017 | 24 Apr 2018 |
| 337 | ausar-energy.solar | Gandi SAS | 7 Sep 2015 | - | - |
| 338 | ausarenergy.solar | Gandi SAS | 7 Sep 2015 | - | - |
| 339 | ausar.energy | Gandi SAS | 7 Sep 2015 | - | - |
| 340 | ausangateenvironmental.com | GoDaddy.com, LLC | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2016 |
| 341 | ausalice.com | Soluciones Corporativas IP, SLU | 15 Jul 2016 | 15 Jun 2017 | 15 Jul 2018 |
| 342 | ausadvisor.com | CloudFlare, Inc. | 27 Nov 2019 | 24 Nov 2025 | 27 Nov 2026 |
| 343 | ausatech.info | GoDaddy.com, LLC | 28 Apr 2015 | - | 28 Apr 2016 |
| 344 | ausatech.com | GoDaddy.com, LLC | 28 Apr 2015 | 9 Jun 2025 | 28 Apr 2025 |
| 345 | ausadawood.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 346 | ausangateenvironmental.org | GoDaddy.com, LLC | 27 Apr 2015 | 28 Apr 2017 | 27 Apr 2018 |
| 347 | ausatech.org | GoDaddy.com, LLC | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 348 | ausatech.net | GoDaddy.com, LLC | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 349 | ausaxwnuq.us | - | 8 Sep 2015 | - | 7 Sep 2016 |
| 350 | ausaremaroc.com | NordNet SA | 8 Sep 2015 | 25 Jul 2017 | 7 Sep 2018 |
| 351 | ausablerivertobacco.net | Network Solutions, LLC | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 352 | ausamc.com | Domainnovations, Inc. | 10 Nov 2022 | 24 Jan 2024 | 10 Nov 2023 |
| 353 | ausableriversportshop.com | Synergy Wholesale Pty Ltd | 30 Jan 2019 | 11 Mar 2026 | 30 Jan 2026 |
| 354 | ausasia-capintro.com | GoDaddy.com, LLC | 6 May 2015 | 6 May 2015 | 6 May 2020 |
| 355 | ausarasota.org | Domain.com, LLC | 13 May 2015 | 28 May 2017 | 13 May 2018 |
| 356 | ausannette.com | Google, Inc. | 15 May 2015 | 30 Apr 2025 | 15 May 2026 |
| 357 | ausapa.com | Tucows Domains Inc. | 20 Jun 2022 | 31 Aug 2025 | 20 Jun 2025 |
| 358 | ausap.us | GoDaddy.com, LLC | 12 Sep 2015 | 12 May 2025 | 11 Sep 2025 |
| 359 | ausableriverriders.com | GMO Internet Inc. | 13 Sep 2015 | 29 Sep 2016 | 12 Sep 2017 |
| 360 | ausatexas.com | - | 18 Jul 2016 | 18 Jul 2016 | 18 Jul 2017 |
| 361 | ausablefur.com | Network Solutions, LLC | 18 May 2015 | 18 May 2019 | 18 May 2029 |
| 362 | ausapavideos.com | eNom, Inc. | 19 May 2015 | 19 May 2015 | 19 May 2017 |
| 363 | ausaccounting.info | GoDaddy.com, LLC | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 364 | ausaservices.com | GoDaddy.com, LLC | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 365 | ausailormoon.com | register.com, Inc. | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 366 | ausaccounting.net | GoDaddy.com, LLC | 20 May 2015 | 20 May 2015 | 20 May 2017 |
| 367 | ausarma.org | Synergy Wholesale Pty Ltd | 8 Jan 2022 | 11 Jan 2026 | 8 Jan 2027 |
| 368 | ausaupair.com | TurnCommerce, Inc. DBA NameBright.com | 10 Aug 2019 | 21 Sep 2024 | 10 Aug 2024 |
| 369 | ausaupair.info | GoDaddy.com, LLC | 23 May 2015 | 24 May 2017 | 23 May 2018 |
| 370 | ausaving.com | Uniregistrar Corp | - | - | - |
| 371 | ausatours.com | Wild West Domains, LLC | 24 May 2015 | 24 May 2015 | 24 May 2017 |
| 372 | ausaupair.org | GoDaddy.com, LLC | 23 May 2015 | 24 May 2017 | 23 May 2018 |
| 373 | ausaupair.net | GoDaddy.com, LLC | 23 May 2015 | 23 May 2015 | 23 May 2016 |
| 374 | ausaire.com | eName Technology Co., Ltd. | 19 Apr 2023 | 31 May 2024 | 19 Apr 2024 |
| 375 | ausasiainvestments.com | NetRegistry Pty Ltd. | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 376 | ausairoftexas.com | GoDaddy.com, LLC | 20 Jun 2016 | 20 Jun 2016 | 20 Jun 2017 |
| 377 | ausafir.com | Wix.com Ltd. | 8 Jun 2022 | 19 Jul 2023 | 8 Jun 2023 |
| 378 | ausaire.net | GoDaddy.com, LLC | 25 May 2015 | 25 May 2015 | 25 May 2016 |
| 379 | ausadhalay.com | GoDaddy.com, LLC | 24 Oct 2021 | 27 May 2025 | 24 Oct 2026 |
| 380 | ausampelite.com | Shanghai Meicheng Technology Information Co., Ltd | 22 Apr 2020 | 23 Apr 2026 | 22 Apr 2027 |
| 381 | ausairjar.com | GoDaddy.com, LLC | 14 Sep 2015 | 14 Sep 2015 | 14 Sep 2017 |
| 382 | ausassistance.com | Crazy Domains FZ-LLC | 13 Aug 2017 | 19 Jul 2024 | 13 Aug 2026 |
| 383 | ausarta.org | Realtime Register B.V. | 7 Nov 2017 | 22 Dec 2025 | 7 Nov 2026 |
| 384 | ausablerivecampsite.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 385 | ausacamera.com | Bizcn.com, Inc. | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2016 |
| 386 | ausavonnet.com | OVH sas | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 387 | ausacbcv.org | Launchpad, Inc. | 16 Sep 2015 | 6 Sep 2025 | 16 Sep 2026 |
| 388 | ausarchts.com | easyDNS Technologies, Inc. | 30 May 2014 | 3 Jun 2018 | 30 May 2018 |
| 389 | ausamusic.com | 10dencehispahard, S.L. | 15 May 2008 | 19 Apr 2020 | 15 May 2026 |
| 390 | ausarauseteurope.com | Tucows Domains Inc. | 3 Jun 2015 | 14 Aug 2025 | 3 Jun 2025 |
| 391 | ausar-auset.com | Tucows Domains Inc. | 31 May 2012 | 4 Jun 2015 | 31 May 2016 |
| 392 | ausamusic.net | West263 International Limited | 25 Aug 2021 | 25 Aug 2021 | 25 Aug 2022 |
| 393 | ausarian.net | Google, Inc. | 26 Nov 2021 | 26 Nov 2021 | 26 Nov 2022 |
| 394 | ausapex.com | HiChina Zhicheng Technology Limited | 5 Jun 2015 | 4 Jun 2025 | 5 Jun 2026 |
| 395 | ausavet.com | Name.com, Inc. | 7 Jun 2015 | 7 Jun 2015 | 7 Jun 2016 |
| 396 | ausablevalleygrange.com | Key-Systems GmbH | 29 Dec 2022 | 13 Mar 2024 | 29 Dec 2023 |
| 397 | ausart-mining.com | eNom, Inc. | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 398 | ausablesurvey.com | Network Solutions, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 399 | ausalaya.com | GoDaddy.com, LLC | 9 Jun 2015 | 9 Jun 2015 | 9 Jun 2016 |
| 400 | ausablerivercampsite.net | GoDaddy.com, LLC | 30 Dec 2016 | 30 Dec 2016 | 30 Dec 2017 |
| 401 | ausamt.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 11 Jun 2015 | 11 Jun 2015 | 11 Jun 2016 |
| 402 | ausabit.com | 10dencehispahard, S.L. | 21 Sep 2007 | 26 Sep 2025 | 21 Sep 2026 |
| 403 | ausalaya.org | GoDaddy.com, LLC | 9 Jun 2015 | 21 Jun 2017 | 9 Jun 2018 |
| 404 | ausalaya.net | GoDaddy.com, LLC | 9 Jun 2015 | 9 Jun 2015 | 9 Jun 2016 |
| 405 | ausalaya.info | GoDaddy.com, LLC | 9 Jun 2015 | 21 Jun 2017 | 9 Jun 2018 |
| 406 | ausa-forklift.com | GoDaddy.com, LLC | 14 Feb 2017 | 14 Feb 2017 | 14 Feb 2018 |
| 407 | ausasiafinance.com | Tucows Domains Inc. | 16 Jun 2004 | 20 Jun 2015 | 16 Jun 2016 |
| 408 | ausainvestment.com | GoDaddy.com, LLC | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 409 | ausalpaca.com | TurnCommerce, Inc. DBA NameBright.com | 7 Dec 2018 | 13 Feb 2025 | 7 Dec 2026 |
| 410 | ausartaoptima.net | Domain.com, LLC | 19 Sep 2008 | 19 Sep 2008 | 19 Sep 2026 |
| 411 | ausartaoptima.com | Domain.com, LLC | 19 Sep 2008 | 25 Aug 2025 | 19 Sep 2026 |
| 412 | ausartamedia.net | Domain.com, LLC | 19 Sep 2008 | 25 Aug 2025 | 19 Sep 2026 |
| 413 | ausartamedia.com | Domain.com, LLC | 19 Sep 2008 | 25 Aug 2025 | 19 Sep 2026 |
| 414 | ausarta.net | Domain.com, LLC | 19 Sep 2008 | 26 Sep 2025 | 19 Sep 2026 |
| 415 | ausanime.com | TurnCommerce, Inc. DBA NameBright.com | 7 Sep 2017 | 1 Sep 2020 | 7 Sep 2026 |
| 416 | ausablevalleygolf.com | GoDaddy.com, LLC | 11 Sep 2020 | 11 Sep 2020 | 11 Sep 2021 |
| 417 | ausamservice.com | GoDaddy.com, LLC | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2016 |
| 418 | ausautoglasslasvegas.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Oct 2017 | 16 Oct 2017 | 16 Oct 2018 |
| 419 | ausauthorpreneur.com | Crazy Domains FZ-LLC | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2017 |
| 420 | ausammi.com | Global Domain Name Trading Center Ltd | 27 Nov 2021 | 27 Nov 2021 | 27 Nov 2022 |
| 421 | ausablenorthbranch.com | Network Solutions, LLC | 1 Jul 2015 | 29 Jun 2017 | 1 Jul 2019 |
| 422 | ausargames.com | Active Registrar, Inc. | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2016 |
| 423 | ausa4westernutilities.org | FastDomain Inc. | 1 Jul 2015 | 31 Aug 2015 | 1 Jul 2018 |
| 424 | ausacafeteria.com | Dinahosting s.l. | 3 Jul 2015 | 26 Jun 2017 | 3 Jul 2018 |
| 425 | ausalewomenshoe.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Sep 2015 | 25 Sep 2015 | 25 Sep 2016 |
| 426 | ausamseries.com | Tucows Domains Inc. | 3 Jul 2013 | 7 Jul 2015 | 3 Jul 2016 |
| 427 | ausargaming.com | Tucows Domains Inc. | 8 Jul 2015 | 8 Jul 2015 | 8 Jul 2017 |
| 428 | ausameetings.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 17 Apr 2024 | 18 Apr 2025 | 17 Apr 2026 |
| 429 | ausafindustries.com | Domain.com, LLC | 8 Jul 2015 | 9 Jun 2025 | 8 Jul 2026 |
| 430 | ausajacorporation.com | Domain Central Australia Pty Ltd. | 12 Jul 2015 | 12 Jul 2015 | 12 Jul 2016 |
| 431 | ausaairtexas.com | GoDaddy.com, LLC | 13 Jun 2016 | 13 Jun 2016 | 13 Jun 2017 |
| 432 | ausatinyhouse.com | GoDaddy.com, LLC | 19 Jul 2015 | 19 Jul 2015 | 19 Jul 2016 |
| 433 | ausagencies.com | Crazy Domains FZ-LLC | 11 Jul 2011 | 17 Mar 2016 | 11 Jul 2018 |
| 434 | ausassistexportandeducation.com | Synergy Wholesale Pty Ltd | 21 Jul 2015 | 21 Jul 2025 | 21 Jul 2026 |
| 435 | ausasiaculturalintelligence.com | Launchpad, Inc. | 21 Jul 2015 | 6 Jul 2017 | 21 Jul 2018 |
| 436 | ausasiaadvisory.com | GoDaddy.com, LLC | 18 Jun 2020 | 30 Jul 2024 | 18 Jun 2024 |
| 437 | ausasiaresources.com | Wix.com Ltd. | 28 Dec 2023 | 7 Jan 2025 | 28 Dec 2026 |
| 438 | ausailing.com | TurnCommerce, Inc. DBA NameBright.com | 17 Dec 2017 | 26 Jan 2025 | 17 Dec 2024 |
| 439 | ausavings.com | GoDaddy.com, LLC | 31 Mar 2020 | 1 Apr 2026 | 31 Mar 2027 |
| 440 | ausarcellrepair.com | Web Commerce Communications Limited dba WebNic.cc | 16 Nov 2022 | 26 Oct 2022 | 16 Nov 2024 |
| 441 | ausahomestay.com | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 442 | ausacorp.com | Tucows Domains Inc. | 26 Jul 2001 | 7 Sep 2025 | 26 Jul 2026 |
| 443 | ausaconnect.com | GoDaddy.com, LLC | 29 Jul 2015 | 30 Jul 2025 | 29 Jul 2026 |
| 444 | ausarabic.com | DropCatch.com 878 LLC | 20 Dec 2017 | 20 Dec 2017 | 20 Dec 2018 |
| 445 | ausautomotive.com | TurnCommerce, Inc. DBA NameBright.com | 17 Oct 2017 | 11 Oct 2020 | 17 Oct 2026 |
| 446 | ausappcast.com | GoDaddy.com, LLC | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 447 | ausadventuresafari.com | TPP Wholesale Pty Ltd. | 3 Aug 2015 | 3 Aug 2015 | 3 Aug 2017 |
| 448 | ausalize.review | Alpnames Limited | 2 Oct 2015 | - | 1 Oct 2016 |
| 449 | ausautomatics.com | Crazy Domains FZ-LLC | 4 Aug 2015 | 15 Aug 2017 | 4 Aug 2017 |
| 450 | ausautoelectricians.com | Crazy Domains FZ-LLC | 4 Aug 2015 | 15 Aug 2017 | 4 Aug 2017 |
| 451 | ausautoelectrician.com | Crazy Domains FZ-LLC | 4 Aug 2015 | 15 Aug 2017 | 4 Aug 2017 |
| 452 | ausallerwelt.info | RegistryGate GmbH | 3 Oct 2015 | 3 Oct 2015 | 3 Oct 2016 |
| 453 | ausawd.com | - | 13 Jul 2025 | 26 Oct 2025 | 13 Jul 2027 |
| 454 | ausaccommodation.com | Melbourne IT, Ltd | 9 Aug 2015 | 5 Aug 2025 | 9 Aug 2026 |
| 455 | ausautomatic.com | Crazy Domains FZ-LLC | 11 Aug 2015 | 22 Aug 2017 | 11 Aug 2017 |
| 456 | ausacewines.com | HiChina Zhicheng Technology Limited | 10 Aug 2015 | 10 Aug 2015 | 10 Aug 2018 |
| 457 | ausall.info | GoDaddy.com, LLC | 9 Aug 2015 | - | 9 Aug 2016 |
| 458 | ausablethan.xyz | GMO Internet Inc. | 5 Oct 2015 | - | 5 Oct 2016 |
| 459 | ausangatetreksperu.com | Namesilo, LLC | 20 Apr 2023 | 21 Apr 2026 | 20 Apr 2027 |
| 460 | ausafrandaquitaine.org | OVH sas | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 461 | ausafrandaquitaine.net | OVH sas | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 462 | ausafrandaquitaine.info | OVH sas | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 463 | ausafrandaquitaine.com | OVH sas | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 464 | ausafrandaquitaine.biz | OVH sas | 8 Oct 2015 | 8 Oct 2015 | 7 Oct 2016 |
| 465 | ausaf.org | Tucows Domains Inc. | 8 Jan 2024 | 31 Jan 2026 | 8 Jan 2027 |
| 466 | ausandnzmemberbenefits.com | Melbourne IT, Ltd | 9 Oct 2015 | 9 Oct 2015 | 9 Oct 2016 |
| 467 | ausalewomenshoes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Oct 2015 | 10 Oct 2015 | 10 Oct 2016 |
| 468 | ausaleengeryad.net | register.com, Inc. | 9 Oct 2015 | 9 Oct 2015 | 9 Oct 2016 |
| 469 | ausarcadez.com | GoDaddy.com, LLC | 13 Oct 2015 | 13 Oct 2015 | 13 Oct 2016 |
| 470 | ausaguenay.com | DropCatch.com 969 LLC | 22 Feb 2018 | 22 Feb 2018 | 22 Feb 2019 |
| 471 | ausangateadventures.com | GoDaddy.com, LLC | 21 Feb 2023 | 22 Feb 2025 | 21 Feb 2027 |
| 472 | ausagbusiness.com | Tucows Domains Inc. | 19 Oct 2015 | 23 Oct 2017 | 19 Oct 2017 |
| 473 | ausagbusiness.net | Tucows Domains Inc. | 19 Oct 2015 | 23 Oct 2018 | 19 Oct 2018 |
| 474 | ausaerialphotos.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Oct 2015 | 25 Nov 2016 | 19 Oct 2017 |
| 475 | ausablemediagroup.com | DropCatch.com 617 LLC | 19 Oct 2015 | 20 Oct 2016 | 19 Oct 2017 |
| 476 | ausausa.com | GoDaddy.com, LLC | 22 Oct 2015 | 23 Oct 2025 | 22 Oct 2030 |
| 477 | ausaparts.com | GoDaddy.com, LLC | 22 Oct 2015 | 23 Oct 2025 | 22 Oct 2030 |
| 478 | ausa-usa.com | GoDaddy.com, LLC | 22 Oct 2015 | 23 Oct 2025 | 22 Oct 2030 |
| 479 | ausa-parts.com | GoDaddy.com, LLC | 22 Oct 2015 | 23 Oct 2025 | 22 Oct 2030 |
| 480 | ausablerivertobacco.com | 1&1 Internet AG | 27 Oct 2015 | 28 Oct 2019 | 27 Oct 2026 |
| 481 | ausanime.net | GoDaddy.com, LLC | 29 Oct 2015 | 30 Oct 2016 | 29 Oct 2018 |
| 482 | ausanime.info | GoDaddy.com, LLC | 29 Oct 2015 | 30 Oct 2018 | 29 Oct 2020 |
| 483 | ausandy.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Aug 2024 | 19 Mar 2026 | 16 Aug 2026 |
| 484 | ausaedu.com | GoDaddy.com, LLC | 3 Dec 2021 | 13 Jan 2026 | 3 Dec 2025 |
| 485 | ausaco.info | Network Solutions, LLC | 31 Oct 2015 | 31 Oct 2015 | 31 Oct 2016 |
| 486 | ausachi.net | GoDaddy.com, LLC | 2 Nov 2015 | 2 Nov 2015 | 2 Nov 2016 |
| 487 | ausapparel.com | TurnCommerce, Inc. DBA NameBright.com | 19 Jan 2018 | 13 Jan 2021 | 19 Jan 2027 |
| 488 | ausachi.com | TurnCommerce, Inc. DBA NameBright.com | 20 Jan 2018 | 1 Mar 2025 | 20 Jan 2025 |
| 489 | ausarea.com | GoDaddy.com, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 490 | ausata.xyz | GMO Internet Inc. | 7 Nov 2015 | 7 Nov 2015 | 7 Nov 2016 |
| 491 | ausawards.com | Dynadot, LLC | 12 Nov 2015 | 23 Oct 2025 | 12 Nov 2026 |
| 492 | ausacheva.com | Regional Network Information Center, JSC dba RU-CE… | 24 Apr 2021 | 27 Apr 2021 | 23 Apr 2022 |
| 493 | ausaafconstruction.com | GoDaddy.com, LLC | 13 Nov 2015 | 13 Nov 2015 | 13 Nov 2016 |
| 494 | ausa1.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Feb 2020 | 8 Feb 2020 | 8 Feb 2021 |
| 495 | ausar.win | Alpnames Limited | 14 Nov 2015 | - | 13 Nov 2016 |
| 496 | ausalefactory.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Nov 2015 | 18 Nov 2015 | 18 Nov 2016 |
| 497 | ausadumpers.com | Network Solutions, LLC | 18 Nov 2015 | 19 Sep 2025 | 18 Nov 2026 |
| 498 | ausasweepers.com | Network Solutions, LLC | 18 Nov 2015 | 19 Sep 2025 | 18 Nov 2026 |
| 499 | ausankacrues.com | Google, Inc. | 18 Nov 2015 | 3 Nov 2025 | 18 Nov 2026 |
| 500 | ausalonreno.com | GoDaddy.com, LLC | 19 Nov 2015 | 14 Mar 2026 | 19 Nov 2026 |
| 501 | ausaforklifts.com | Network Solutions, LLC | 18 Nov 2015 | 19 Sep 2025 | 18 Nov 2026 |
| 502 | ausatelehandler.com | Synergy Wholesale Pty Ltd | 20 Nov 2015 | 6 Nov 2025 | 20 Nov 2026 |
| 503 | ausataurulifts.com | Synergy Wholesale Pty Ltd | 20 Nov 2015 | 6 Nov 2025 | 20 Nov 2026 |
| 504 | ausataurulift.com | Synergy Wholesale Pty Ltd | 20 Nov 2015 | 6 Nov 2025 | 20 Nov 2026 |
| 505 | ausaroughterrainforklifts.com | Synergy Wholesale Pty Ltd | 20 Nov 2015 | 6 Nov 2025 | 20 Nov 2026 |
| 506 | ausaroughterrainforklift.com | Synergy Wholesale Pty Ltd | 20 Nov 2015 | 6 Nov 2025 | 20 Nov 2026 |
| 507 | ausaforklift.com | Synergy Wholesale Pty Ltd | 20 Nov 2015 | 6 Nov 2025 | 20 Nov 2026 |
| 508 | ausalmon.work | Wild West Domains, LLC | 24 Nov 2015 | 24 Nov 2015 | 24 Nov 2016 |
| 509 | ausaccom.com | Synergy Wholesale Pty Ltd | 17 Jul 2022 | 17 Jul 2022 | 17 Jul 2023 |
| 510 | ausaltwirdneu.com | Key-Systems GmbH | 1 Dec 2015 | 6 Jan 2026 | 1 Dec 2026 |
| 511 | ausark.net | NameCheap, Inc. | 18 Oct 2019 | 18 Sep 2025 | 18 Oct 2026 |
| 512 | ausark.com | TurnCommerce, Inc. DBA NameBright.com | 19 Feb 2017 | 13 Feb 2021 | 19 Feb 2027 |
| 513 | ausadds.com | TPP Wholesale Pty Ltd. | 2 Dec 2015 | 2 Dec 2015 | 2 Dec 2016 |
| 514 | ausaway.com | - | 19 Jul 2022 | 20 Sep 2023 | 19 Jul 2023 |
| 515 | ausalonrouen.com | Tucows Domains Inc. | 29 Feb 2020 | 4 Mar 2021 | 28 Feb 2021 |
| 516 | ausandvic.com | GoDaddy.com, LLC | 8 Dec 2015 | 8 Dec 2015 | 8 Dec 2016 |
| 517 | ausableeclub.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2016 |
| 518 | ausaypn.org | Domain.com, LLC | 13 Dec 2015 | 7 Dec 2016 | 13 Dec 2017 |
| 519 | ausaw.com | Dynadot, LLC | 23 Sep 2022 | 19 Mar 2026 | 23 Sep 2026 |
| 520 | ausatobyhanna.org | register.com, Inc. | 17 Dec 2015 | 2 Dec 2016 | 17 Dec 2017 |
| 521 | ausaleairmax.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 12 Feb 2023 | 20 Feb 2024 | 12 Feb 2024 |
| 522 | ausazb.com | HiChina Zhicheng Technology Limited | 22 Dec 2015 | 23 Nov 2016 | 22 Dec 2017 |
| 523 | ausaisai.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 11 Mar 2018 | 11 Mar 2018 | 11 Mar 2019 |
| 524 | ausangkorasia.com | FastDomain Inc. | 23 Dec 2015 | 28 Dec 2016 | 23 Dec 2017 |
| 525 | ausamaine.org | eNom, Inc. | 23 Dec 2015 | 23 Dec 2015 | 23 Dec 2016 |
| 526 | ausarmusic.com | GoDaddy.com, LLC | 24 Dec 2015 | 25 Dec 2025 | 24 Dec 2026 |
| 527 | ausadentallab.com | Tucows Domains Inc. | 24 Dec 2012 | 28 Dec 2015 | 24 Dec 2016 |
| 528 | ausafri.com | eNom, Inc. | 29 Dec 2015 | 30 Dec 2016 | 29 Dec 2017 |
| 529 | ausautame.xyz | NameCheap, Inc. | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 530 | ausaidassist.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 531 | ausagaming.com | GoDaddy.com, LLC | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 532 | ausammy.org | Wild West Domains, LLC | 14 Jan 2016 | 14 Jan 2016 | 14 Jan 2017 |
| 533 | ausableresearch.com | Tucows Domains Inc. | 14 Jan 2016 | 18 Jan 2023 | 14 Jan 2024 |
| 534 | ausaddress.com | Amazon Registrar, Inc. | 16 Jan 2016 | 12 Dec 2025 | 16 Jan 2027 |
| 535 | ausalondedanse.com | OVH sas | 17 Jan 2016 | 17 Jan 2016 | 17 Jan 2017 |
| 536 | ausamerica.com | Dynadot, LLC | 18 Jan 2016 | 19 Jan 2026 | 18 Jan 2027 |
| 537 | ausartoamen.com | eNom, Inc. | 20 Jan 2016 | 15 Jan 2017 | 20 Jan 2018 |
| 538 | ausanco.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 22 Jan 2016 | 22 Jan 2016 | 22 Jan 2017 |
| 539 | ausableriversoap.com | Promo People inc. | 24 Jan 2016 | 17 Jan 2017 | 24 Jan 2018 |
| 540 | ausaautoparts.com | GoDaddy.com, LLC | 25 Jan 2016 | 25 Jan 2016 | 25 Jan 2018 |
| 541 | ausarrowsurvival.net | NetRegistry Pty Ltd. | 27 Jan 2016 | 28 Jan 2017 | 27 Jan 2018 |
| 542 | ausartung.com | Wix.com Ltd. | 28 Jan 2016 | 4 Jan 2026 | 28 Jan 2027 |
| 543 | ausangatetrips.com | GoDaddy.com, LLC | 5 May 2023 | 16 Jun 2025 | 5 May 2025 |
| 544 | ausablerivercanoemarathon.info | GoDaddy.com, LLC | 30 Jan 2016 | - | 30 Jan 2017 |
| 545 | ausablemarathon.info | GoDaddy.com, LLC | 30 Jan 2016 | - | 30 Jan 2017 |
| 546 | ausablecanoemarathon.info | GoDaddy.com, LLC | 30 Jan 2016 | - | 30 Jan 2017 |
| 547 | ausablerivercanoemarathon.org | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 30 Jan 2017 |
| 548 | ausablerivercanoemarathon.net | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 30 Jan 2017 |
| 549 | ausablerivercanoemarathon.com | DropCatch.com 1173 LLC | 18 Apr 2017 | 18 Apr 2017 | 18 Apr 2018 |
| 550 | ausablerivercanoemarathon.biz | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 29 Jan 2017 |
| 551 | ausablemarathon.org | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 30 Jan 2017 |
| 552 | ausablemarathon.net | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 30 Jan 2017 |
| 553 | ausablemarathon.com | TurnCommerce, Inc. DBA NameBright.com | 18 Apr 2017 | 12 Apr 2021 | 18 Apr 2026 |
| 554 | ausablemarathon.biz | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 29 Jan 2017 |
| 555 | ausablecanoemarathon.net | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 30 Jan 2017 |
| 556 | ausablecanoemarathon.com | Tucows Domains Inc. | 29 Sep 2017 | 31 Aug 2025 | 29 Sep 2026 |
| 557 | ausablecanoemarathon.biz | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 29 Jan 2017 |
| 558 | ausaobott.com | Beijing Lanhai Jiye Technology Co., Ltd | 5 Jul 2021 | 5 Jul 2023 | 5 Jul 2024 |
| 559 | ausablerivercanoemarathon.us | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 29 Jan 2017 |
| 560 | ausablemarathon.us | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 29 Jan 2017 |
| 561 | ausablecanoemarathon.us | GoDaddy.com, LLC | 30 Jan 2016 | 30 Jan 2016 | 29 Jan 2017 |
| 562 | ausa-steel.com | Tucows Domains Inc. | 29 Jan 1998 | 1 Feb 2016 | 28 Jan 2017 |
| 563 | ausavina.com | GMO Internet Inc. | 13 Oct 2009 | 19 Mar 2024 | 13 Oct 2026 |
| 564 | ausavon.com | GoDaddy.com, LLC | 1 Nov 2019 | 13 Dec 2024 | 1 Nov 2024 |
| 565 | ausask.com | TurnCommerce, Inc. DBA NameBright.com | 4 Apr 2019 | 5 May 2024 | 4 Apr 2024 |
| 566 | ausavon.asia | PlanetDomain Pty Ltd | 4 Feb 2016 | 5 Feb 2017 | 4 Feb 2018 |
| 567 | ausaltemholz.com | 1API GmbH | 4 Feb 2016 | 4 Feb 2016 | 4 Feb 2017 |
| 568 | ausair.net | Crazy Domains FZ-LLC | 17 May 2017 | 28 May 2022 | 17 May 2022 |
| 569 | ausablepottery.com | Tucows Domains Inc. | 6 Feb 2016 | 22 Jan 2026 | 6 Feb 2027 |
| 570 | ausalaryflowingwater.com | Zhengzhou Zitian Network Technology Co., Ltd | 7 Feb 2016 | 7 Feb 2016 | 7 Feb 2018 |
| 571 | ausavoirflair.com | 1&1 Internet AG | 9 Feb 2016 | 10 Feb 2017 | 9 Feb 2018 |
| 572 | ausamatuer.net | GoDaddy.com, LLC | 9 Feb 2016 | 9 Feb 2016 | 9 Feb 2017 |
| 573 | ausamatuer.com | GoDaddy.com, LLC | 9 Feb 2016 | 9 Feb 2016 | 9 Feb 2018 |
| 574 | ausafactions.com | GoDaddy.com, LLC | 11 Feb 2016 | 11 Feb 2016 | 11 Feb 2017 |
| 575 | ausabazaar.com | GoDaddy.com, LLC | 11 Feb 2016 | 11 Feb 2016 | 11 Feb 2018 |
| 576 | ausadenver.org | eNom, Inc. | 10 Feb 2016 | 10 Feb 2016 | 10 Feb 2017 |
| 577 | ausalsa.com | Shanghai Meicheng Technology Information Co., Ltd | 12 Feb 2016 | 12 Feb 2016 | 12 Feb 2017 |
| 578 | ausassetdev.com | Melbourne IT, Ltd | 16 Feb 2016 | 12 Feb 2026 | 16 Feb 2027 |
| 579 | ausableproduce.com | easyDNS Technologies, Inc. | 6 Feb 2008 | 5 Feb 2025 | 6 Feb 2027 |
| 580 | ausarbeitungen.info | Mesh Digital Limited | 19 Feb 2016 | 8 Jun 2017 | 19 Feb 2018 |
| 581 | ausagolf.org | GoDaddy.com, LLC | 19 Feb 2016 | 29 Oct 2016 | 19 Feb 2018 |
| 582 | ausablehardware.com | FastDomain Inc. | 20 Feb 2016 | 5 Feb 2026 | 20 Feb 2027 |
| 583 | ausamexico.com | Web Commerce Communications Limited dba WebNic.cc | 14 May 2023 | 24 Jul 2024 | 14 May 2024 |
| 584 | ausablerivermfg.com | 1&1 Internet AG | 23 Feb 2016 | 18 Jan 2017 | 23 Feb 2018 |
| 585 | ausabletownship.net | TLDs LLC dba SRSplus | 26 Sep 2000 | 27 Sep 2025 | 26 Sep 2026 |
| 586 | ausarrowmc.net | GoDaddy.com, LLC | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
| 587 | ausatexas.org | Tucows Domains Inc. | 9 Jun 2024 | 15 May 2025 | 9 Jun 2026 |
| 588 | ausauraair.com | Namesilo, LLC | 16 May 2021 | 20 Jul 2023 | 16 May 2023 |
| 589 | ausa-alamochapter.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Feb 2016 | 26 Feb 2016 | 26 Feb 2017 |
| 590 | ausa-alamochapter.com | GoDaddy.com, LLC | 28 Feb 2016 | 28 Feb 2016 | 28 Feb 2017 |
| 591 | ausaglac.org | GMO Internet Inc. | 12 May 2016 | 19 Apr 2017 | 12 May 2018 |
| 592 | ausante.org | Register NV dba Register.eu | 14 Nov 2008 | 29 Dec 2025 | 14 Nov 2026 |
| 593 | ausabledumpster.com | Tucows Domains Inc. | 3 Mar 2016 | 16 Feb 2026 | 3 Mar 2027 |
| 594 | ausawardpackaging.com.au | - | - | - | - |
| 595 | ausandals.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 5 Jan 2022 | 5 Jan 2022 | 5 Jan 2023 |
| 596 | ausalearning.com | Tucows Domains Inc. | 5 Mar 2016 | 9 Mar 2019 | 5 Mar 2019 |
| 597 | ausajadossa.com | 1&1 Internet AG | 7 Mar 2016 | 7 Mar 2016 | 7 Mar 2017 |
| 598 | ausatampabay.org | GoDaddy.com, LLC | 9 Mar 2016 | 9 Mar 2016 | 9 Mar 2017 |
| 599 | ausablecabin.net | GoDaddy.com, LLC | 9 Mar 2016 | 9 Mar 2016 | 9 Mar 2017 |
| 600 | ausapt.info | Network Solutions, LLC | 11 Mar 2016 | 11 Mar 2016 | 11 Mar 2017 |
| 601 | ausatacoma.com | - | 29 May 2024 | 30 May 2025 | 29 May 2026 |
| 602 | ausaffordableloans.com | eNom, Inc. | 13 Mar 2016 | 14 Mar 2017 | 13 Mar 2018 |
| 603 | ausahlc.org | GoDaddy.com, LLC | 15 Mar 2016 | 16 Mar 2017 | 15 Mar 2018 |
| 604 | ausacrylics.com | GoDaddy.com, LLC | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 605 | ausatampabaylogin.com | Wild West Domains, LLC | 16 Mar 2016 | 16 Mar 2016 | 16 Mar 2017 |
| 606 | ausadamsmd.com | GoDaddy.com, LLC | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 607 | ausar.com | - | 4 Dec 2002 | 3 Apr 2024 | 4 Dec 2027 |
| 608 | ausawinter.org | GMO Internet Inc. | 4 Jun 2017 | 10 Aug 2017 | 4 Jun 2018 |
| 609 | ausassignmenthelp.com | GoDaddy.com, LLC | 19 Mar 2016 | 21 Mar 2026 | 19 Mar 2028 |
| 610 | ausassociation.com | GoDaddy.com, LLC | 23 Mar 2016 | 23 Mar 2016 | 23 Mar 2017 |
| 611 | ausanges.com | Tucows Domains Inc. | 20 Mar 2012 | 20 Mar 2012 | 20 Mar 2017 |
| 612 | ausabs.com | Tucows Domains Inc. | 24 Mar 2016 | 16 Mar 2026 | 24 Mar 2027 |
| 613 | ausagolf.com | Amazon Registrar, Inc. | 25 Mar 2016 | 18 Feb 2026 | 25 Mar 2027 |
| 614 | ausapts.info | GoDaddy.com, LLC | 26 Mar 2016 | 25 May 2016 | 26 Mar 2018 |
| 615 | ausapts.net | GoDaddy.com, LLC | 26 Mar 2016 | 26 Mar 2016 | 26 Mar 2018 |
| 616 | ausapts.apartments | GoDaddy.com, LLC | 26 Mar 2016 | 26 Mar 2016 | 26 Mar 2018 |
| 617 | ausatechnologies.com | Key-Systems GmbH | 4 Apr 2020 | 4 Apr 2020 | 4 Apr 2021 |
| 618 | ausale.net | HiChina Zhicheng Technology Limited | 15 Feb 2019 | 15 Feb 2019 | 15 Feb 2020 |
| 619 | ausabate.com | GoDaddy.com, LLC | 1 Apr 2016 | 1 Apr 2016 | 1 Apr 2017 |
| 620 | ausapartment.com | NameCheap, Inc. | 6 Jun 2022 | 18 Jul 2023 | 6 Jun 2023 |
| 621 | ausadh.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Apr 2016 | 4 Apr 2016 | 4 Apr 2017 |
| 622 | ausadh.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Apr 2016 | 4 Apr 2016 | 4 Apr 2017 |
| 623 | ausableriveroutfitters.com | GoDaddy.com, LLC | 5 Apr 2016 | 6 Apr 2026 | 5 Apr 2031 |
| 624 | ausarentertainment.com | Name.com, Inc. | 6 Apr 2016 | 19 Jun 2025 | 6 Apr 2025 |
| 625 | ausadultservices.com | Crazy Domains FZ-LLC | 3 Mar 2014 | 3 Mar 2014 | 3 Mar 2017 |
| 626 | ausapparelstore.com | GoDaddy.com, LLC | 9 Apr 2016 | 9 Apr 2016 | 9 Apr 2017 |
| 627 | ausapparelgroup.com | GoDaddy.com, LLC | 9 Apr 2016 | 9 Apr 2016 | 9 Apr 2017 |
| 628 | ausangaterainbow.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Apr 2016 | 22 Jun 2025 | 10 Apr 2025 |
| 629 | ausanatural.com | GoDaddy.com, LLC | 11 Apr 2016 | 11 Apr 2016 | 11 Apr 2018 |
| 630 | ausafa.com | Metaregistrar BV Applications | 29 Mar 2026 | 29 Mar 2026 | 29 Mar 2027 |
| 631 | ausaberwirdund.org | InterNetworX Ltd. & Co. KG | 10 Apr 2016 | 10 Apr 2016 | 10 Apr 2017 |
| 632 | ausangatemountain.com | GoDaddy.com, LLC | 13 Nov 2024 | 6 Feb 2026 | 13 Nov 2026 |
| 633 | ausalliance.com | NameCheap, Inc. | 7 Nov 2025 | 7 Nov 2025 | 7 Nov 2026 |
| 634 | ausangatetours.com | Namesilo, LLC | 4 Mar 2022 | 4 Mar 2026 | 4 Mar 2027 |
| 635 | ausawiregrass.org | Namesilo, LLC | 16 Apr 2012 | 16 Apr 2026 | 16 Apr 2027 |
| 636 | ausarin.com | GoDaddy.com, LLC | 23 Aug 2023 | 23 Aug 2023 | 23 Aug 2024 |
| 637 | ausace2013.com | GMO Internet Inc. | 21 Apr 2016 | 21 Apr 2016 | 21 Apr 2017 |
| 638 | ausagresourcing.com | Tucows Domains Inc. | 24 Apr 2016 | 28 Apr 2018 | 24 Apr 2018 |
| 639 | ausaruco.com | eNom, Inc. | 25 Apr 2016 | 25 Apr 2016 | 25 Apr 2017 |
| 640 | ausangaterainbowmountain.com | NameCheap, Inc. | 28 Oct 2020 | - | 28 Oct 2021 |
| 641 | ausandnzbettingexchange.com | CSC Corporate Domains, Inc. | 26 Apr 2016 | 24 May 2023 | 26 Apr 2023 |
| 642 | ausairportparkinglot.com | GoDaddy.com, LLC | 27 Apr 2016 | 9 May 2024 | 27 Apr 2025 |
| 643 | ausavenue.com | Instra Corporation Pty Ltd. | 16 Mar 2024 | 15 Jan 2025 | 16 Mar 2026 |
| 644 | ausalcrm.com | Realtime Register B.V. | 4 May 2016 | 25 Mar 2024 | 4 May 2026 |
| 645 | ausa-catoctin.org | Domain.com, LLC | 6 May 2016 | 26 Apr 2025 | 6 May 2026 |
| 646 | ausangatevinicuncatrek.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 647 | ausarbeiten.dental | united-domains AG | 10 May 2016 | 24 Jun 2017 | 10 May 2018 |
| 648 | ausanderenaugen.com | - | 11 May 2016 | 11 May 2016 | 11 May 2017 |
| 649 | ausarsrl.com | GoDaddy.com, LLC | 13 May 2016 | 13 May 2016 | 13 May 2019 |
| 650 | ausafrica.org | Tucows Domains Inc. | 16 May 2016 | 20 May 2017 | 16 May 2018 |
| 651 | ausapps.com | CloudFlare, Inc. | 21 Mar 2026 | 29 Mar 2026 | 21 Mar 2029 |
| 652 | ausae.mobi | Gandi SAS | 17 May 2016 | 22 Mar 2017 | 17 May 2018 |
| 653 | ausasia-mintech.com | - | 20 May 2016 | 20 May 2016 | 20 May 2017 |
| 654 | ausangatetrail.com | NameCheap, Inc. | 23 Feb 2022 | 24 Jan 2026 | 23 Feb 2027 |
| 655 | ausarismusic.com | Gandi SAS | 22 May 2016 | 22 May 2016 | 22 May 2017 |
| 656 | ausafartindia.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Dec 2020 | 18 Feb 2025 | 7 Dec 2024 |
| 657 | ausarewards.com | GoDaddy.com, LLC | 23 May 2016 | 23 May 2016 | 23 May 2017 |
| 658 | ausada.com | Moniker Online Services LLC | 26 Jul 2008 | 25 Nov 2025 | 26 Jul 2026 |
| 659 | ausate.top | Alpnames Limited | 13 May 2016 | 13 May 2017 | 13 May 2018 |
| 660 | ausablemotors.com | Domainsalsa.com LLC | 14 Aug 2018 | 14 Aug 2018 | 14 Aug 2019 |
| 661 | ausaittexas.com | GoDaddy.com, LLC | 27 May 2016 | 27 May 2016 | 27 May 2017 |
| 662 | ausabl.com | NameCheap, Inc. | 30 Apr 2025 | 30 Apr 2025 | 30 Apr 2026 |
| 663 | ausatel.cat | Soluciones Corporativas IP, SLU | 21 Apr 2006 | 25 Mar 2026 | 21 Apr 2027 |
| 664 | ausafworld.com | GoDaddy.com, LLC | 31 May 2016 | 31 May 2016 | 31 May 2017 |
| 665 | ausamerican.com | GMO Internet Inc. | 27 Apr 2026 | 27 Apr 2026 | 27 Apr 2027 |
| 666 | ausableforks.city | Epik Inc. | 1 Jun 2016 | 16 Jul 2017 | 1 Jun 2018 |
| 667 | ausableway.rocks | eNom, Inc. | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 668 | ausableway.org | eNom, Inc. | 1 Jun 2016 | 7 Jul 2017 | 1 Jun 2018 |
| 669 | ausarmahub.com | eNom, Inc. | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 670 | ausableway.com | Go China Domains, LLC | 19 Aug 2018 | 19 Aug 2018 | 19 Aug 2019 |
| 671 | ausagar.com | Hebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.… | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 672 | ausability.com | GoDaddy.com, LLC | 14 Jan 2026 | 14 Jan 2026 | 14 Jan 2028 |
| 673 | ausa-ar.com | GoDaddy.com, LLC | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 674 | ausadie.com | FastDomain Inc. | 5 Jun 2016 | 18 Jul 2025 | 5 Jun 2025 |
| 675 | ausabenefits.net | GoDaddy.com, LLC | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2018 |
| 676 | ausabenefits.com | GoDaddy.com, LLC | 6 Jun 2016 | 7 Jun 2025 | 6 Jun 2026 |
| 677 | ausabletanemura.xyz | - | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 678 | ausanzeal.com | Tucows Domains Inc. | 5 Jun 2014 | 5 Jun 2014 | 5 Jun 2017 |
| 679 | ausadhighar.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Jun 2016 | 9 Jun 2016 | 9 Jun 2017 |
| 680 | ausairconditioning.com | Key-Systems GmbH | 13 Jun 2016 | 19 Jan 2026 | 13 Jun 2026 |
| 681 | ausalesdepot.com | eNom, Inc. | 13 Jun 2016 | 13 Jun 2016 | 13 Jun 2017 |
| 682 | ausafortlewis.com | Realtime Register B.V. | 9 May 2021 | 10 May 2021 | 9 May 2022 |
| 683 | ausagrup.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 26 Dec 2021 | 26 Dec 2021 | 26 Dec 2022 |
| 684 | ausadmission.com | CloudFlare, Inc. | 31 Jan 2023 | 12 Mar 2025 | 31 Jan 2025 |
| 685 | ausablenorthbranch.org | Network Solutions, LLC | 16 Jun 2016 | 22 May 2025 | 16 Jun 2028 |
| 686 | ausabroad.com | GMO Internet Inc. | 5 May 2025 | 15 Dec 2025 | 5 May 2026 |
| 687 | ausableriverfestival.com | GoDaddy.com, LLC | 20 Jun 2016 | 13 Aug 2025 | 20 Jun 2026 |
| 688 | ausangatereviews.com | Name.com, Inc. | 22 Jun 2016 | 20 Jun 2017 | 22 Jun 2018 |
| 689 | ausautotransport.com | Crazy Domains FZ-LLC | 19 May 2010 | 19 Feb 2019 | 19 May 2019 |
| 690 | ausattradingmethod.xyz | - | 22 Jun 2016 | 22 Jun 2016 | 22 Jun 2017 |
| 691 | ausatraliabinarytrades.xyz | - | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2017 |
| 692 | ausatradingrewards.xyz | - | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2017 |
| 693 | ausablefurs.com | GoDaddy.com, LLC | 24 Jun 2016 | 24 Jun 2016 | 24 Jun 2017 |
| 694 | ausafterhours.com.au | WebTrends Corporation | - | 29 Mar 2016 | - |
| 695 | ausabihar.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 696 | ausasiamall.net | register.com, Inc. | 28 Jun 2016 | 13 Jun 2017 | 28 Jun 2018 |
| 697 | ausablefreeclinic.org | Domain.com, LLC | 29 Jun 2016 | 29 Jun 2016 | 29 Jun 2017 |
| 698 | ausaint-louisculvieillehavreplan.top | 1API GmbH | 29 Jun 2016 | 29 Jun 2016 | 29 Jun 2017 |
| 699 | ausamapparel.us | GoDaddy.com, LLC | 2 Jul 2016 | 2 Jul 2017 | 1 Jul 2018 |
| 700 | ausamapparel.net | GoDaddy.com, LLC | 2 Jul 2016 | 2 Jul 2016 | 2 Jul 2017 |
| 701 | ausamapparel.info | GoDaddy.com, LLC | 2 Jul 2016 | 3 Jul 2017 | 2 Jul 2018 |
| 702 | ausaftechnologies.com | Tucows Domains Inc. | 30 Jun 2014 | 30 Jun 2014 | 30 Jun 2017 |
| 703 | ausaftech.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Feb 2024 | 7 Feb 2026 | 7 Feb 2027 |
| 704 | ausalewischapter.com | GMO Internet Inc. | 2 Dec 2017 | - | 1 Dec 2018 |
| 705 | ausagco.com | GoDaddy.com, LLC | 4 Jul 2016 | 4 Jul 2016 | 4 Jul 2018 |
| 706 | ausalife.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jul 2016 | 17 Aug 2017 | 6 Jul 2018 |
| 707 | ausaudio.net | Gandi SAS | 6 Jul 2016 | 5 Jun 2017 | 6 Jul 2018 |
| 708 | ausavoirfer.com | OVH sas | 7 Jun 2016 | 8 Jun 2025 | 7 Jun 2026 |
| 709 | ausablekoujiya.xyz | GMO Internet Inc. | 7 Jun 2016 | 7 Jun 2016 | 7 Jun 2017 |
| 710 | ausaccommodation.info | DiaMatrix C.C. | 8 Jun 2016 | 5 Jun 2017 | 8 Jun 2018 |
| 711 | ausails.com | DomainHood LLC | 22 Aug 2018 | 22 Aug 2018 | 22 Aug 2019 |
| 712 | ausakaendorse.xyz | GMO Internet Inc. | 8 Jun 2016 | 17 Jun 2016 | 8 Jun 2017 |
| 713 | ausakaumakoshi.xyz | GMO Internet Inc. | 8 Jun 2016 | 17 Jun 2016 | 8 Jun 2017 |
| 714 | ausatraliabinarytrends.xyz | - | 8 Jul 2016 | 8 Jul 2016 | 8 Jul 2017 |
| 715 | ausasiapmg.com | Bizcn.com, Inc. | 4 Jun 2020 | 4 Jun 2020 | 4 Jun 2021 |
| 716 | ausaton.com | Namesilo, LLC | 11 Jul 2016 | 11 Jul 2016 | 11 Jul 2017 |
| 717 | ausangate.biz | GoDaddy.com, LLC | 12 Jul 2016 | 22 Aug 2024 | 11 Jul 2024 |
| 718 | ausastro.in | - | 2 Jan 2013 | 4 Dec 2015 | 2 Jan 2019 |
| 719 | ausapatriot.org | Tucows Domains Inc. | 13 Jul 2016 | 28 Jun 2017 | 13 Jul 2018 |
| 720 | ausaffiliates.com | - | 15 Jul 2016 | 15 Jul 2016 | 15 Jul 2017 |
| 721 | ausann.com | GoDaddy.com, LLC | 22 Jan 2009 | 20 Jan 2026 | 22 Jan 2027 |
| 722 | ausape.biz | Acens Technologies, S.L.U. | 15 Jan 2002 | 22 Dec 2019 | 14 Jan 2021 |
| 723 | ausart.biz | Tucows Domains Inc. | 11 Aug 2014 | 14 Aug 2017 | 10 Aug 2017 |
| 724 | ausaccom.biz | GoDaddy.com, LLC | 25 Feb 2004 | 2 Mar 2019 | 24 Feb 2021 |
| 725 | ausasteel.biz | Soluciones Corporativas IP, SLU | 15 Jun 2007 | 24 Oct 2025 | 14 Jun 2026 |
| 726 | ausableacres.biz | GoDaddy.com, LLC | 16 Feb 2013 | 27 Feb 2017 | 15 Feb 2017 |
| 727 | ausante.biz | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 14 Nov 2008 | 20 Nov 2025 | 13 Nov 2026 |
| 728 | ausairportparkingreservations.com | GoDaddy.com, LLC | 17 Jul 2016 | 18 Jul 2025 | 17 Jul 2026 |
| 729 | ausairportparking.net | GoDaddy.com, LLC | 18 Jul 2016 | 18 Jul 2025 | 18 Jul 2026 |
| 730 | ausairportparkingreservations.net | GoDaddy.com, LLC | 18 Jul 2016 | 18 Jul 2025 | 18 Jul 2026 |
| 731 | ausafe.com | GoDaddy.com, LLC | 2 Oct 2018 | 8 Nov 2025 | 2 Oct 2026 |
| 732 | ausahighdesert.org | register.com, Inc. | 20 Jul 2016 | 20 Jul 2017 | 20 Jul 2018 |
| 733 | ausamenergy.com | TurnCommerce, Inc. DBA NameBright.com | 21 Jul 2016 | 3 Nov 2025 | 21 Jul 2026 |
| 734 | ausamail.com | GoDaddy.com, LLC | 15 Aug 2024 | 16 Aug 2025 | 15 Aug 2026 |
| 735 | ausar.site | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 736 | ausac.com | GoDaddy.com, LLC | 23 Jul 2016 | 8 Nov 2025 | 23 Jul 2026 |
| 737 | ausafahmed.com | 1&1 Internet AG | 16 Oct 2018 | 16 Oct 2018 | 16 Oct 2019 |
| 738 | ausacdny.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 26 Jan 2025 | 9 Feb 2026 | 26 Jan 2027 |
| 739 | ausaura.com | Squarespace Domains LLC | 3 May 2024 | 19 Apr 2025 | 3 May 2026 |
| 740 | ausautoart.com | NameCheap, Inc. | 24 May 2022 | 5 Jul 2023 | 24 May 2023 |
| 741 | ausautofinder.com | Tucows Domains Inc. | 9 Apr 2008 | 8 Apr 2026 | 9 Apr 2027 |
| 742 | ausablewood.com | GoDaddy.com, LLC | 6 Jun 2006 | 6 Jun 2016 | 6 Jun 2017 |
| 743 | ausalonstyle.com | Hongkong Domain Name Information Management Co., L… | 9 Apr 2021 | 9 Apr 2021 | 9 Apr 2022 |
| 744 | ausach.com | GoDaddy.com, LLC | 13 Dec 2006 | 13 Dec 2024 | 13 Dec 2029 |
| 745 | ausaevents.com | Click Registrar, Inc. d/b/a publicdomainregistry.c… | 21 Mar 2022 | 2 Jun 2023 | 21 Mar 2023 |
| 746 | ausablegrovepresbyterian.com | GoDaddy.com, LLC | 2 Jan 2008 | 3 Jan 2016 | 2 Jan 2021 |
| 747 | ausaboxing.com | - | 28 Feb 2024 | 1 Mar 2025 | 28 Feb 2026 |
| 748 | ausairuniforms.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 Mar 2022 | 4 May 2024 | 2 Mar 2024 |
| 749 | ausastonewall.com | Google, Inc. | 25 Jan 2015 | 7 Feb 2017 | 25 Jan 2019 |
| 750 | ausautdulit.com | GoDaddy.com, LLC | 27 May 2008 | 27 May 2025 | 27 May 2026 |
| 751 | ausaia.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 Jun 2013 | 4 Mar 2026 | 4 Jun 2026 |
| 752 | ausam.com | Dynadot, LLC | 3 Jul 1997 | 18 Jun 2025 | 2 Jul 2026 |
| 753 | ausamarok.com | - | 23 Mar 2023 | 25 May 2024 | 23 Mar 2024 |
| 754 | ausablevalleywoodworks.com | GoDaddy.com, LLC | 29 Aug 2013 | 13 Jun 2015 | 29 Aug 2017 |
| 755 | ausacolumbiariver.com | GoDaddy.com, LLC | 7 Jan 2009 | 9 Dec 2011 | 7 Jan 2017 |
| 756 | ausarchery.com | TurnCommerce, Inc. DBA NameBright.com | 28 Nov 2021 | 30 Dec 2023 | 28 Nov 2023 |
| 757 | ausalange.com | - | 20 May 2023 | 21 Jun 2024 | 20 May 2024 |
| 758 | ausableanglers.com | Tirupati Domains And Hosting Pvt. Ltd. | 31 Mar 2013 | 1 Apr 2025 | 31 Mar 2026 |
| 759 | ausadultsonly.com | TPP Wholesale Pty Ltd. | 27 May 2014 | 22 May 2015 | 27 May 2017 |
| 760 | ausave.com | GoDaddy.com, LLC | 15 Sep 2004 | 7 Dec 2025 | 15 Sep 2026 |
| 761 | ausaba.com | TurnCommerce, Inc. DBA NameBright.com | 5 Jan 2022 | 15 Feb 2025 | 5 Jan 2025 |
| 762 | ausalvage.com | GoDaddy.com, LLC | 2 Jul 2007 | 2 Jul 2015 | 2 Jul 2017 |
| 763 | ausableboats.com | DropCatch.com 1008 LLC | 17 Apr 2023 | 18 May 2024 | 17 Apr 2024 |
| 764 | ausax.com | Annulet LLC | 23 Aug 2005 | 24 Aug 2025 | 23 Aug 2026 |
| 765 | ausangatetour.com | GoDaddy.com, LLC | 13 Nov 2024 | 14 Nov 2025 | 13 Nov 2026 |
| 766 | ausaf.com | GoDaddy.com, LLC | 31 Jul 2004 | 31 Aug 2024 | 31 Jul 2027 |
| 767 | ausajula.com | GoDaddy.com, LLC | 3 Dec 2013 | 4 May 2015 | 3 Dec 2016 |
| 768 | ausacc6105.com | Network Solutions, LLC | 20 Mar 2014 | 5 Mar 2016 | 20 Mar 2017 |
| 769 | ausasia.com | Domain.com, LLC | 17 Feb 2002 | 26 Feb 2026 | 17 Feb 2027 |
| 770 | ausartak.com | Aquarius Domains, LLC | 27 Sep 2020 | 28 Sep 2020 | 27 Sep 2021 |
| 771 | ausangle.com | Tucows Domains Inc. | 15 Jun 2025 | 16 Jun 2025 | 15 Jun 2026 |
| 772 | ausab.com | TurnCommerce, Inc. DBA NameBright.com | 16 Mar 2011 | 3 Nov 2025 | 16 Mar 2027 |
| 773 | ausacan.com | GoDaddy.com, LLC | 24 Mar 2009 | 24 Mar 2026 | 24 Mar 2027 |
| 774 | ausairways.com | NameKing.com Inc. | 12 Nov 2004 | 5 Nov 2025 | 12 Nov 2026 |
| 775 | ausano.com | GoDaddy.com, LLC | 15 Aug 2004 | 8 Oct 2024 | 15 Aug 2026 |
| 776 | ausangatetrekperu.com | GoDaddy.com, LLC | 29 Apr 2011 | 30 Apr 2025 | 29 Apr 2026 |
| 777 | ausaco.com | Network Solutions, LLC | 3 Oct 2001 | 3 Aug 2021 | 3 Oct 2026 |
| 778 | ausableadvisors.com | Network Solutions, LLC | 6 Apr 2007 | 5 Feb 2026 | 6 Apr 2027 |
| 779 | ausambiotech.com | - | 5 Oct 2016 | 5 Oct 2016 | 5 Oct 2017 |
| 780 | ausasteel.com | Soluciones Corporativas IP, SLU | 1 Oct 2001 | 1 Sep 2025 | 1 Oct 2030 |
| 781 | ausangatetreks.com | Hostinger, UAB | 12 Apr 2025 | 12 Apr 2025 | 12 Apr 2027 |
| 782 | ausabot.com | OVH sas | 7 Jan 2002 | 8 Sep 2025 | 7 Jan 2027 |
| 783 | ausablevalleytrailriders.com | eNom, Inc. | 22 Jan 2010 | 24 Dec 2025 | 22 Jan 2027 |
| 784 | ausaglac.com | GoDaddy.com, LLC | 27 Jan 2015 | 22 Jan 2018 | 27 Jan 2019 |
| 785 | ausablefabrics.com | TLDs LLC dba SRSplus | 10 May 2014 | 25 Apr 2017 | 10 May 2018 |
| 786 | ausableforksfreelibrary.com | eNom, Inc. | 19 Jun 2006 | 21 May 2025 | 19 Jun 2026 |
| 787 | ausaregional2013.com | GoDaddy.com, LLC | 2 Nov 2012 | 3 Nov 2015 | 2 Nov 2016 |
| 788 | ausablewulff.com | NameCheap, Inc. | 7 Nov 1996 | 7 Oct 2025 | 6 Nov 2026 |
| 789 | ausagent.com | GoDaddy.com, LLC | 15 Jun 2025 | 15 Jun 2025 | 15 Jun 2026 |
| 790 | ausamovar.com | TurnCommerce, Inc. DBA NameBright.com | 11 May 2004 | 23 Jul 2024 | 11 May 2024 |
| 791 | ausaps.com | GoDaddy.com, LLC | 24 Feb 2025 | 24 Feb 2025 | 24 Feb 2028 |
| 792 | ausapt.com | Network Solutions, LLC | 24 Nov 1995 | 28 Sep 2023 | 23 Nov 2028 |
| 793 | ausablefishing.com | GoDaddy.com, LLC | 24 Apr 2012 | 19 Apr 2016 | 24 Apr 2017 |
| 794 | ausamstrong.com | GoDaddy.com, LLC | 6 Jun 2014 | 4 May 2016 | 6 Jun 2017 |
| 795 | ausainsurance.com | MarkMonitor Inc. | 7 Feb 2003 | 6 Jan 2026 | 7 Feb 2027 |
| 796 | ausabledesign.com | NameCheap, Inc. | 29 Dec 2008 | 16 Dec 2025 | 29 Dec 2026 |
| 797 | ausasiabusinessweekly.com | GoDaddy.com, LLC | 14 Oct 2009 | 15 Oct 2025 | 14 Oct 2026 |
| 798 | ausalumni.com | GoDaddy.com, LLC | 29 Jul 2011 | 23 Jul 2025 | 29 Jul 2026 |
| 799 | ausartlia.com | register.com, Inc. | 20 Sep 2011 | 7 Sep 2025 | 20 Sep 2027 |
| 800 | ausaconstructors.com | Nominalia Internet S.L. | 9 Sep 2008 | 23 Nov 2016 | 21 Oct 2017 |
| 801 | ausavo.com | PSI-USA, Inc. dba Domain Robot | 3 Dec 2020 | 3 Dec 2020 | 3 Dec 2021 |
| 802 | ausajailsolutions.com | GoDaddy.com, LLC | 14 Jan 2014 | 15 Jan 2016 | 14 Jan 2017 |
| 803 | ausaumon-wasselonne.com | Namebay SAM | 26 May 2005 | 27 Mar 2016 | 26 May 2017 |
| 804 | ausamstrolleystop.com | GoDaddy.com, LLC | 8 May 2013 | 19 Jul 2023 | 8 May 2023 |
| 805 | ausaflorist.com | Domain.com, LLC | 1 Jul 1998 | 24 Jun 2025 | 30 Jun 2026 |
| 806 | ausaero.com | Hostinger, UAB | 3 Feb 2026 | 3 Feb 2026 | 3 Feb 2029 |
| 807 | ausair.com | GoDaddy.com, LLC | 7 May 2003 | 18 Mar 2025 | 7 May 2032 |
| 808 | ausago.com | Soluciones Corporativas IP, SLU | 12 Jan 2011 | 8 Jan 2026 | 12 Jan 2027 |
| 809 | ausages.com | Key-Systems GmbH | 16 Sep 2012 | 28 Nov 2025 | 16 Sep 2026 |
| 810 | ausafricarts.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 28 Apr 2016 | 28 Jun 2017 | 28 Apr 2018 |
| 811 | ausavondemarseille.com | Register NV dba Register.eu | 18 Nov 2004 | 22 Nov 2025 | 18 Nov 2026 |
| 812 | ausau.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 18 Sep 2012 | 29 Nov 2024 | 18 Sep 2026 |
| 813 | ausaarsenalofdemocracy.com | GoDaddy.com, LLC | 16 Sep 2011 | 21 Sep 2024 | 16 Sep 2026 |
| 814 | ausablebrewingco.com | FastDomain Inc. | 15 Nov 2013 | 15 Nov 2016 | 15 Nov 2017 |
| 815 | ausableinternational.com | Tucows Domains Inc. | 18 Nov 2010 | 20 Oct 2025 | 18 Nov 2026 |
| 816 | ausavoirfaire.com | TurnCommerce, Inc. DBA NameBright.com | 22 May 2020 | 23 Jun 2024 | 22 May 2024 |
| 817 | ausace.com | GoDaddy.com, LLC | 15 Jun 2011 | 28 Oct 2025 | 15 Jun 2026 |
| 818 | ausasiahealth.com | Web Commerce Communications Limited dba WebNic.cc | 7 Jul 2022 | 16 Sep 2023 | 7 Jul 2023 |
| 819 | ausangels.com | Wild West Domains, LLC | 4 Jan 2001 | 3 Nov 2025 | 3 Nov 2026 |
| 820 | ausasiaproperties.com | GoDaddy.com, LLC | 30 Jan 2014 | 30 Jan 2016 | 30 Jan 2018 |
| 821 | ausangatealpacas.com | GoDaddy.com, LLC | 9 Oct 2010 | 10 Oct 2015 | 9 Oct 2017 |
| 822 | ausableflyfishing.com | eNom, Inc. | 12 Dec 2000 | 11 Dec 2025 | 12 Dec 2026 |
| 823 | ausable.com | GoDaddy.com, LLC | 4 Dec 2003 | 14 Nov 2025 | 4 Dec 2026 |
| 824 | ausa-kuwait.com | 35 Technology Co., Ltd. | 23 Jun 2022 | 1 Sep 2023 | 23 Jun 2023 |
| 825 | ausathlete.com | Synergy Wholesale Pty Ltd | 23 Feb 2022 | 3 Apr 2023 | 23 Feb 2024 |
| 826 | ausappcentre.com | GoDaddy.com, LLC | 8 Mar 2014 | 8 Mar 2016 | 8 Mar 2017 |
| 827 | ausainsure.com | MarkMonitor Inc. | 4 Nov 2004 | 28 Oct 2025 | 4 Nov 2026 |
| 828 | ausafari.com | GoDaddy.com, LLC | 6 Nov 2002 | 18 Aug 2025 | 18 Aug 2026 |
| 829 | ausai.com | - | 7 Dec 2009 | 10 Mar 2026 | 7 Dec 2026 |
| 830 | ausadao.com | Jiangsu Bangning Science and technology Co. Ltd. | 31 Aug 2013 | 24 Sep 2015 | 31 Aug 2016 |
| 831 | ausafdaily.com | Launchpad, Inc. | 5 Apr 2012 | 22 Aug 2017 | 5 Apr 2018 |
| 832 | ausaeventnotebook.com | PSI-USA, Inc. dba Domain Robot | 15 Jan 2013 | 12 Mar 2017 | 15 Jan 2018 |
| 833 | ausadults.com | Porkbun, LLC | 24 Apr 2020 | 8 May 2025 | 24 Apr 2026 |
| 834 | ausamgroup.com | Crazy Domains FZ-LLC | 19 Jan 2009 | 11 Jan 2025 | 19 Jan 2027 |
| 835 | ausaappliance.com | GoDaddy.com, LLC | 5 Feb 2009 | 5 Feb 2025 | 5 Feb 2027 |
| 836 | ausabletroutfitters.com | Tucows Domains Inc. | 25 Jan 2008 | 27 Dec 2025 | 25 Jan 2027 |
| 837 | ausablemarketingprofessionals.com | GoDaddy.com, LLC | 10 Apr 2013 | 11 Apr 2016 | 10 Apr 2017 |
| 838 | ausaintsbookstore.com | GoDaddy.com, LLC | 13 Dec 2021 | 13 Dec 2021 | 13 Dec 2022 |
| 839 | ausablevalleygrangefarmersmarkets.com | GMO Internet Inc. | 15 May 2023 | 18 Nov 2025 | 15 May 2026 |
| 840 | ausableriverhomeprices.com | GoDaddy.com, LLC | 5 Jun 2014 | 6 Jun 2016 | 5 Jun 2017 |
| 841 | ausarten.com | GoDaddy.com, LLC | 31 Dec 2021 | 20 Dec 2025 | 31 Dec 2026 |
| 842 | ausableurgentcare.com | eNom, Inc. | 14 Jul 2010 | 15 Jun 2025 | 14 Jul 2026 |
| 843 | ausariantantrayoga.com | Beijing Lanhai Jiye Technology Co., Ltd | 7 Feb 2021 | 15 Feb 2026 | 7 Feb 2027 |
| 844 | ausaperture.com | GoDaddy.com, LLC | 5 Jan 2012 | 28 Apr 2015 | 5 Jan 2017 |
| 845 | ausableindustries.com | Squarespace Domains LLC | 2 Dec 2025 | 17 Dec 2025 | 2 Dec 2026 |
| 846 | ausarcapital.com | DROPCATCH.COM 754 LLC | 18 Oct 2025 | 19 Oct 2025 | 18 Oct 2026 |
| 847 | ausama.com | 1&1 Internet AG | 4 Oct 2011 | 5 Oct 2022 | 4 Oct 2026 |
| 848 | ausanter.com | Namezero, LLC | 12 Aug 2006 | 17 Jul 2017 | 12 Aug 2018 |
| 849 | ausableinstitute.com | GoDaddy.com, LLC | 10 Jun 2010 | 22 Jul 2024 | 10 Jun 2024 |
| 850 | ausadhvyapaar.com | Tucows Domains Inc. | 7 Nov 2024 | 11 Nov 2025 | 7 Nov 2026 |
| 851 | ausarausetpa.com | GoDaddy.com, LLC | 27 Jun 2008 | 28 Jun 2025 | 27 Jun 2026 |
| 852 | ausaa.com | GoDaddy.com, LLC | 22 Aug 2004 | 14 Nov 2025 | 22 Aug 2027 |
| 853 | ausablerivercabins.com | Tucows Domains Inc. | 13 Dec 2005 | 17 Dec 2022 | 13 Dec 2023 |
| 854 | ausaoffers.com | GoDaddy.com, LLC | 24 Mar 2025 | 24 Mar 2025 | 24 Mar 2026 |
| 855 | ausanastudio.com | GoDaddy.com, LLC | 28 Apr 2014 | 28 Apr 2014 | 28 Apr 2019 |
| 856 | ausangatecircuitperu.com | Network Solutions, LLC | 21 Aug 2011 | 29 Jan 2015 | 21 Aug 2016 |
| 857 | ausagri.com | GMO Internet Inc. | 21 Oct 2013 | 10 Oct 2025 | 21 Oct 2026 |
| 858 | ausarrow.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 22 Jul 2024 | 23 Jul 2025 | 22 Jul 2025 |
| 859 | ausa-inc.com | register.com, Inc. | 17 Nov 2005 | 16 Nov 2015 | 17 Nov 2016 |
| 860 | ausablegroup.com | Namesilo, LLC | 19 Jul 2004 | 17 Mar 2026 | 19 Jul 2026 |
| 861 | ausafsayeed.com | Tucows Domains Inc. | 7 Oct 2000 | 20 Sep 2025 | 7 Oct 2026 |
| 862 | ausadultvideo.com | Melbourne IT, Ltd | 15 Oct 2012 | 11 Oct 2025 | 15 Oct 2026 |
| 863 | ausarbeitungen.com | Hongkong Domain Name Information Management Co., L… | 30 Aug 2021 | 30 Aug 2021 | 30 Aug 2022 |
| 864 | ausable-inn.com | - | 11 Apr 2022 | 17 Apr 2026 | 11 Apr 2026 |
| 865 | ausafterhours.com | TurnCommerce, Inc. DBA NameBright.com | 4 Sep 2022 | 3 Nov 2025 | 4 Sep 2026 |
| 866 | ausaquaponics.com | GlamDomains LLC | 20 Jun 2014 | 21 Jun 2017 | 20 Jun 2018 |
| 867 | ausalon.com | Wild West Domains, LLC | 4 Jul 2005 | 5 Jul 2025 | 4 Jul 2026 |
| 868 | ausarborist.com | Melbourne IT, Ltd | 6 Jun 2023 | 12 May 2025 | 6 Jun 2027 |
| 869 | ausachina.com | Xin Net Technology Corporation | 11 Jan 2010 | 14 Oct 2022 | 11 Jan 2032 |
| 870 | ausablevalleyalpacas.com | Beijing Lanhai Jiye Technology Co., Ltd | 27 Mar 2023 | 29 May 2025 | 27 Mar 2025 |
| 871 | ausablerivercarvers.com | Namesilo, LLC | 18 Jan 2001 | 22 Dec 2025 | 18 Jan 2027 |
| 872 | ausangol.com | Internet Domain Services BS Corp | 27 Nov 2012 | 25 Nov 2025 | 27 Nov 2026 |
| 873 | ausalt.com | FastDomain Inc. | 22 Jan 2014 | 17 Dec 2025 | 22 Jan 2027 |
| 874 | ausableriver2flyshop.com | Tucows Domains Inc. | 9 Apr 2013 | 13 Apr 2026 | 9 Apr 2027 |
| 875 | ausaluxury.com | GoDaddy.com, LLC | 3 Jul 2006 | 4 Jul 2015 | 3 Jul 2016 |
| 876 | ausara.com | TurnCommerce, Inc. DBA NameBright.com | 30 Jun 2012 | 3 Nov 2025 | 30 Jun 2026 |
| 877 | ausahoops.com | GoDaddy.com, LLC | 28 Apr 2013 | 3 Sep 2025 | 28 Apr 2027 |
| 878 | ausarb.com | NetEarth One Inc. d/b/a NetEarth | 14 Aug 2003 | 9 Aug 2025 | 14 Aug 2026 |
| 879 | ausableriverco.com | GoDaddy.com, LLC | 9 Mar 2010 | 9 Mar 2016 | 9 Mar 2017 |
| 880 | ausairpower.com | TurnCommerce, Inc. DBA NameBright.com | 10 Feb 2020 | 3 Nov 2025 | 10 Feb 2027 |
| 881 | ausaxemen.com | Bizcn.com, Inc. | 9 May 2019 | 9 May 2019 | 9 May 2020 |
| 882 | ausaroo.com | Dynadot, LLC | 8 Mar 2025 | 9 Mar 2026 | 8 Mar 2027 |
| 883 | ausablevalleyapts.com | NameCheap, Inc. | 21 Jun 2012 | 16 Jun 2025 | 21 Jun 2026 |
| 884 | ausasiafinancehub.com | Melbourne IT, Ltd | 15 Jul 2013 | 4 Jul 2017 | 15 Jul 2019 |
| 885 | ausaki.com | GMO Internet Inc. | 5 Mar 2007 | 15 Feb 2024 | 5 Mar 2030 |
| 886 | ausay.com | HiChina Zhicheng Technology Limited | 30 May 2011 | 5 Dec 2024 | 30 May 2033 |
| 887 | ausa-group.com | Xin Net Technology Corporation | 2 Jan 2014 | 7 Dec 2023 | 2 Jan 2033 |
| 888 | ausaccounting.com | GoDaddy.com, LLC | 17 Jul 2005 | 14 Jun 2025 | 17 Jul 2026 |
| 889 | ausararecordings.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Jul 2024 | 18 Jul 2025 | 17 Jul 2026 |
| 890 | ausasiainstitute.com | Launchpad, Inc. | 1 Aug 2020 | 13 Oct 2023 | 1 Aug 2023 |
| 891 | ausangaterainbowmountaintrek.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Apr 2016 | 29 Jun 2016 | 29 Apr 2017 |
| 892 | ausaintpatrick-courville-sur-eure.com | - | 3 Nov 2013 | 3 Nov 2013 | 3 Nov 2017 |
| 893 | ausalba.com | Tucows Domains Inc. | 17 Nov 2013 | 21 Nov 2016 | 17 Nov 2016 |
| 894 | ausaquatec.com | Crazy Domains FZ-LLC | 4 Feb 2014 | 10 Dec 2015 | 4 Feb 2018 |
| 895 | ausanews.com | GoDaddy.com, LLC | 25 Oct 2006 | 13 Dec 2025 | 25 Oct 2028 |
| 896 | ausarma.com | Synergy Wholesale Pty Ltd | 25 Jan 2020 | 5 Apr 2026 | 25 Jan 2026 |
| 897 | ausableriverwalker.com | Beijing Lanhai Jiye Technology Co., Ltd | 23 Jul 2021 | 24 Aug 2024 | 23 Jul 2024 |
| 898 | ausart.com | GoDaddy.com, LLC | 17 Jul 2003 | 18 Jul 2025 | 17 Jul 2026 |
| 899 | ausableriverrealestate.com | - | 21 Dec 2023 | 22 Jan 2025 | 21 Dec 2024 |
| 900 | ausasiaseafood.com | Tucows Domains Inc. | 8 Jan 2009 | 9 Feb 2026 | 8 Jan 2028 |
| 901 | ausarchitecture.com | GoDaddy.com, LLC | 6 Jun 2003 | 6 Jun 2024 | 6 Jun 2027 |
| 902 | ausautoweek.com | Jiangsu Bangning Science and technology Co. Ltd. | 19 Feb 2022 | 19 Feb 2022 | 19 Feb 2023 |
| 903 | ausantislip.com | DropCatch.com 1049 LLC | 16 May 2018 | 16 May 2018 | 16 May 2019 |
| 904 | ausablellc.com | Global Domain Name Trading Center Ltd | 22 Oct 2021 | 22 Oct 2021 | 22 Oct 2022 |
| 905 | ausacenter.com | Acens Technologies, S.L.U. | 14 Dec 2011 | 12 Dec 2025 | 14 Dec 2026 |
| 906 | ausani.com | GoDaddy.com, LLC | 5 Dec 2012 | 6 Dec 2025 | 5 Dec 2026 |
| 907 | ausarbragg.com | GoDaddy.com, LLC | 17 Jan 2013 | 18 Jan 2016 | 17 Jan 2017 |
| 908 | ausassin.com | 1&1 Internet AG | 15 Sep 2005 | 16 Sep 2016 | 15 Sep 2026 |
| 909 | ausalera.com | Network Solutions, LLC | 5 Jul 2004 | 11 Jul 2016 | 5 Jul 2017 |
| 910 | ausatexascapitalarea.com | Wild West Domains, LLC | 30 Mar 2011 | 26 Apr 2015 | 30 Mar 2017 |
| 911 | ausaglobal.com | GoDaddy.com, LLC | 28 Apr 2011 | 12 May 2023 | 28 Apr 2026 |
| 912 | ausafaris.com | GoDaddy.com, LLC | 26 Jun 2002 | 18 Aug 2025 | 18 Aug 2026 |
| 913 | ausantezambia.com | Mesh Digital Limited | 21 Sep 2011 | 26 Sep 2017 | 21 Sep 2017 |
| 914 | ausabletech.com | GoDaddy.com, LLC | 18 May 2019 | 18 May 2025 | 18 May 2026 |
| 915 | ausasiaworld.com | TPP Wholesale Pty Ltd. | 17 Feb 2012 | 10 Feb 2017 | 17 Feb 2018 |
| 916 | ausableadventures.com | GoDaddy.com, LLC | 25 Feb 2014 | 8 Mar 2026 | 25 Feb 2027 |
| 917 | ausalert.com | Melbourne IT, Ltd | 25 Dec 2025 | 12 Jan 2026 | 25 Dec 2026 |
| 918 | ausangateperu.com | GoDaddy.com, LLC | 28 Sep 2009 | 28 Sep 2025 | 28 Sep 2026 |
| 919 | ausablerivercampsite.com | - | 21 Jun 2021 | 4 Aug 2025 | 21 Jun 2025 |
| 920 | ausame.com | GoDaddy.com, LLC | 4 Aug 2014 | 12 Jul 2024 | 4 Aug 2026 |
| 921 | ausallerwelt.com | Hongkong Domain Name Information Management Co., L… | 17 Oct 2021 | 17 Oct 2021 | 17 Oct 2022 |
| 922 | ausayamasranchresort.com | Tucows Domains Inc. | 3 May 2014 | 7 May 2017 | 3 May 2017 |
| 923 | ausat.com | Gabia, Inc. | 22 Apr 2009 | 16 Dec 2024 | 22 Apr 2027 |
| 924 | ausapacific.com | DreamHost, LLC | 12 Dec 2004 | 10 Nov 2025 | 12 Dec 2026 |
| 925 | ausamcorp.com | FastDomain Inc. | 21 Feb 2013 | 21 Feb 2016 | 21 Feb 2017 |
| 926 | ausabletownship.com | GoDaddy.com, LLC | 11 Jul 2020 | 12 Jul 2025 | 11 Jul 2026 |
| 927 | ausablepinescampground.com | Wild Bunch Domains, LLC | 29 Jun 2022 | 11 Sep 2024 | 29 Jun 2024 |
| 928 | ausasiatraininginstitute.com | Launchpad, Inc. | 26 Jul 2013 | 11 Jul 2017 | 26 Jul 2018 |
| 929 | ausablevalleyinn.com | GoDaddy.com, LLC | 27 Jan 2001 | 9 May 2024 | 27 Jan 2030 |
| 930 | ausandnztravel.com | Key-Systems GmbH | 3 Feb 2005 | 4 Mar 2026 | 3 Feb 2027 |
| 931 | ausabledentalcenter.com | Network Solutions, LLC | 16 Aug 2011 | 15 May 2024 | 16 Aug 2026 |
| 932 | ausabletobacco.com | eNom, Inc. | 4 Jul 2014 | 7 Jul 2016 | 4 Jul 2016 |
| 933 | ausamenergyco.com | GoDaddy.com, LLC | 17 Jun 2008 | 24 Jun 2016 | 17 Jun 2017 |
| 934 | ausarimansovega.com | GoDaddy.com, LLC | 1 Apr 2011 | 2 Apr 2026 | 1 Apr 2027 |
| 935 | ausaware.com | GoDaddy.com, LLC | 24 Jun 2007 | 7 Aug 2025 | 24 Jun 2026 |
| 936 | ausangatetreksite.com | Namesilo, LLC | 7 Jan 2020 | 8 Jan 2020 | 7 Jan 2021 |
| 937 | ausades.com | 1&1 Internet AG | 20 Jul 2012 | 21 Jul 2018 | 20 Jul 2026 |
| 938 | ausangraf.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Feb 2019 | 7 Feb 2019 | 7 Feb 2020 |
| 939 | ausablerivermap.com | register.com, Inc. | 10 Aug 2009 | 10 Aug 2009 | 10 Aug 2018 |
| 940 | ausablevalleyapartments.com | Tucows Domains Inc. | 14 Jun 2011 | 18 Jun 2017 | 14 Jun 2017 |
| 941 | ausakis.com | Tucows Domains Inc. | 22 Oct 2011 | 26 Oct 2022 | 22 Oct 2022 |
| 942 | ausatinrouge.com | EuroDNS S.A. | 6 Jul 2011 | 3 Jul 2025 | 5 Jul 2026 |
| 943 | ausarsc.com | Dinahosting s.l. | 23 May 2013 | 16 May 2025 | 23 May 2026 |
| 944 | ausacontractorsinc.com | Domaingazelle.com LLC | 2 Jul 2025 | 11 Mar 2026 | 2 Jul 2026 |
| 945 | ausableinn.com | GoDaddy.com, LLC | 16 Jan 2014 | 27 Feb 2026 | 16 Jan 2026 |
| 946 | ausantejapan.com | GoDaddy.com, LLC | 18 Jan 2012 | 18 Jan 2012 | 18 Jan 2017 |
| 947 | ausaic.com | Network Solutions, LLC | 16 Dec 2019 | 16 Dec 2019 | 16 Dec 2020 |
| 948 | ausarm.com | GMO Internet Inc. | 2 Aug 2022 | 12 Sep 2023 | 1 Aug 2023 |
| 949 | ausalfa.com | Key-Systems GmbH | 21 Aug 2007 | 28 Nov 2025 | 21 Aug 2026 |
| 950 | ausaes.com | Google, Inc. | 5 Mar 2023 | 18 Feb 2026 | 5 Mar 2027 |
| 951 | ausadesign.com | NameCheap, Inc. | 20 Jun 2014 | 21 May 2025 | 20 Jun 2026 |
| 952 | ausassekuranz.com | 1&1 Internet AG | 12 Jun 2012 | 9 Feb 2018 | 12 Jun 2026 |
| 953 | ausablebigwaterlodge.com | Tucows Domains Inc. | 5 Mar 2010 | 16 May 2023 | 5 Mar 2023 |
| 954 | ausautahchapter.com | GoDaddy.com, LLC | 17 Jan 2013 | 22 Oct 2014 | 17 Jan 2017 |
| 955 | ausairportparking.com | GoDaddy.com, LLC | 8 Jun 2012 | 1 Jan 2026 | 31 Dec 2026 |
| 956 | ausablebrewco.com | FastDomain Inc. | 15 Nov 2013 | 15 Nov 2016 | 15 Nov 2017 |
| 957 | ausableugly.com | GoDaddy.com, LLC | 22 Jan 2006 | 2 Feb 2026 | 22 Jan 2027 |
| 958 | ausanna.com | FastDomain Inc. | 16 May 2012 | 30 Apr 2025 | 16 May 2026 |
| 959 | ausaveteranevent.com | GoDaddy.com, LLC | 28 Jul 2014 | 29 Jul 2016 | 28 Jul 2018 |
| 960 | ausaypcb.com | GoDaddy.com, LLC | 10 May 2012 | 22 Jul 2024 | 10 May 2024 |
| 961 | ausangateexpeditionperu.com | Wild West Domains, LLC | 13 Mar 2020 | 13 Mar 2020 | 13 Mar 2021 |
| 962 | ausableartisanvillage.com | FastDomain Inc. | 24 Mar 2010 | 8 Mar 2017 | 24 Mar 2018 |
| 963 | ausanil.com | GMO Internet Inc. | 19 Dec 2025 | 19 Dec 2025 | 19 Dec 2026 |
| 964 | ausasian.com | GoDaddy.com, LLC | 30 Jul 2011 | 10 Sep 2024 | 30 Jul 2024 |
| 965 | ausae.com | TurnCommerce, Inc. DBA NameBright.com | 16 Mar 2013 | 10 Mar 2021 | 16 Mar 2027 |
| 966 | ausablerivermichigan.com | Wild West Domains, LLC | 1 Jul 1999 | 2 Jul 2024 | 1 Jul 2026 |
| 967 | ausageparty.com | eNom, Inc. | 19 Nov 2010 | 7 Jan 2016 | 19 Nov 2016 |
| 968 | ausalondegazelle78000.com | Dynadot, LLC | 8 Oct 2018 | 9 Oct 2018 | 8 Oct 2019 |
| 969 | ausamigration.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jun 2018 | 20 Jun 2024 | 28 Jun 2029 |
| 970 | ausacases.com | GoDaddy.com, LLC | 18 Apr 2019 | 18 Apr 2019 | 18 Apr 2020 |
| 971 | ausangel.com | - | 9 May 2022 | 10 May 2023 | 9 May 2024 |
| 972 | ausatel.com | Soluciones Corporativas IP, SLU | 2 Oct 1997 | 4 Sep 2025 | 1 Oct 2026 |
| 973 | ausan25.com | Amazon Registrar, Inc. | 17 May 2010 | 12 Apr 2025 | 17 May 2026 |
| 974 | ausatoday.com | Beijing Lanhai Jiye Technology Co., Ltd | 17 Apr 2023 | 21 Apr 2026 | 17 Apr 2027 |
| 975 | ausafricansafaris.com | GoDaddy.com, LLC | 2 Mar 2014 | 2 Mar 2016 | 2 Mar 2018 |
| 976 | ausatrans.com | 10dencehispahard, S.L. | 5 Feb 2014 | 20 Jan 2016 | 5 Feb 2027 |
| 977 | ausabledancecenter.com | GoDaddy.com, LLC | 15 Sep 2011 | 10 Sep 2022 | 15 Sep 2026 |
| 978 | ausable-huron.com | register.com, Inc. | 9 Jun 2019 | 10 May 2025 | 9 Jun 2026 |
| 979 | ausamasl.com | 1&1 Internet AG | 1 Aug 2003 | 22 Apr 2019 | 1 Aug 2026 |
| 980 | ausale.com | Dynadot, LLC | 20 May 2003 | 2 Jan 2026 | 20 May 2026 |
| 981 | ausasiaholiday.com | GoDaddy.com, LLC | 4 Jun 2024 | 4 Jun 2024 | 4 Jun 2029 |
| 982 | ausad.com | CloudFlare, Inc. | 30 Sep 1998 | 30 Aug 2025 | 29 Sep 2026 |
| 983 | ausablepartners.com | Network Solutions, LLC | 24 Oct 2005 | 28 Aug 2025 | 24 Oct 2026 |
| 984 | ausantehk.com | GoDaddy.com, LLC | 18 Jan 2012 | 18 Jan 2012 | 18 Jan 2017 |
| 985 | ausandstone.com | HiChina Zhicheng Technology Limited | 28 Jan 2014 | 5 Jan 2025 | 28 Jan 2028 |
| 986 | ausalonvert.com | eNom, Inc. | 9 Nov 2010 | 9 Mar 2016 | 9 Nov 2016 |
| 987 | ausan.com | Uniregistrar Corp | 12 Mar 2003 | 23 Jan 2026 | 12 Mar 2027 |
| 988 | ausangatetravel.com | Cosmotown, Inc. | 11 Jan 2011 | 12 Jan 2026 | 11 Jan 2027 |
| 989 | ausaga.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 4 Aug 2025 | 4 Aug 2025 | 4 Aug 2026 |
| 990 | ausamples.com | Namesilo, LLC | 22 Aug 2021 | 23 Aug 2021 | 22 Aug 2022 |
| 991 | ausarausetwestcoast.com | CloudFlare, Inc. | 8 May 2009 | 8 Feb 2026 | 8 May 2026 |
| 992 | ausamnation.com | GoDaddy.com, LLC | 30 May 2014 | 4 May 2016 | 30 May 2017 |
| 993 | ausarasurface.com | GoDaddy.com, LLC | 23 Jun 2013 | 23 Jun 2025 | 23 Jun 2026 |
| 994 | ausablevalleyfuels.com | eNom, Inc. | 19 Jul 2012 | 20 Jun 2025 | 19 Jul 2026 |
| 995 | ausar-energy.com | Gandi SAS | 11 Apr 2013 | 30 Jun 2025 | 11 Apr 2027 |
| 996 | ausahogrally.com | MarkMonitor Inc. | 5 Jan 2001 | 4 Dec 2025 | 5 Jan 2028 |
| 997 | ausamx.com | eNom, Inc. | 17 Feb 2017 | 19 Jan 2018 | 17 Feb 2018 |
| 998 | ausape.com | 1&1 Internet AG | 15 Jan 2002 | 24 Feb 2025 | 15 Jan 2027 |
| 999 | ausableuph.com | eNom, Inc. | 2 Oct 2010 | 3 Sep 2016 | 2 Oct 2018 |
| 1000 | ausamahalabsi.com | FastDomain Inc. | 15 Feb 2012 | 15 Feb 2017 | 15 Feb 2018 |
Displaying 1,000 out of 3,984 domains starting with the keyword "AUSA". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=ausa
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |