Keyword: ARKANSASCRIMINALDEFENSELAWYER
Reverse Whois » KEYWORD [arkansascriminaldefenselawyer ] { 3 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | arkansascriminaldefenselawyer.com | Hawthornedomains.com LLC | 30 Jan 2025 | 15 Mar 2026 | 30 Jan 2026 |
| 2 | arkansascriminaldefenselawyerattorney.com | GoDaddy.com, LLC | 20 Feb 2013 | 20 Feb 2016 | 20 Feb 2017 |
| 3 | arkansascriminaldefenselawyers.com | NameKing.com Inc. | 26 Jul 2022 | 9 Oct 2023 | 26 Jul 2023 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=arkansascriminaldefenselawyer
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |
