Our database now contains whois records of 646 Million (646,413,757) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [646 Million Domains] $10,000 Details

Keyword: ANTALYA

Reverse Whois » KEYWORD [antalya ]  { 23,219 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1antalya.bel.tr-16 Apr 2004-15 Apr 2016
2antalya.edu.tr-12 Oct 2010-11 Oct 2015
3antalya.gov.tr-24 Dec 2001-23 Dec 2015
4antalya.pol.tr-21 Apr 2004-20 Apr 2016
5antalya.orgEPAG Domainservices GmbH29 Apr 200231 Aug 202529 Apr 2026
6antalya.xxxGoDaddy.com, LLC17 Mar 201321 Jun 201517 Mar 2016
7antalya.pro-22 Feb 202523 Apr 202522 Feb 2026
8antalya.vacationsGoDaddy.com, LLC24 Feb 202029 Feb 202024 Feb 2021
9antalya.rentalseNom, Inc.25 Jun 201412 Mar 201725 Jun 2017
10antalya.kimİsimtescil Bilişim A.Ş.5 Jan 20215 Jan 20215 Jan 2022
11antalya.votingRegistryGate GmbH23 Jul 2014-23 Jul 2015
12antalya.reisenPSI-USA, Inc. dba Domain Robot12 May 201626 Jun 201712 May 2018
13antalya.dentalPDR Ltd. d/b/a PublicDomainRegistry.com21 Apr 202026 Apr 202521 Apr 2026
14antalya.fitnessNameCheap, Inc.24 Mar 20225 May 202424 Mar 2024
15antalya.blackfridayUniregistrar Corp23 Sep 201423 Sep 201423 Sep 2015
16antalya.guideName.com, Inc.16 Jul 201918 Jul 202516 Jul 2026
17antalya.christmasUniregistrar Corp30 Sep 20141 Oct 201430 Sep 2015
18antalya.lawyerName.com, Inc.28 Feb 20221 Mar 202528 Feb 2026
19antalya.blueNameCheap, Inc.10 Sep 202411 Aug 202510 Sep 2026
20antalya.lifeNamesilo, LLC4 Jan 20181 Sep 20254 Jan 2026
21antalya.pubName.com, Inc.1 Nov 20145 Nov 20171 Nov 2018
22antalya.redFBS Inc.31 Oct 2014-31 Oct 2015
23antalya.trainingGoDaddy.com, LLC9 Nov 20146 Jan 20179 Nov 2017
24antalya.reviewsGoDaddy.com, LLC9 Nov 201424 Dec 20179 Nov 2018
25antalya.healthcareGoDaddy.com, LLC9 Nov 201424 Dec 20179 Nov 2018
26antalya.educationGoDaddy.com, LLC9 Nov 201424 Dec 20179 Nov 2018
27antalya.attorneyName.com, Inc.14 Sep 202115 Sep 202514 Sep 2026
28antalya.picturesGoDaddy.com, LLC16 Nov 201431 Dec 201716 Nov 2018
29antalya.eventsGoDaddy.com, LLC16 Nov 201421 Nov 202316 Nov 2024
30antalya.hosting1API GmbH25 Nov 201419 Sep 202525 Nov 2025
31antalya.giftsGoDaddy.com, LLC23 Nov 201423 Nov 201423 Nov 2015
32antalya.giftNameCheap, Inc.25 Oct 202430 Oct 202425 Oct 2025
33antalya.directoryGoDaddy.com, LLC4 Dec 201418 Jan 20184 Dec 2018
34antalya.clickURL Solutions, Inc.25 Oct 201630 Oct 201625 Oct 2017
35antalya.solarGoogle, Inc.1 Jun 20223 Jun 20251 Jun 2026
36antalya.rocksGoDaddy.com, LLC19 Dec 201419 Dec 201419 Dec 2015
37antalya.businessGoDaddy.com, LLC10 Dec 201410 Dec 201410 Dec 2015
38antalya.moscowRegional Network Information Center, JSC dba RU-CE…3 Jan 20153 Jan 20153 Jan 2016
39antalya.world-10 Oct 202410 Oct 202510 Oct 2025
40antalya.helpUniregistrar Corp31 Jan 201531 Jan 201531 Jan 2016
41antalya.dietUniregistrar Corp31 Jan 201531 Jan 201531 Jan 2016
42antalya.spaceGoDaddy.com, LLC28 Jan 201528 Apr 201728 Jan 2018
43antalya.propertyUniregistrar Corp31 Jan 201517 Mar 201731 Jan 2018
44antalya.workPorkbun, LLC18 Jun 202416 Oct 202518 Jun 2026
45antalya.yogaGo Montenegro Domains, LLC17 Feb 201517 Feb 201517 Feb 2016
46antalya.holdingsTucows Domains Inc.18 Mar 201422 Mar 201518 Mar 2016
47antalya.forsaleGoDaddy.com, LLC22 Oct 202023 Oct 202422 Oct 2025
48antalya.flowersUniregistrar Corp7 Apr 20157 Apr 20157 Apr 2016
49antalya.email-16 Nov 202312 Nov 202416 Nov 2024
50antalya.casaTucows Domains Inc.3 Aug 202313 Sep 20243 Aug 2024
51antalya.apartmentsOVH sas19 Apr 20192 May 202419 Apr 2025
52antalya.todayGoDaddy.com, LLC28 Mar 202112 May 202528 Mar 2026
53antalya.golfNameKing.com Inc.15 Dec 202328 Jan 202515 Dec 2024
54antalya.toursNamesilo, LLC3 Dec 202017 Jan 20253 Dec 2025
55antalya.newsGoDaddy.com, LLC13 Jun 202128 Jul 202513 Jun 2026
56antalya.estate-10 Feb 202425 Mar 202510 Feb 2025
57antalya.cityGoDaddy.com, LLC19 May 20243 Jul 202519 May 2026
58antalya.oneGoDaddy.com, LLC10 Jun 202421 Jun 202510 Jun 2026
59antalya.networkOVH sas12 Jan 202512 Jan 202512 Jan 2026
60antalya.videoGoDaddy.com, LLC17 Mar 202522 Mar 202517 Mar 2026
61antalya.top-17 Oct 202417 Oct 202417 Oct 2025
62antalya.onlineXin Net Technology Corporation10 Apr 202214 Apr 202510 Apr 2026
63antalya.amsterdamTucows Domains Inc.2 Sep 201527 Jun 20172 Sep 2017
64antalya.fyiGoDaddy.com, LLC22 Sep 201516 Jul 201722 Sep 2017
65antalya.designGoDaddy.com, LLC17 Mar 202522 Mar 202517 Mar 2026
66antalya.reiseVautron Rechenzentrum AG2 Oct 201516 Nov 20192 Oct 2020
67antalya.cabGoDaddy.com, LLC2 Oct 20152 Oct 20152 Oct 2016
68antalya.villasGoogle, Inc.6 Mar 20233 Jun 20256 Mar 2026
69antalya.socialName.com, Inc.15 Oct 201516 Oct 201515 Oct 2016
70antalya.vetMarcaria.com International, Inc.22 Oct 202026 Sep 202422 Oct 2025
71antalya.dentistFBS Inc.7 May 202019 Jul 20247 May 2024
72antalya.hostNameCheap, Inc.24 Oct 202224 Oct 202224 Oct 2023
73antalya.globalName.com, Inc.25 Feb 201726 Apr 201725 Feb 2018
74antalya.taxiCloudFlare, Inc.15 Sep 202216 Aug 202515 Sep 2026
75antalya.agencyPDR Ltd. d/b/a PublicDomainRegistry.com27 Sep 20204 Aug 202527 Sep 2026
76antalya.liveCommuniGal Communication Ltd.26 May 202531 May 202526 May 2026
77antalya.siteWest263 International Limited18 Jul 202518 Aug 202518 Jul 2026
78antalya.holidayPorkbun, LLC18 Jun 202416 May 202518 Jun 2026
79antalya.cafePorkbun, LLC15 Jun 202421 May 202515 Jun 2026
80antalya.techWest263 International Limited15 Sep 202416 Sep 202515 Sep 2026
81antalya.comGoDaddy.com, LLC23 Jan 199611 Dec 202424 Jan 2026
82antalya.wangChengdu West Dimension Digital Technology Co., Ltd…25 May 20165 Feb 201725 May 2018
83antalya.vipDynadot, LLC13 Sep 201717 Oct 202513 Sep 2026
84antalya.pressGoDaddy.com, LLC10 Oct 202111 Oct 202510 Oct 2026
85antalya.storeCommuniGal Communication Ltd.1 May 20242 May 20251 May 2026
86antalya.singlesPDR Ltd. d/b/a PublicDomainRegistry.com12 Feb 20145 Feb 201712 Feb 2018
87antalya.partyAlpnames Limited17 Feb 20153 Mar 201616 Feb 2019
88antalya.voyageEnCirca, Inc.10 Dec 201825 Jan 202110 Dec 2021
89antalya.guruNameCheap, Inc.5 Dec 202310 Nov 20245 Dec 2025
90antalya.floristGoDaddy.com, LLC11 Jun 201421 Apr 201711 Jun 2018
91antalya.centerGoDaddy.com, LLC19 Mar 20143 May 202519 Mar 2026
92antalya.houseCronon AG3 May 20234 Nov 202415 Sep 2026
93antalya.companyeNom, Inc.21 Apr 20142 Nov 201521 Apr 2017
94antalya.lolNameCheap, Inc.15 Jun 202416 Jun 202515 Jun 2026
95antalya.diamondsPDR Ltd. d/b/a PublicDomainRegistry.com20 Mar 201418 Mar 201720 Mar 2018
96antalya.tipsunited-domains AG15 Jun 201430 Jul 202515 Jun 2026
97antalya.tattooFBS Inc.4 Nov 20174 Nov 20174 Nov 2018
98antalya.photoUniregistrar Corp15 Apr 201411 May 201615 Apr 2017
99antalya.wikiPorkbun, LLC24 Jun 202426 May 202524 Jun 2026
100antalya.linkUniregistrar Corp15 Apr 201411 May 201615 Apr 2017
101antalya.expertunited-domains AG22 Feb 202122 Feb 202122 Feb 2022
102antalya.propertiesGandi SAS4 Jun 201425 May 20254 Jun 2026
103antalya.webcamAlpnames Limited9 Jun 201413 Jul 20168 Jun 2017
104antalya.bizEPAG Domainservices GmbH13 Jun 200510 Jul 202512 Jun 2026
105antalya.de--11 Sep 2024-
106antalya.infoGoogle, Inc.10 Aug 200130 Aug 202510 Aug 2026
107antalya.mobiGoDaddy.com, LLC19 Mar 201430 May 202519 Mar 2025
108antalya.netMoniker Online Services LLC29 Apr 19975 Feb 202530 Apr 2031
109antalya.mediaGoDaddy.com, LLC17 Mar 202522 Mar 202517 Mar 2026
110antalya.xyzİsimtescil Bilişim A.Ş.1 Jul 201412 Sep 20241 Jul 2024
111antalya.telName.com, Inc.24 Mar 200921 Apr 201723 Mar 2018
112antalya.ma-27 May 202024 Mar 202227 May 2023
113antalya.zone-24 Aug 2025-24 Aug 2026
114antalya.ltdNics Telekomünikasyon Ticaret Ltd. Şti.24 May 201724 May 202524 May 2026
115antalya.menALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED8 Aug 201814 Oct 20258 Aug 2028
116antalya.petNameCheap, Inc.22 May 2025--
117antalya.cc1API GmbH31 Oct 201731 Oct 201731 Oct 2018
118antalya.placePorkbun, LLC2 Jan 20182 Jan 20182 Jan 2019
119antalya.org.uk-24 Mar 202513 Aug 202524 Mar 2026
120antalya.co.uk-6 Feb 200030 Jan 20186 Feb 2020
121antalya.plusGoDaddy.com, LLC27 Dec 20241 Jan 202527 Dec 2025
122antalya.cloudTucows Domains Inc.9 Dec 20199 Dec 20199 Dec 2020
123antalya.internationalNameCheap, Inc.28 Nov 201826 Nov 202428 Nov 2025
124antalya.worksPorkbun, LLC5 Dec 20234 Dec 20245 Dec 2025
125antalya.academyGoDaddy.com, LLC6 Mar 201911 Mar 20196 Mar 2020
126antalya.moneyTucows Domains Inc.3 Apr 201914 May 20203 Apr 2020
127antalya.realtyTucows Domains Inc.18 Aug 202026 Jul 202518 Aug 2026
128antalya.landGoDaddy.com, LLC5 Apr 20196 Apr 20205 Apr 2021
129antalya.careKey-Systems, LLC12 May 201917 May 201912 May 2020
130antalya.marketingGoDaddy.com, LLC8 Jun 202513 Jun 20258 Jun 2026
131antalya.communityGoDaddy.com, LLC5 Aug 201913 May 20205 Aug 2020
132antalya.realestateRealtime Register B.V.11 Apr 202311 Apr 202411 Apr 2025
133antalya.filmNameCheap, Inc.6 Oct 202214 Oct 20256 Oct 2026
134antalya.digital-9 Mar 202526 Jul 20259 Mar 2026
135antalya.travelPorkbun, LLC5 May 201729 Apr 20254 May 2026
136antalya.doctorPDR Ltd. d/b/a PublicDomainRegistry.com3 Oct 20203 Oct 20203 Oct 2021
137antalya.exchangeNameCheap, Inc.14 Oct 202014 Oct 202014 Oct 2021
138antalya.shoppingGoDaddy.com, LLC19 Oct 202028 Sep 202419 Oct 2025
139antalya.servicesGoDaddy.com, LLC8 Jun 202513 Jun 20258 Jun 2026
140antalya.constructionNameCheap, Inc.28 Feb 202129 Jan 202528 Feb 2026
141antalya.goldAtak Domain Hosting Internet d/b/a Atak Teknoloji11 Aug 202111 Aug 202111 Aug 2026
142antalya.restNameCheap, Inc.5 Dec 202310 Nov 20245 Dec 2025
143antalya.inkPorkbun, LLC15 Jun 202426 May 202515 Jun 2026
144antalya.tc-30 Aug 2018-30 Aug 2026
145antalya.surgeryGoDaddy.com, LLC4 Jun 202219 Jul 20254 Jun 2026
146antalya.deals-6 Jul 20226 Jul 20226 Jul 2023
147antalya.churchGoDaddy.com, LLC23 Jul 20223 Sep 202423 Jul 2024
148antalya.archiOVH sas5 Aug 20226 Aug 20235 Aug 2024
149antalya.partnersOVH sas7 Aug 20227 Aug 20227 Aug 2023
150antalya.appGoogle, Inc.24 Aug 202225 Aug 202524 Aug 2026
151antalya.taxDynadot, LLC9 Sep 20229 Sep 20229 Sep 2023
152antalya.movieNameCheap, Inc.6 Oct 202217 Dec 20246 Oct 2024
153antalya.teamGoDaddy.com, LLC8 Jun 202513 Jun 20258 Jun 2026
154antalya.blog1API GmbH15 Nov 202229 Dec 202215 Nov 2023
155antalya.paris1&1 Internet AG1 Dec 202215 Jan 20251 Dec 2025
156antalya.idReserved1 Nov 20213 Nov 20241 Nov 2025
157antalya.clinicİsimtescil Bilişim A.Ş.12 Dec 202223 Feb 202412 Dec 2023
158antalya.consultingNameCheap, Inc.29 Nov 20181 Dec 202429 Nov 2025
159antalya.groupChengdu West Dimension Digital Technology Co., Ltd…22 Nov 202422 Nov 202422 Nov 2025
160antalya.saleNameKing.com Inc.13 Mar 202326 Apr 202413 Mar 2024
161antalya.runPorkbun, LLC9 Jan 20238 Jan 20259 Jan 2026
162antalya.barNameKing.com Inc.4 Jul 202417 Aug 20254 Jul 2025
163antalya.bestNameKing.com Inc.16 Dec 202421 Dec 202416 Dec 2025
164antalya.boatsNameCheap, Inc.25 Sep 202326 Sep 202425 Sep 2025
165antalya.pl-2 Mar 200411 Jan 20252 Mar 2026
166antalya.clubLedl.net GmbH7 May 201411 May 20226 May 2027
167antalya.aeroTucows Domains Inc.26 Jun 20183 Jun 202526 Jun 2026
168antalya.gayNameCheap, Inc.23 Jun 20228 Jul 202323 Jun 2023
169antalya.devGoogle, Inc.23 Jul 202210 Oct 202523 Jul 2028
170antalya.funName.com, Inc.3 May 20171 May 20253 May 2026
171antalya.homesNameKing.com Inc.19 Sep 202124 Jun 202519 Sep 2026
172antalya.it-30 May 202530 May 202530 May 2026
173antalya.lawName.com, Inc.24 Sep 201914 Oct 202524 Sep 2026
174antalya.meGoDaddy.com, LLC15 Jul 200920 Jul 202515 Jul 2026
175antalya.motorcyclesNameCheap, Inc.15 Jun 202416 Jun 202515 Jun 2026
176antalya.nl-12 Nov 200111 Jul 2025-
177antalya.bidCosmotown, Inc.25 Apr 20237 May 202325 Apr 2029
178antalya.ovhOVH sas7 Aug 20228 Aug 20237 Aug 2024
179antalya.bioName.com, Inc.30 Apr 202312 Jun 202430 Apr 2024
180antalya.express-28 Aug 2025-28 Aug 2026
181antalya.yachtsGoogle, Inc.29 Jun 202311 Aug 202529 Jun 2025
182antalya.beautyNameCheap, Inc.2 Jul 202313 Aug 20242 Jul 2024
183antalya.camp-12 Jan 2025-12 Jan 2026
184antalya.hairNameCheap, Inc.5 Dec 202315 Nov 20245 Dec 2025
185antalya.makeupNameCheap, Inc.5 Dec 202315 Nov 20245 Dec 2025
186antalya.questNameCheap, Inc.5 Dec 202315 Nov 20245 Dec 2025
187antalya.skinNameCheap, Inc.5 Dec 202313 Nov 20245 Dec 2025
188antalya.picsNameCheap, Inc.5 Dec 202315 Nov 20245 Dec 2025
189antalya.foundationNameCheap, Inc.8 Jun 202513 Jun 20258 Jun 2026
190antalya.wedding-13 Feb 202415 Mar 202513 Feb 2025
191antalya.cl-17 Jun 2024-17 Jun 2026
192antalya.com.au--3 Sep 2025-
193antalya.ro-22 Oct 2020-21 Oct 2025
194antalya.websiteGoogle, Inc.18 Sep 201416 Oct 202518 Sep 2026
195antalya.givingNameCheap, Inc.13 Apr 202424 Jun 202513 Apr 2025
196antalya.ru-9 Mar 2000-31 Mar 2026
197antalya.tradeCloudFlare, Inc.2 May 20247 May 20242 May 2025
198antalya.su-1 Nov 2005-1 Nov 2025
199antalya.se-20 May 202311 Jul 202520 May 2026
200antalya.dk-31 Jan 2025-30 Jan 2026
201antalya.momPorkbun, LLC15 Jun 202413 Jun 202515 Jun 2026
202antalya.cam-17 Jun 202418 Jun 202517 Jun 2026
203antalya.uk-1 Jul 20196 May 20251 Jul 2026
204antalya.fit-16 Sep 202426 Jun 202516 Sep 2025
205antalya.wsGoDaddy.com, LLC16 May 202427 May 202516 May 2026
206antalya.lat-7 May 20256 Jun 20257 May 2026
207antalya.uno-7 May 20256 Jun 20257 May 2026
208antalya.babyNameCheap, Inc.16 May 20251 Jun 202516 May 2026
209antalya.irishNameCheap, Inc.28 May 202528 May 202528 May 2026
210antalya.studioGoDaddy.com, LLC8 Jun 202513 Jun 20258 Jun 2026
211antalya.solutionsHostinger, UAB9 Jun 202514 Jun 20259 Jun 2026
212antalya.frRegistryGate GmbH17 Jul 200619 Oct 202519 Oct 2026
213antalya.sk-25 Jun 202411 Sep 202525 Jun 2026
214antalya.chatHostinger, UAB10 Aug 202515 Aug 202510 Aug 2026
215antalya.beerNameCheap, Inc.18 Sep 202518 Sep 202518 Sep 2026
216antalyatv.comGoDaddy.com, LLC14 Dec 200915 Dec 202414 Dec 2025
217antalyaitumezunlari.comGMO Internet Inc.27 Mar 200927 Mar 202527 Mar 2026
218antalyaguncel.com-30 Apr 200917 Apr 202530 Apr 2026
219antalyayuva.comDomainnovations, Inc.24 Mar 20227 May 202324 Mar 2023
220antalyadayiz.comGoDaddy.com, LLC13 Jan 202424 Jan 202513 Jan 2026
221antalyasporum.comDomain.com, LLC27 Jan 200224 Jan 202527 Jan 2026
222antalyacambalkon.bizPDR Ltd. d/b/a PublicDomainRegistry.com6 Feb 20122 Mar 20175 Feb 2018
223antalyaisrehberi.orgInternet Domain Services BS Corp10 Apr 200925 May 202510 Apr 2026
224antalyaemlakbul.comIHS Telekom, Inc.29 Apr 201017 Oct 201629 Apr 2018
225antalyaaquarium.com-13 Apr 201120 Apr 202513 Apr 2027
226antalyacambalkon.infoGoDaddy.com, LLC18 Mar 2015-18 Mar 2016
227antalyainternethaber.comNameCheap, Inc.24 Mar 202524 Mar 202524 Mar 2026
228antalyaspor.com.tr-26 Apr 2001-25 Apr 2019
229antalyatasarim.comTucows Domains Inc.30 Sep 20244 Oct 202530 Sep 2025
230antalyabugun.com-16 Aug 200716 Aug 202516 Aug 2026
231antalya-ulasim.comMoniker Online Services LLC18 May 202424 Jan 202518 May 2026
232antalyaajanda.comGMO Internet Inc.27 Jul 202128 Jul 202127 Jul 2022
233antalyaajans.netDropCatch.com 406 LLC20 Aug 202119 Aug 202420 Aug 2026
234antalyaanket.kimFBS Inc.19 Feb 201523 Feb 201519 Feb 2016
235antalyabarosu.org.tr-26 Dec 2001-25 Dec 2017
236antalyaburada.comİsimtescil Bilişim A.Ş.17 Feb 20099 Oct 202417 Feb 2027
237antalyacicek.com.tr-14 Dec 2004-13 Dec 2017
238antalyadasms.comAtak Domain Hosting Internet d/b/a Atak Teknoloji19 Nov 202120 Nov 202119 Nov 2022
239antalyaemniyet.pol.tr-26 Apr 2011-25 Apr 2016
240antalyaescortbayan.tvGoDaddy.com, LLC5 Jun 201418 Mar 20155 Jun 2015
241antalyaescortla.netNetwork Solutions, LLC3 Sep 20144 Sep 20143 Sep 2015
242antalyaescortnet.comFBS Inc.22 Dec 201414 Mar 201522 Dec 2015
243antalyagazetesi.com.tr-18 Sep 2008-17 Sep 2015
244antalyahomes.comIHS Telekom, Inc.6 Jul 200414 Jun 20246 Jul 2033
245antalyahomes.com.tr-20 Feb 2012-19 Feb 2017
246antalyakobi.comHostinger, UAB21 Jan 201327 Sep 202521 Jan 2026
247antalyakulturturizm.gov.tr-27 Dec 2006-26 Dec 2015
248antalyamanken.comAutomattic Inc.12 Aug 202321 Aug 202512 Aug 2026
249antalyaotokiralama.orgFBS Inc.14 May 201431 May 202014 May 2026
250antalyapartner.comPSI-USA, Inc. dba Domain Robot2 Dec 20202 Dec 20202 Dec 2021
251antalyarentalcars.comİsimtescil Bilişim A.Ş.20 Feb 201217 Feb 202520 Feb 2026
252antalyatransfer.orgIHS Telekom, Inc.4 May 200924 Jul 20254 May 2026
253antalyawebseo.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.26 Jan 202226 Jan 202226 Jan 2023
254antalyawebtasarim.comGoDaddy.com, LLC24 Aug 201118 Nov 202224 Aug 2028
255antalyayeniescortlar.comFBS Inc.12 Jan 20159 Mar 201512 Jan 2016
256antalyakahvecilerodasi.comIHS Telekom, Inc.21 Oct 201421 Oct 201421 Oct 2015
257antalyagubresanayi.comGoDaddy.com, LLC21 Oct 201421 Oct 201421 Oct 2015
258antalyaerbogahafriyat.comFBS Inc.21 Oct 201421 Oct 201421 Oct 2015
259antalyacadde.comGoDaddy.com, LLC7 Jun 20257 Jun 20257 Jun 2026
260antalyabolgeservis.comGoogle, Inc.11 Nov 202426 Nov 202411 Nov 2025
261antalya-club.comDynadot, LLC21 Oct 201431 Jan 201821 Oct 2019
262antalya-tours.ir----
263antalyaestate.ir----
264antalyarentacars.net1&1 Internet AG24 Aug 202524 Aug 202524 Aug 2026
265antalyatoday.ru-2 Nov 2021-2 Nov 2025
266antalyazub.comGoDaddy.com, LLC22 Oct 201422 Oct 201422 Oct 2016
267antalyayouthfestival.comReg2C.com Inc.22 Oct 201422 Oct 201422 Oct 2015
268antalyaxboxkiralama.comTucows Domains Inc.19 Oct 201323 Oct 201419 Oct 2015
269antalyauyduservisi.comAtak Domain Hosting Internet d/b/a Atak Teknoloji19 Oct 201221 Oct 202319 Oct 2025
270antalyaplaystationkiralama.com-6 Oct 20236 Nov 20246 Oct 2024
271antalyanextservisi.comAtak Domain Hosting Internet d/b/a Atak Teknoloji19 Oct 201221 Oct 202319 Oct 2025
272antalyaivesinsaat.comNics Telekomünikasyon Ticaret Ltd. Şti.22 Oct 201422 Oct 201422 Oct 2015
273antalyadiscephetemizligi.comIHS Telekom, Inc.22 Oct 201422 Oct 201422 Oct 2015
274antalyaazdekor.comNics Telekomünikasyon Ticaret Ltd. Şti.22 Oct 201422 Oct 201422 Oct 2016
275antalyaantikmuzayede.comFBS Inc.22 Oct 201419 Oct 202422 Oct 2025
276antalyaantikmezat.comFBS Inc.22 Oct 201425 May 201722 Oct 2019
277antalyakonteyner.netIHS Telekom, Inc.4 Feb 20256 Apr 20254 Feb 2026
278antalya2015.orgGoDaddy.com, LLC21 Oct 201421 Oct 201421 Oct 2015
279antalyaescort07.orgGoDaddy.com, LLC21 Aug 201326 Aug 201621 Aug 2017
280antalyaescort07.comName.com, Inc.29 Jul 202210 Sep 202329 Jul 2023
281antalyacity.ru-10 Sep 2024-10 Sep 2026
282antalyaescortresimleri.orgGoDaddy.com, LLC21 Aug 201326 Aug 201621 Aug 2017
283antalyaescortbayanbul.comDomainToOrder, LLC29 Nov 201529 Nov 201529 Nov 2016
284antalyaeo.org.tr-5 Aug 1998-4 Aug 2015
285antalya07rentacar.comNics Telekomünikasyon Ticaret Ltd. Şti.7 Nov 201318 Oct 20247 Nov 2025
286antalyaliescortbayan.orgIHS Telekom, Inc.13 Mar 201513 May 201513 Mar 2016
287antalyaeskortlari.comName.com, Inc.10 Mar 202524 Jun 202510 Mar 2026
288antalyarental.netRegister.it SPA20 Jan 201720 Jan 201720 Jan 2018
289antalyayachts.comNameCheap, Inc.27 Aug 202118 Jun 202427 Aug 2030
290antalyatemizlikmalzemeleri.comFBS Inc.18 Oct 201718 Oct 201718 Oct 2018
291antalyasehirportali.comNics Telekomünikasyon Ticaret Ltd. Şti.10 Jan 201610 Jan 201610 Jan 2017
292antalyaerenlernakliyat.comFBS Inc.23 Oct 201423 Oct 201423 Oct 2015
293antalya-tercumeburosu.comNics Telekomünikasyon Ticaret Ltd. Şti.23 Oct 201417 Oct 202523 Oct 2026
294antalyailanservisi.comDomain Source LLC28 Jun 202311 Sep 202428 Jun 2024
295antalyaclass.comBeijing Lanhai Jiye Technology Co., Ltd22 Nov 202316 Oct 202522 Nov 2025
296antalyayouthfestival.orgReg2C.com Inc.22 Oct 201422 Oct 201422 Oct 2015
297antalyatuzcuoglunakliyat.orgKey-Systems GmbH22 Oct 20147 Nov 201422 Oct 2015
298antalyaairporttransfers.de--8 Mar 2025-
299antalyahomes.netIHS Telekom, Inc.30 Apr 20082 Nov 202330 Apr 2029
300antalyaevdenevenakliye.comİsimtescil Bilişim A.Ş.14 Dec 202420 Jan 202514 Dec 2025
301antalyaescortpartner.comGoogle, Inc.22 Aug 20238 Aug 202522 Aug 2026
302antalyavipevdeneve.comNameCheap, Inc.11 Jul 202415 May 202511 Jul 2026
303antalyaucuzescortlar.comGoDaddy.com, LLC24 Jul 201924 Jul 201924 Jul 2021
304antalyaparti.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.24 Aug 20234 Oct 202424 Aug 2024
305antalyamerthotel.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Oct 201425 Oct 201425 Oct 2015
306antalyamerkezescortlar.comMoniker Online Services LLC24 Oct 201424 Oct 201424 Oct 2015
307antalyadogumgunu.com-21 Jun 201821 Jun 202521 Jun 2027
308antalyacicekmarketi.comFBS Inc.24 Oct 201425 May 201724 Oct 2017
309antalyacicekmarket.comİsimtescil Bilişim A.Ş.4 Jan 202318 Mar 20244 Jan 2024
310antalyaaltinemlak.comOnlineNIC, Inc.24 Oct 201424 Oct 201424 Oct 2015
311antalyaairporttransfer.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.4 Apr 200716 Sep 20254 Apr 2026
312antalyaalarmsistemleri.comGoDaddy.com, LLC24 May 201425 May 201524 May 2016
313antalyaesnafi.comIHS Telekom, Inc.17 Feb 201617 Feb 201617 Feb 2017
314antalyadirect.comGoDaddy.com, LLC24 May 201325 May 201524 May 2016
315antalyasehirportali.netPDR Ltd. d/b/a PublicDomainRegistry.com23 Oct 201423 Oct 201423 Oct 2015
316antalyaescortbayan.xxxGoDaddy.com, LLC14 Jul 20141 Oct 201414 Jul 2015
317antalyayamacparasutu.com-15 Oct 202114 Oct 202515 Oct 2026
318antalyaistikbalmobilya.comGoDaddy.com, LLC26 May 201127 May 201526 May 2016
319antalyabosch.netGoDaddy.com, LLC26 May 201127 May 201526 May 2016
320antalyaasrinreklam.comGoDaddy.com, LLC26 May 201427 May 201526 May 2016
321antalyatarimmakineleri.comFBS Inc.25 Oct 201425 Oct 201425 Oct 2015
322antalyatarimaletleri.comFBS Inc.25 Oct 201425 Oct 201425 Oct 2015
323antalyacandlesuites.comDNC Holdings, Inc.25 Oct 201425 Oct 201425 Oct 2015
324antalyaescortgulcan.comGoDaddy.com, LLC29 May 201430 May 201529 May 2016
325antalyaprefabrikev.netAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.27 Sep 202527 Sep 202527 Sep 2026
326antalyacicekmarketi.netFBS Inc.24 Oct 201424 Oct 201424 Oct 2016
327antalyacicekmarket.netFBS Inc.24 Oct 201424 Oct 201424 Oct 2016
328antalyasatilikrezidans.comGoDaddy.com, LLC1 Jun 20128 Jun 20151 Jun 2016
329antalyacenter.comLigne Web Services SARL9 Jun 20209 Jun 20209 Jun 2021
330antalyaalexandritelazer.comGoDaddy.com, LLC2 Jun 20143 Jun 20152 Jun 2016
331antalyaeye.comGoDaddy.com, LLC2 Jun 20143 Jun 20152 Jun 2016
332antalyahatirasi.comGoDaddy.com, LLC2 Jun 20143 Jun 20152 Jun 2016
333antalyadasurucukursu.comGoDaddy.com, LLC2 Jun 20143 Jun 20152 Jun 2016
334antalyasporburada.comWild West Domains, LLC3 Jun 20134 Jun 20153 Jun 2016
335antalyadogalguzellikleri.comGoDaddy.com, LLC3 Jun 20134 Jun 20153 Jun 2016
336antalyasoforluotokiralama.comFBS Inc.26 Oct 201431 Oct 201726 Oct 2018
337antalyasoforluarabakiralama.comFBS Inc.26 Oct 201431 Oct 201726 Oct 2018
338antalyaotelhurdalari.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Oct 201426 Oct 201426 Oct 2015
339antalyagulsoymobilyadekorasyon.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Oct 201413 Oct 201626 Oct 2017
340antalyafun.comHostinger, UAB8 Jun 202321 Aug 20258 Jun 2025
341antalyacarbooking.comFBS Inc.21 May 201921 May 201921 May 2020
342antalya-klimaservis.comNameCheap, Inc.18 Apr 202518 Apr 202518 Apr 2026
343antalyakozmikenerji.comGoDaddy.com, LLC22 May 201423 May 201522 May 2016
344antalyabotanikexpo2016.comGoDaddy.com, LLC22 May 201223 May 201522 May 2016
345antalyainanturizm.comGoDaddy.com, LLC24 May 201424 May 201524 May 2016
346antalyaiguide.comGoDaddy.com, LLC23 May 201424 May 201523 May 2016
347antalyabotanikexpo2016.infoGoDaddy.com, LLC22 May 201222 May 201522 May 2016
348antalya-cambalkon.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Dec 201814 Dec 201814 Dec 2019
349antalyaucakbileti.comIHS Telekom, Inc.18 Jun 200929 Jul 202518 Jun 2025
350antalyadentist.comGoDaddy.com, LLC22 Nov 202323 Sep 202522 Nov 2026
351antalyabitpazari.comGoDaddy.com, LLC20 May 201121 May 202520 May 2026
352antalyasatilikev.org----
353antalyakultur.comNameKing.com Inc.11 Apr 202212 Apr 202511 Apr 2026
354antalyasoforlerodasi.com1API GmbH28 Oct 201412 Apr 201728 Oct 2017
355antalyakuzeynakliyat.comXin Net Technology Corporation7 Apr 202127 May 20217 Apr 2022
356antalyaklimaci.comRealtime Register B.V.20 Jan 2020-20 Jan 2021
357antalyahotellist.comNamesilo, LLC15 Oct 201127 Oct 201415 Oct 2015
358antalya-nakliyat.comDynadot12 LLC8 Apr 202219 May 20238 Apr 2023
359antalyasoforluarackiralama.netFBS Inc.26 Oct 201418 May 201726 Oct 2017
360antalyahotelsdiscount.comGoDaddy.com, LLC20 Feb 201228 Apr 201520 Feb 2016
361antalyahavalimanitaksi.comGoDaddy.com, LLC17 Mar 200728 Mar 202517 Mar 2026
362antalyaozel.comGoDaddy.com, LLC16 Sep 202016 Sep 202016 Sep 2021
363antalyaescortmerkezi.comName.com, Inc.18 Jan 20178 Mar 201718 Jan 2018
364antalyayasamkocu.bizFBS Inc.28 Oct 201428 Oct 201427 Oct 2015
365antalyayagmurcicekcilik.comNics Telekomünikasyon Ticaret Ltd. Şti.28 Oct 201428 Oct 201428 Oct 2015
366antalyasutesisattamircisi.comNics Telekomünikasyon Ticaret Ltd. Şti.28 Oct 201428 Oct 201428 Oct 2015
367antalyasukacagitespiti.comIHS Telekom, Inc.4 Feb 202029 Jan 20244 Feb 2026
368antalyaarcelikservis.comAtak Domain Hosting Internet d/b/a Atak Teknoloji11 Jul 202511 Jul 202511 Jul 2026
369antalyaeskortbayan.netName.com, Inc.11 Mar 201912 Mar 201911 Mar 2020
370antalyaaparts.comGoDaddy.com, LLC5 Aug 20136 Aug 20175 Aug 2018
371antalyaflats.comOnlineNIC, Inc.11 Nov 201922 Oct 202411 Nov 2025
372antalyakoli.com-28 Oct 201628 Oct 201628 Oct 2017
373antalyanet.comTurnCommerce, Inc. DBA NameBright.com11 Nov 20162 Aug 202511 Nov 2025
374antalyahotels724.comGoDaddy.com, LLC23 Aug 200730 Apr 201523 Aug 2015
375antalyadarling.netGoDaddy.com, LLC20 Jun 201221 Jun 201520 Jun 2016
376antalyaotelleri.net-1 Aug 20241 Sep 20251 Aug 2025
377antalyaservis.com-7 Jan 201412 Jan 20257 Jan 2026
378antalyaciceksergisi.comNamesilo, LLC10 Feb 20201 Sep 202510 Feb 2026
379antalyahotelbook.comHongkong Domain Name Information Management Co., L…5 Jul 20215 Jul 20215 Jul 2022
380antalyaflight.comIHS Telekom, Inc.8 Jul 20249 Jul 20258 Jul 2026
381antalyaolimpos.comNominalia Internet S.L.8 Dec 20208 Dec 20208 Dec 2021
382antalyastreunerfreunde.comGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
383antalyasgkdanismanlik.comIHS Telekom, Inc.5 Oct 20186 Oct 20255 Oct 2026
384antalyaninenucuzhastanesi.comReg2C.com Inc.29 Oct 201429 Oct 201429 Oct 2015
385antalyanineniyihastanesi.comReg2C.com Inc.29 Oct 201428 Oct 201629 Oct 2017
386antalyanineniyidoktorlari.comReg2C.com Inc.29 Oct 20143 Nov 201729 Oct 2018
387antalyaninenbasarilihastanesi.comReg2C.com Inc.29 Oct 201429 Oct 201429 Oct 2015
388antalyadaeniyihastane.comReg2C.com Inc.29 Oct 20143 Nov 201729 Oct 2018
389antalyacanlisiva.comGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
390antalyabalik.comNameCheap, Inc.24 Sep 201929 Sep 202524 Sep 2026
391antalyaaksuarsa.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Mar 202117 Mar 202331 Mar 2026
392antalyaemlakcisi.comAtak Domain Hosting Internet d/b/a Atak Teknoloji17 May 202210 Jul 202317 May 2023
393antalyahalikoltukyikama.netNics Telekomünikasyon Ticaret Ltd. Şti.28 Oct 201428 Oct 201428 Oct 2015
394antalyais.comDynadot12 LLC15 Apr 202116 Apr 202115 Apr 2022
395antalyashoppingfestexpo.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Oct 201430 Oct 201430 Oct 2015
396antalyamanti.comGoogle, Inc.13 Sep 202013 Oct 202413 Sep 2024
397antalyaluksyat.comIHS Telekom, Inc.30 Oct 201430 Oct 201430 Oct 2015
398antalyakiralikyat.comRealtime Register B.V.1 Nov 20182 Nov 20181 Nov 2019
399antalyaarslannakliyat.comIHS Telekom, Inc.30 Oct 201430 Oct 201430 Oct 2015
400antalyaaltinportakalevdeneve.comIHS Telekom, Inc.30 Oct 201425 Nov 202130 Oct 2022
401antalyaninenucuzhastanesi.netReg2C.com Inc.29 Oct 201429 Oct 201429 Oct 2015
402antalyanineniyihastanesi.netReg2C.com Inc.29 Oct 201429 Oct 201429 Oct 2015
403antalyanineniyidoktorlari.netReg2C.com Inc.29 Oct 201429 Oct 201429 Oct 2015
404antalyaninenbasarilihastanesi.netReg2C.com Inc.29 Oct 201429 Oct 201429 Oct 2015
405antalyadaeniyihastane.netReg2C.com Inc.29 Oct 201429 Oct 201429 Oct 2015
406antalyaig.comNetwork Solutions, LLC6 Aug 20148 Aug 20146 Aug 2015
407antalyaoteli.comGoDaddy.com, LLC26 Oct 202326 Oct 202326 Oct 2025
408antalyaarackiralama.comTurnCommerce, Inc. DBA NameBright.com3 Feb 202030 Mar 20223 Feb 2026
409antalyaturkeyhotels.com1API GmbH1 Aug 20181 Aug 20251 Aug 2026
410antalyaarackirala.comİsimtescil Bilişim A.Ş.13 Apr 201829 Mar 202513 Apr 2026
411antalyafilokirala.comGoDaddy.com, LLC7 Jun 20157 Jun 20157 Jun 2016
412antalyaonline.comGoDaddy.com, LLC13 Nov 200414 Nov 202413 Nov 2025
413antalyayanginsondurme.comNics Telekomünikasyon Ticaret Ltd. Şti.17 Feb 201624 Feb 202517 Feb 2026
414antalyatransfercenter.comDigivity B.V.11 Apr 20196 May 202411 Apr 2027
415antalyatadilatdecor.comFBS Inc.31 Oct 201431 Oct 201431 Oct 2015
416antalyasenturkemlak.comOnlineNIC, Inc.31 Oct 201431 Oct 201431 Oct 2016
417antalyasenolemlak.comGMO Internet Inc.19 Jan 20172 Jan 201819 Jan 2019
418antalyaisrehberim.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED8 Aug 20188 Aug 20188 Aug 2019
419antalyaikincielaraba.com-1 Nov 20141 Nov 20141 Nov 2017
420antalya-produksiyon.comFBS Inc.31 Oct 201431 Oct 201431 Oct 2015
421antalya-gayrimenkul.comAutomattic Inc.10 Mar 202223 May 202310 Mar 2023
422antalya-alanya.comAscio Technologies, Inc. Danmark - Filial af Ascio…3 Apr 202111 Apr 20253 Apr 2026
423antalyadutyfree.comNameCheap, Inc.18 Aug 202513 Oct 202518 Aug 2026
424antalyahavalimanitransferi.net-27 Sep 202326 Aug 202427 Sep 2025
425antalyaevdeneve.bizFBS Inc.29 Jun 201930 Jun 202029 Jun 2021
426antalyaarkadas.netSoldierofonedomains.com19 Dec 201920 Dec 201919 Dec 2020
427antalyasehirrehberi.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Sep 202131 Oct 202319 Sep 2023
428antalya-smmmo.orgDynadot, LLC24 Apr 20243 Jun 202524 Apr 2025
429antalyabutikotel.comTucows Domains Inc.15 Sep 202313 Sep 202515 Sep 2026
430antalyaspor.xxxGoDaddy.com, LLC17 Mar 201321 Jun 201517 Mar 2016
431antalyageceleri.comGoDaddy.com, LLC24 May 202524 May 202524 May 2026
432antalyabetonkesimi.comNics Telekomünikasyon Ticaret Ltd. Şti.1 Nov 20141 Nov 20141 Nov 2016
433antalyakariyer.comİsimtescil Bilişim A.Ş.10 Jun 202410 Jun 202510 Jun 2026
434antalyaikincielesya.netTucows Domains Inc.31 Oct 201426 Nov 202431 Oct 2025
435antalyabayan.net-27 Dec 202317 Dec 202427 Dec 2025
436antalyaciceks.com-23 Feb 202423 Feb 202523 Feb 2026
437antalyamerkezkarot.comOnlineNIC, Inc.9 Jun 201412 Jun 20159 Jun 2016
438antalyanetworksistemleri.netTucows Domains Inc.5 Jun 20139 Jun 20155 Jun 2016
439antalyasite.netTucows Domains Inc.5 Jun 20149 Jun 20155 Jun 2016
440antalyadiamond.comHosting Concepts B.V. dba Openprovider19 Dec 201919 Dec 201919 Dec 2020
441antalyazetemlak.comOnlineNIC, Inc.10 Jun 201313 Jun 201510 Jun 2016
442antalya-kiralik-arac.netPDR Ltd. d/b/a PublicDomainRegistry.com9 Jun 201410 Jun 20159 Jun 2016
443antalya-travestileri.comGMO Internet Inc.7 Sep 20157 Sep 20157 Sep 2016
444antalya-hurda.netGoDaddy.com, LLC9 Jun 201410 Jun 20159 Jun 2016
445antalyatorf.comOnlineNIC, Inc.30 Mar 201621 Jun 202530 Mar 2026
446antalyamermersilimcisi.comFBS Inc.2 Nov 20142 Nov 20142 Nov 2016
447antalyakonyaaltiemlak.comName.com, Inc.3 Nov 20143 Nov 20143 Nov 2015
448antalyadacaddeler.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Nov 20142 Nov 20142 Nov 2015
449antalyaliman.comNamesilo, LLC8 Apr 202112 Jun 20248 Apr 2024
450antalyawebtasarim.web.tr-14 Dec 2013-13 Dec 2015
451antalyaetkinlik.infoGoDaddy.com, LLC11 Jun 201312 Jun 201511 Jun 2016
452antalyatavan.comCosmotown, Inc.2 Jul 20256 Jul 20252 Jul 2026
453antalyamama.comNics Telekomünikasyon Ticaret Ltd. Şti.27 Feb 20242 Sep 202427 Feb 2026
454antalyaisilhaliyikama.comFBS Inc.3 Nov 201416 Dec 20243 Nov 2024
455antalyaincitemizlik.comNics Telekomünikasyon Ticaret Ltd. Şti.3 Nov 20143 Nov 20143 Nov 2015
456antalyapaylasimlitransfer.comFBS Inc.4 Nov 20144 Nov 20144 Nov 2015
457antalyajewellry.comFBS Inc.4 Nov 20144 Nov 20144 Nov 2016
458antalyagunesi.comNameCheap, Inc.16 Apr 2021-16 Apr 2022
459antalyaescortlarinn.comGoDaddy.com, LLC4 Nov 20144 Nov 20144 Nov 2015
460antalyaconvention.comDropCatch.com 1005 LLC22 Jan 201623 Jan 201722 Jan 2018
461antalyacicekpazari.comNics Telekomünikasyon Ticaret Ltd. Şti.5 Nov 20145 Nov 20145 Nov 2015
462antalyabuild.comGoDaddy.com, LLC4 Nov 20144 Nov 20144 Nov 2015
463antalyamanyak.comGoDaddy.com, LLC12 Jun 201213 Jun 201512 Jun 2016
464antalyaescorts.netPorkbun, LLC5 Aug 20251 Sep 20255 Aug 2026
465antalyaescortlar.netInternet Domain Services BS Corp21 Sep 201721 Sep 201721 Sep 2018
466antalyadakirentacarlar.comGoDaddy.com, LLC12 Jun 201413 Jun 201512 Jun 2016
467antalyafuarrehberi.comGoDaddy.com, LLC8 Mar 20178 Mar 20178 Mar 2018
468antalyasporsahalariveekipmanlari.comGoDaddy.com, LLC13 Jun 201414 Jun 201513 Jun 2016
469antalyahalisaha.comName.com, Inc.26 Aug 201726 Aug 201726 Aug 2018
470antalyacocukoyunparki.comAtak Domain Hosting Internet d/b/a Atak Teknoloji13 Aug 202513 Aug 202513 Aug 2026
471antalyagalvaniz.com----
472antalya-tekstil.comNics Telekomünikasyon Ticaret Ltd. Şti.18 Aug 201418 Aug 201418 Aug 2015
473antalyaakillitahta.comNamesilo, LLC26 Sep 202327 Sep 202526 Sep 2026
474antalyaarcelikservismerkezi.comGoDaddy.com, LLC18 Aug 201426 Aug 201618 Aug 2018
475antalyaatrakcje.netKey-Systems GmbH18 Aug 201418 Aug 201418 Aug 2015
476antalyaegitimdanismanlik.comReg2C.com Inc.18 Aug 201418 Aug 201418 Aug 2015
477antalyaerdemyapi.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Aug 201418 Aug 201418 Aug 2015
478antalyaguloto.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Aug 201418 Aug 201418 Aug 2015
479antalyaiselbiseleri.comIHS Telekom, Inc.28 Aug 202428 Aug 202528 Aug 2026
480antalyaseed.comNics Telekomünikasyon Ticaret Ltd. Şti.18 Aug 201418 Aug 201418 Aug 2015
481antalyasengayrimenkul.comOnlineNIC, Inc.18 Aug 201418 Aug 201418 Aug 2015
482antalyasinav.comNameCheap, Inc.17 Apr 202517 Apr 202517 Apr 2026
483antalyatravel.orgGoDaddy.com, LLC15 Jun 202226 Aug 202315 Jun 2023
484antalyayurdisiegitim.comReg2C.com Inc.18 Aug 201418 Aug 201418 Aug 2015
485antalyaconcert.comGoDaddy.com, LLC14 Jun 201326 Jun 201514 Jun 2016
486antalyagozluk.com-26 Jan 202128 Mar 202526 Jan 2025
487antalyaavinc.comGoDaddy.com, LLC17 Jun 201418 Jun 201517 Jun 2016
488antalyafilmguide.comNics Telekomünikasyon Ticaret Ltd. Şti.19 Aug 201419 Aug 201419 Aug 2015
489antalyafilmrehberi.comNics Telekomünikasyon Ticaret Ltd. Şti.19 Aug 201419 Aug 201419 Aug 2015
490antalyaganoexcel.comGoDaddy.com, LLC19 Aug 201419 Aug 201419 Aug 2015
491antalyawork.comGoDaddy.com, LLC19 Aug 201421 Aug 201619 Aug 2017
492antalyaunlumamulleri.comFBS Inc.5 Nov 20146 Nov 20145 Nov 2015
493antalyametalhurdavinc.comFBS Inc.5 Nov 20145 Nov 20145 Nov 2015
494antalyajewelry.comTucows Domains Inc.28 Jul 202316 Jul 202528 Jul 2026
495antalyaguzelsanatlar.com-4 Nov 200924 Jun 20224 Nov 2025
496antalyakiz.comeNom, Inc.23 Sep 20165 Nov 201723 Sep 2017
497antalyapostaguvercini.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Jun 201524 Jun 201524 Jun 2016
498antalyaresistance.comFBS Inc.24 Jun 201524 Jun 201524 Jun 2016
499antalyauzumculuk.comFastDomain Inc.7 Sep 202320 Nov 20247 Sep 2024
500antalyapaylasimlitransfer.orgFBS Inc.4 Nov 20144 Nov 20144 Nov 2015
501antalyapaylasimlitransfer.netFBS Inc.4 Nov 20144 Nov 20144 Nov 2015
502antalyakurtaj.orgFBS Inc.4 Nov 20146 Nov 20174 Nov 2018
503antalyaflughafentaxi.netİsimtescil Bilişim A.Ş.3 Jun 202316 Jul 20243 Jun 2024
504antalyadogalgaz.netİsimtescil Bilişim A.Ş.17 Jan 201631 Dec 202417 Jan 2026
505antalyacicekpazari.netNics Telekomünikasyon Ticaret Ltd. Şti.5 Nov 20145 Nov 20145 Nov 2015
506antalya-organizasyon.orgPDR Ltd. d/b/a PublicDomainRegistry.com20 Aug 201420 Aug 201420 Aug 2015
507antalyabrother.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Aug 201420 Aug 201420 Aug 2015
508antalyacigkofte.netFBS Inc.20 Aug 201413 Sep 201720 Aug 2018
509antalyaemlakara.comFBS Inc.20 Aug 201420 Aug 201420 Aug 2016
510antalyaescort.bizPDR Ltd. d/b/a PublicDomainRegistry.com30 Jan 20254 Feb 202530 Jan 2026
511antalyafilmguide.orgNics Telekomünikasyon Ticaret Ltd. Şti.20 Aug 201418 Aug 201720 Aug 2018
512antalyafilmrehberi.orgNics Telekomünikasyon Ticaret Ltd. Şti.20 Aug 201419 Aug 201620 Aug 2017
513antalyafxbilgisayar.comThreadwise.com, Inc.20 Aug 201420 Aug 201420 Aug 2015
514antalyakomagene.comFBS Inc.20 Aug 201413 Sep 201720 Aug 2018
515antalyapfaff.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Aug 201420 Aug 201420 Aug 2015
516antalyasinger.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Aug 201420 Aug 201420 Aug 2015
517antalya-seo.netPDR Ltd. d/b/a PublicDomainRegistry.com24 May 202024 May 202024 May 2021
518antalyaacikoleji.comFBS Inc.12 Jan 201525 May 201712 Jan 2020
519antalyaalyansimalati.comFBS Inc.12 Jan 201512 Jan 201512 Jan 2016
520antalyaasansorkiralama.orgFBS Inc.9 Aug 20179 Aug 20179 Aug 2018
521antalyaasansorluevdenevenakliyat.comİsimtescil Bilişim A.Ş.12 Jan 202325 Mar 202412 Jan 2024
522antalyaasansorlunakliyat.orgFBS Inc.12 Jan 201512 Jan 201512 Jan 2016
523antalyabilimsanatmerkezi.comTucows Domains Inc.12 Jan 201516 Jan 201612 Jan 2017
524antalyada-kiralikaraba.comNics Telekomünikasyon Ticaret Ltd. Şti.12 Jan 201512 Jan 201512 Jan 2016
525antalyadane.comeNom, Inc.13 May 201613 May 201613 May 2017
526antalyadarentcar.comNics Telekomünikasyon Ticaret Ltd. Şti.12 Jan 201512 Jan 201512 Jan 2016
527antalyaders.comFBS Inc.11 Oct 201614 Oct 201711 Oct 2018
528antalyahizliokuma.orgTucows Domains Inc.12 Jan 201516 Jan 201612 Jan 2017
529antalyakekemelik.netTucows Domains Inc.12 Jan 201516 Jan 201612 Jan 2017
530antalyakolejler.comTucows Domains Inc.12 Jan 201516 Jan 201612 Jan 2017
531antalyamitvagen.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Jan 201512 Jan 201512 Jan 2016
532antalyamitvagen.netPDR Ltd. d/b/a PublicDomainRegistry.com12 Jan 201512 Jan 201512 Jan 2016
533antalyaotomatikapi.comFBS Inc.12 Jan 201512 Jan 201512 Jan 2016
534antalyaseksiescortlar.comFBS Inc.12 Jan 201512 Jan 201512 Jan 2016
535antalyavinckiralama.netGoDaddy.com, LLC14 May 201714 May 201714 May 2018
536antalyayatak.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Feb 202214 Feb 202520 Feb 2026
537antalyaevdekor.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Jan 201810 Jan 201810 Jan 2019
538antalyaevilaclama.comGoDaddy.com, LLC21 Aug 201422 Aug 201621 Aug 2017
539antalyafit.comKey-Systems GmbH8 Nov 202222 Jan 20248 Nov 2023
540antalyakombiklima.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Jul 20206 Jul 20206 Jul 2021
541antalyaaikido.comTurnCommerce, Inc. DBA NameBright.com6 Aug 201717 Sep 20246 Aug 2024
542antalyabynescort.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Feb 20156 Feb 20156 Feb 2016
543antalyadiksiyonkursu.netIHS Telekom, Inc.22 Feb 201724 Apr 201722 Feb 2018
544antalyadramakursu.comNics Telekomünikasyon Ticaret Ltd. Şti.21 Jul 202219 Jul 202521 Jul 2026
545antalyakolicim.comFBS Inc.6 Feb 20156 Feb 20156 Feb 2016
546antalyanotlari.comMat Bao Trading & Service Company Limited d/b/a Ma…2 Aug 20212 Aug 20212 Aug 2022
547antalyaodays.com-6 Feb 201523 Jan 20256 Feb 2026
548antalyaofest.com-6 Feb 201523 Jan 20256 Feb 2026
549antalyaoyunculukkursu.comNics Telekomünikasyon Ticaret Ltd. Şti.28 Feb 201827 Feb 202528 Feb 2026
550antalyapiyanokursu.com-29 Dec 20216 Jan 202529 Dec 2025
551antalyasirkfestivali.comDNC Holdings, Inc.6 Feb 20158 Jan 20256 Feb 2028
552antalyasirki.comDNC Holdings, Inc.6 Feb 20158 Jan 20256 Feb 2028
553antalyarentecar.comFBS Inc.12 Dec 201812 Dec 201812 Dec 2019
554antalyaparadise.com1&1 Internet AG6 Nov 20147 Nov 20246 Nov 2025
555antalya-uzmanlar-sacekim.comeNom, Inc.6 Nov 20146 Nov 20146 Nov 2015
556antalya-sacekim-uzmanlari.comeNom, Inc.6 Nov 20146 Nov 20146 Nov 2015
557antalya-sac.comeNom, Inc.6 Nov 20146 Nov 20146 Nov 2015
558antalya-esthetic-travel.comeNom, Inc.6 Nov 20146 Nov 20146 Nov 2015
559antalyaotokaporta.netTucows Domains Inc.6 Nov 20149 Nov 20156 Nov 2016
560antalyaforkliftkiralama.netFBS Inc.5 Nov 20145 Nov 20145 Nov 2015
561antalyabayanescortlar.netGoDaddy.com, LLC11 Feb 201611 Feb 201611 Feb 2017
562antalyabulteni.comAutomattic Inc.5 Feb 202127 Oct 20235 Feb 2026
563antalyacitteli.com-31 Oct 201631 Oct 201631 Oct 2017
564antalyaehliyet.netWild West Domains, LLC28 Feb 201528 Feb 201528 Feb 2016
565antalyaguvenlikdanismanligi.comNics Telekomünikasyon Ticaret Ltd. Şti.28 Feb 201528 Feb 201528 Feb 2016
566antalyalavaboacma.netNics Telekomünikasyon Ticaret Ltd. Şti.28 Feb 201524 Jul 202528 Feb 2026
567antalyamekanlari.comAtak Domain Hosting Internet d/b/a Atak Teknoloji2 Mar 20252 Mar 20252 Mar 2026
568antalyamia.netGoDaddy.com, LLC28 Feb 201528 Feb 201528 Feb 2016
569antalyasahibinde.comNics Telekomünikasyon Ticaret Ltd. Şti.28 Feb 201528 Feb 201528 Feb 2016
570antalyasandfest.orgUniregistrar Corp28 Feb 201528 Feb 201528 Feb 2016
571antalyatikaniklikacma.comNics Telekomünikasyon Ticaret Ltd. Şti.28 Feb 201514 Jul 202528 Feb 2026
572antalyatikaniklikacma.netNics Telekomünikasyon Ticaret Ltd. Şti.28 Feb 201528 Feb 201528 Feb 2016
573antalyadogumuzmani.comTucows Domains Inc.19 Aug 201323 Aug 201419 Aug 2015
574antalyaikincielnotebook.comNameCheap, Inc.18 May 201818 May 201818 May 2019
575antalyakervannakliyat.comName.com, Inc.10 Nov 201710 Nov 201710 Nov 2018
576antalyakizlikzaridikimi.netİsimtescil Bilişim A.Ş.18 Nov 201431 Jan 202518 Nov 2024
577antalyamedyum.orgNetwork Solutions, LLC22 Aug 201422 Aug 201422 Aug 2015
578antalyasismemanken.comFBS Inc.22 Aug 201422 Aug 201422 Aug 2015
579antalyatekniktesisat.comIHS Telekom, Inc.10 Jan 202527 Apr 202510 Jan 2028
580antalyaucuzdekorasyon.comFBS Inc.22 Aug 201413 Sep 201722 Aug 2018
581antalyavajinismustedavisi.netTucows Domains Inc.19 Aug 201323 Aug 201419 Aug 2015
582antalya-mantolama.comIHS Telekom, Inc.14 Apr 201514 Apr 201514 Apr 2016
583antalyabekoservis.orgFBS Inc.14 Apr 201514 Apr 201514 Apr 2016
584antalyacemiyeti.comGoDaddy.com, LLC26 Aug 201826 Aug 201826 Aug 2019
585antalyaface.comFBS Inc.14 Aug 201814 Aug 201814 Aug 2019
586antalyaiselbisesi.comIHS Telekom, Inc.14 Apr 201514 Apr 201514 Apr 2016
587antalyamantolamafirmasi.comIHS Telekom, Inc.14 Apr 201514 Apr 201514 Apr 2016
588antalyaservisarcelik.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Apr 201524 Oct 201614 Apr 2018
589antalyaservisariston.comFBS Inc.14 Apr 201514 Apr 201514 Apr 2016
590antalyaservisbeko.comFBS Inc.14 Apr 201514 Apr 201514 Apr 2016
591antalyaservisbosch.comFBS Inc.14 Apr 201515 Apr 201514 Apr 2016
592antalyaservissiemens.comFBS Inc.14 Apr 201515 Apr 201514 Apr 2016
593antalyasiemensservis.netBeijing Lanhai Jiye Technology Co., Ltd29 Apr 202230 Apr 202429 Apr 2025
594antalyatemizlikfirmalar.netTucows Domains Inc.14 Apr 201514 Apr 201514 Apr 2017
595antalyainlife.netFBS Inc.23 Aug 201423 Aug 201423 Aug 2015
596antalyakizlikzari.orgTucows Domains Inc.19 Aug 201323 Aug 201419 Aug 2015
597antalyakoltukyikama.org1&1 Internet AG13 Mar 20164 Nov 201613 Mar 2018
598antalyatravelguide.netTucows Domains Inc.23 Aug 201427 Aug 201723 Aug 2017
599antalyaturizmrehberi.netTucows Domains Inc.23 Aug 201423 Aug 201723 Aug 2018
600antalyaambari.netGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
601antalyagece.netFBS Inc.24 Jun 201524 Jun 201524 Jun 2016
602antalyaumutnakliyat.comFBS Inc.25 Jan 201625 Jan 201625 Jan 2017
603antalyaucuzotoekspertiz.comIHS Telekom, Inc.7 Nov 20147 Nov 20147 Nov 2015
604antalyaucuzekspertiz.comIHS Telekom, Inc.7 Nov 20147 Nov 20147 Nov 2015
605antalyaucanhali.com-23 Sep 201623 Sep 201623 Sep 2017
606antalyasporkoleji.comAlantron BiliÅŸim Ltd Åžti.7 Nov 20147 Nov 20147 Nov 2015
607antalyasporcafe.comAlantron BiliÅŸim Ltd Åžti.7 Nov 20147 Nov 20147 Nov 2015
608antalyasporbufe.comAlantron BiliÅŸim Ltd Åžti.7 Nov 20147 Nov 20147 Nov 2015
609antalyaotomobilekspertiz.comIHS Telekom, Inc.7 Nov 20147 Nov 20147 Nov 2015
610antalyaistanbul.comReg2C.com Inc.7 Nov 20147 Nov 20147 Nov 2015
611antalyahaskunefe.comFBS Inc.7 Nov 201418 May 20177 Nov 2017
612antalyaguvenlikkamerasistemi.comTucows Domains Inc.8 Nov 201412 Nov 20158 Nov 2016
613antalyaeskpertizraporu.comIHS Telekom, Inc.7 Nov 20147 Nov 20147 Nov 2015
614antalyaelitescort.comGoDaddy.com, LLC17 Jun 202022 Jun 202217 Jun 2022
615antalyaekspertizotomobil.comIHS Telekom, Inc.7 Nov 20147 Nov 20147 Nov 2015
616antalyadaotoekspertiz.comIHS Telekom, Inc.7 Nov 20147 Nov 20147 Nov 2015
617antalyadakisatilikdaireler.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Nov 20147 Nov 20147 Nov 2015
618antalyadacikmalastik.comFBS Inc.7 Nov 20147 Nov 20147 Nov 2015
619antalyadacikmajant.comFBS Inc.7 Nov 20147 Nov 20147 Nov 2015
620antalyacambalkon1.comTucows Domains Inc.4 Nov 20128 Nov 20144 Nov 2015
621antalyabayankuaforu.com-9 Jan 202531 May 20259 Jan 2027
622antalyaatestarim.comNics Telekomünikasyon Ticaret Ltd. Şti.7 Nov 20147 Nov 20147 Nov 2015
623antalyaaracekspertizraporu.comIHS Telekom, Inc.7 Nov 20147 Nov 20147 Nov 2015
624antalyaaracekspertiz.com-16 Apr 202416 Apr 202516 Apr 2026
625antalyaarabaekspertiz.comIHS Telekom, Inc.7 Nov 20147 Nov 20147 Nov 2015
626antalyaflowerfestival.comWild West Domains, LLC12 Aug 201412 Aug 201412 Aug 2015
627antalyaflowershow.netWild West Domains, LLC12 Aug 201412 Aug 201412 Aug 2015
628antalyamatematikozelders.netName.com, Inc.12 Aug 201412 Aug 201412 Aug 2015
629antalyaevdeneve.orgGoogle, Inc.13 May 202224 Jul 202513 May 2025
630antalyaeskortbayan.orgNameCheap, Inc.23 Apr 202419 Mar 202523 Apr 2026
631antalyaescort.mobiPorkbun, LLC2 Mar 20252 Mar 20252 Mar 2026
632antalyahostes.com-30 Dec 20233 Jul 202430 Dec 2025
633antalyakiralik.orgIHS Telekom, Inc.24 Aug 201424 Aug 201424 Aug 2015
634antalya724.netReg2C.com Inc.25 Aug 201425 Aug 201425 Aug 2015
635antalyaalarmkamera.comFBS Inc.26 Aug 201426 Aug 201426 Aug 2015
636antalyaalarmmerkezi.comFBS Inc.26 Aug 201426 Aug 201426 Aug 2015
637antalyaanket.comİsimtescil Bilişim A.Ş.6 Jul 20227 Jul 20256 Jul 2026
638antalyabizimhaliyikama.comBeijing Lanhai Jiye Technology Co., Ltd11 Nov 202112 Nov 202411 Nov 2025
639antalyadabacatemizligi.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Aug 201426 Aug 201426 Aug 2015
640antalyaguvenlikmerkezi.comFBS Inc.26 Aug 201426 Aug 201426 Aug 2015
641antalyahavalandirmafirmasi.comNics Telekomünikasyon Ticaret Ltd. Şti.3 May 20253 May 20253 May 2026
642antalyakameraalarm.comNics Telekomünikasyon Ticaret Ltd. Şti.6 Nov 202412 Nov 20246 Nov 2025
643antalyakameramerkezi.comFBS Inc.26 Aug 201426 Aug 201426 Aug 2015
644antalyakanalizasyon.comİsimtescil Bilişim A.Ş.13 Nov 201518 Jul 202513 Nov 2025
645antalyakombiavm.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Aug 201426 Aug 201426 Aug 2015
646antalyamarinahostelpansion.comFBS Inc.26 Aug 20142 Jun 201726 Aug 2017
647antalyamydream.com-26 Aug 201426 Aug 201426 Aug 2017
648antalyaorunemlak.infoOnlineNIC, Inc.26 Aug 201427 Aug 201426 Aug 2016
649antalyaport.comDropCatch.com 922 LLC13 Feb 202013 Aug 202513 Feb 2026
650antalyaprofesyonelexpresshaliyikama.comIHS Telekom, Inc.26 Aug 201426 Aug 201426 Aug 2015
651antalyasigorta.bizRealtime Register B.V.18 Nov 202218 Nov 202318 Nov 2023
652antalyasigorta.orgNics Telekomünikasyon Ticaret Ltd. Şti.26 Aug 201426 Oct 201426 Aug 2019
653antalyavipmasoz.comFBS Inc.8 Nov 20148 Nov 20148 Nov 2015
654antalyasarisayfalar.comFBS Inc.2 Aug 201612 Sep 20172 Aug 2017
655antalyanakliyecisi.comGoDaddy.com, LLC30 Jan 201730 Jan 201730 Jan 2018
656antalyamuzikkurslari.comFBS Inc.8 Nov 20148 Nov 20148 Nov 2015
657antalyaescortsitesi.comNameCheap, Inc.26 Mar 202410 Oct 202426 Mar 2026
658antalyaeglencemekanlari.comGoDaddy.com, LLC8 Nov 20148 Nov 20148 Nov 2015
659antalyachts.comGoDaddy.com, LLC14 Jun 201613 Jun 202414 Jun 2026
660antalyadamekanlar.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Aug 201411 Aug 201613 Aug 2017
661antalyaescortlarix.comDynadot8 LLC13 Aug 201415 Mar 201713 Aug 2018
662antalyagebelik.comGoDaddy.com, LLC9 Jul 20249 Jul 20249 Jul 2027
663antalyagiyim.comWild West Domains, LLC14 Jul 202014 Jul 202014 Jul 2021
664antalyaidrarkacirma.comGoDaddy.com, LLC13 Aug 201425 Oct 202213 Aug 2022
665antalyakadinhastaliklari.comGoDaddy.com, LLC9 Jul 20249 Jul 20249 Jul 2027
666antalyakurtaj.comİsimtescil Bilişim A.Ş.13 Aug 201415 Aug 202513 Aug 2026
667antalyaposterleri.comGoDaddy.com, LLC13 Aug 201413 Aug 201413 Aug 2015
668antalyasanalmarket.comGoogle, Inc.11 Apr 20203 Jun 202511 Apr 2026
669antalyatourist.netReg2C.com Inc.7 Nov 20147 Nov 20147 Nov 2015
670antalyahomes.orgNameCheap, Inc.2 Mar 202414 Apr 20252 Mar 2025
671antalyadugunfotografcisi.netİsimtescil Bilişim A.Ş.24 Jan 201619 Dec 202424 Jan 2026
672antalyabiletofisi.comIHS Telekom, Inc.14 Aug 20141 Aug 202514 Aug 2026
673antalyadigiturk.comGoDaddy.com, LLC22 Aug 202427 Aug 202522 Aug 2026
674antalyaeniyi.com-18 Jul 202518 Jul 202518 Jul 2026
675antalyaescorto.comNameCheap, Inc.22 Mar 202522 Mar 202522 Mar 2026
676antalyaevdenevetasimacilik.infoDynadot, LLC2 Mar 20222 Mar 20222 Mar 2023
677antalyaklimaservisim.infoFBS Inc.14 Aug 201414 Aug 201414 Aug 2015
678antalyakompanzasyon.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.12 Apr 202512 Jun 202512 Apr 2028
679antalyaperdetasarim.comNics Telekomünikasyon Ticaret Ltd. Şti.14 Aug 201414 Aug 201414 Aug 2015
680antalyatekneturu.comIHS Telekom, Inc.1 Nov 201610 Jan 20251 Nov 2025
681antalyayatturlari.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Aug 202214 Oct 20252 Aug 2025
682antalyaekipsogutma.comKey-Systems GmbH9 Nov 201410 Nov 20149 Nov 2015
683antalyadiamondestate.comFBS Inc.9 Nov 20149 Nov 20149 Nov 2015
684antalyacilingiriniz.comNordreg AB17 Feb 202519 Apr 202517 Feb 2026
685antalyaguvenlikalarm.comNics Telekomünikasyon Ticaret Ltd. Şti.27 Aug 201427 Aug 201427 Aug 2015
686antalyaguvenlikkamera.comNics Telekomünikasyon Ticaret Ltd. Şti.28 Mar 20188 Jun 201928 Mar 2028
687antalyahipodromu.comFBS Inc.4 Jan 20184 Jan 20184 Jan 2019
688antalyahypoxi.comXin Net Technology Corporation22 Feb 202127 May 202122 Feb 2022
689antalyamekaniktesisat.comNics Telekomünikasyon Ticaret Ltd. Şti.27 Aug 201427 Aug 201427 Aug 2015
690antalyasalonshne.comReg2C.com Inc.27 Aug 201419 Aug 201627 Aug 2017
691antalyateknikservis.netSquarespace Domains LLC10 Oct 202510 Oct 202510 Oct 2026
692antalyatavsiye.orgReg2C.com Inc.8 Nov 20148 Nov 20148 Nov 2015
693antalyatavsiye.netReg2C.com Inc.8 Nov 20148 Nov 20148 Nov 2015
694antalyasex.netIHS Telekom, Inc.10 Nov 201410 Nov 201410 Nov 2015
695antalya-escortlari.mobiFBS Inc.15 Aug 201415 Aug 201415 Aug 2015
696antalyaanten.comName.com, Inc.12 Sep 201712 Sep 201712 Sep 2018
697antalyaantenci.comFBS Inc.15 Aug 201415 Aug 201415 Aug 2015
698antalyabayaneskortlar.mobiFBS Inc.15 Aug 201415 Aug 201415 Aug 2015
699antalyadacambalkon.comIHS Telekom, Inc.10 Oct 201710 Oct 201710 Oct 2018
700antalyadangeziler.comİsimtescil Bilişim A.Ş.17 Oct 20219 Oct 202517 Oct 2026
701antalyaescortisimleri.mobiFBS Inc.15 Aug 201415 Aug 201415 Aug 2015
702antalyaescortlara.mobiFBS Inc.15 Aug 201415 Aug 201415 Aug 2015
703antalyaescortresimleri.mobiFBS Inc.15 Aug 201415 Aug 201415 Aug 2015
704antalyaescortsinirsiz.mobiFBS Inc.15 Aug 201415 Aug 201415 Aug 2015
705antalyaescortucuz.mobiFBS Inc.15 Aug 201415 Aug 201415 Aug 2015
706antalyaevdenevetasimacilik.bizNameKing.com Inc.14 Nov 202114 Nov 202114 Nov 2022
707antalyamedldf.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Aug 201415 Aug 201415 Aug 2015
708antalyamedldf.orgDropCatch.com 851 LLC1 Nov 20172 Nov 20171 Nov 2018
709antalyasiemensservis.comNics Telekomünikasyon Ticaret Ltd. Şti.15 Aug 201415 Aug 201415 Aug 2015
710antalyaticari.com-31 Dec 20221 Mar 202431 Dec 2023
711antalyaturistik.comNics Telekomünikasyon Ticaret Ltd. Şti.15 Aug 201415 Aug 201415 Aug 2015
712antalyaescortilan.netGoDaddy.com, LLC20 Mar 20241 May 202520 Mar 2026
713antalyaturkuaz.netFBS Inc.27 Aug 201413 Sep 201727 Aug 2018
714antalyaescortantalya.orgPDR Ltd. d/b/a PublicDomainRegistry.com27 Aug 201427 Aug 201427 Aug 2015
715antalyaescortu.infoGoDaddy.com, LLC7 May 20167 May 20167 May 2017
716antalyaliescortbayan.comGoDaddy.com, LLC28 Aug 201428 Aug 201428 Aug 2015
717antalyasam.netPDR Ltd. d/b/a PublicDomainRegistry.com29 Aug 201426 Aug 201629 Aug 2017
718antalyasehirlerarasinakliyat.comİsimtescil Bilişim A.Ş.3 Jan 20214 Nov 20243 Jan 2026
719antalya-davetiye.comİsimtescil Bilişim A.Ş.9 Feb 202428 Aug 20259 Feb 2026
720antalya-turkiye.comTucows Domains Inc.26 Aug 202526 Aug 202526 Aug 2026
721antalyajeoteknik.comIHS Telekom, Inc.16 Aug 201416 Aug 201416 Aug 2015
722antalyamikrobayi.comNics Telekomünikasyon Ticaret Ltd. Şti.10 Nov 201410 Nov 201410 Nov 2015
723antalyagunlukkiralik.com-23 Apr 202324 May 202423 Apr 2024
724antalyageziyor.comAtak Domain Hosting Internet d/b/a Atak Teknoloji26 Nov 202426 Nov 202426 Nov 2025
725antalyaapartdaire.comNics Telekomünikasyon Ticaret Ltd. Şti.10 Nov 201410 Nov 201410 Nov 2015
726antalya1.comName.com, Inc.5 Aug 20244 Aug 20255 Aug 2026
727antalya-uzmanlar-sacekimi.comeNom, Inc.10 Nov 201410 Nov 201410 Nov 2015
728antalya-turizm.comNics Telekomünikasyon Ticaret Ltd. Şti.10 Nov 201410 Nov 201410 Nov 2015
729antalyabocekilaclama.infoFBS Inc.17 Aug 201417 Aug 201417 Aug 2015
730antalyacast.comİsimtescil Bilişim A.Ş.10 Jun 202324 Aug 202410 Jun 2024
731antalyadiodelazer.comIHS Telekom, Inc.5 Jul 20195 Jul 20195 Jul 2020
732antalyaescortkizlari.comGoDaddy.com, LLC17 Apr 202318 Apr 202517 Apr 2026
733antalyaescortvitrin.comNetwork Solutions, LLC17 Aug 201417 Aug 201417 Aug 2015
734antalyaholiday.netNetwork Solutions, LLC17 Aug 201417 Aug 201417 Aug 2015
735antalyaozturklernakliyat.comNETIM SARL5 Apr 20245 Apr 20245 Apr 2025
736antalyastorperdeyikama.comİsimtescil Bilişim A.Ş.30 Jun 202012 Aug 202430 Jun 2024
737antalyatente.infoFBS Inc.17 Aug 201417 Aug 201417 Aug 2015
738antalyatr.comGoDaddy.com, LLC11 Nov 201417 May 202511 Nov 2025
739antalyakiralikgelinlik.comTucows Domains Inc.11 Nov 201415 Nov 201511 Nov 2016
740antalyailimyrahotel.comAbove.com Pty Ltd.12 Nov 201412 Nov 201412 Nov 2015
741antalyaescortdns.comGoDaddy.com, LLC11 Nov 201412 Nov 201411 Nov 2015
742antalyacilekshop.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Nov 201411 Nov 201411 Nov 2015
743antalyaescortbayanlar.orgGoDaddy.com, LLC1 Jun 20161 Jun 20161 Jun 2017
744antalya-club.netRealtime Register B.V.10 Mar 2020-10 Mar 2021
745antalyakadinkoop.orgIHS Telekom, Inc.12 Nov 201412 Nov 201412 Nov 2015
746antalyagunlukkiralik.netİsimtescil Bilişim A.Ş.31 Mar 202113 Jun 202531 Mar 2025
747antalyaburomobilyalari.netPDR Ltd. d/b/a PublicDomainRegistry.com6 May 20206 May 20206 May 2021
748antalyabeton.comNics Telekomünikasyon Ticaret Ltd. Şti.12 Apr 202313 Apr 202512 Apr 2026
749antalyacerkesdernegi.com-15 Nov 202415 Nov 202415 Nov 2025
750antalyahabercisi.comIHS Telekom, Inc.29 Aug 20149 Oct 202529 Aug 2025
751antalyahavalimanioteltransfer.orgTucows Domains Inc.28 Aug 20141 Sep 201528 Aug 2016
752antalyanakliyem.netAcens Technologies, S.L.U.29 Aug 201429 Aug 201429 Aug 2015
753antalyasocial.comNics Telekomünikasyon Ticaret Ltd. Şti.15 Aug 202515 Aug 202515 Aug 2026
754antalyasosyal.com-13 Jun 202413 Jul 202513 Jun 2025
755antalyasosyete.netFBS Inc.31 Mar 201620 May 201731 Mar 2018
756antalyatransfer.proFBS Inc.26 Nov 201725 Jan 201826 Nov 2018
757antalyaasansorlunakliyat.com-4 Aug 20254 Aug 20254 Aug 2026
758antalyadenizkulubu.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Sep 201412 Sep 201412 Sep 2015
759antalyaemlaksitesi.comReg2C.com Inc.25 May 20228 Jul 202325 May 2023
760antalyakaramancinakliyat.comeNom, Inc.20 May 202420 May 202420 May 2025
761antalyakoltukkanepehastanesi.comOnlineNIC, Inc.28 Jan 201628 Jan 201628 Jan 2017
762antalyakostum.comGoDaddy.com, LLC1 Dec 201822 Jul 20251 Dec 2027
763antalyakoykahvaltisi.comGoDaddy.com, LLC19 Nov 201931 Jan 202419 Nov 2023
764antalyasayarasansorlutasimacilik.comGMO Internet Inc.29 Nov 201829 Nov 201829 Nov 2019
765antalyasigarabirakma.bizFBS Inc.11 Sep 201411 Sep 201410 Sep 2015
766antalyadakiralikvilla.comAtak Domain Hosting Internet d/b/a Atak Teknoloji26 Jul 201826 Jul 201826 Jul 2019
767antalyaflughafentransfer.mobiFBS Inc.30 Aug 201430 Aug 201430 Aug 2015
768antalyagunemlak.comFBS Inc.30 Aug 201430 Aug 201430 Aug 2015
769antalyaozeldireksiyondersi.comAlantron BiliÅŸim Ltd Åžti.14 Aug 201616 Aug 201629 Aug 2018
770antalyaservice.comNameCheap, Inc.1 Aug 20244 Jul 20251 Aug 2026
771antalyanakliyatcisi.comIHS Telekom, Inc.13 Nov 201413 Nov 201413 Nov 2015
772antalyamsigorta.comReg2C.com Inc.13 Nov 20145 Oct 201613 Nov 2017
773antalyabasket.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.16 Oct 202516 Oct 202516 Oct 2026
774antalyaatletik.comNics Telekomünikasyon Ticaret Ltd. Şti.13 Nov 201413 Nov 201413 Nov 2015
775antalyagranit.comIHS Telekom, Inc.28 Apr 202528 Jun 202528 Apr 2026
776antalyaguzelliksalonlari.com-3 Aug 20163 Aug 20163 Aug 2017
777antalyakombimarket.comAtak Domain Hosting Internet d/b/a Atak Teknoloji25 Nov 202127 Nov 202125 Nov 2022
778antalyarusescort.comGoDaddy.com, LLC2 Oct 20182 Oct 20182 Oct 2019
779antalyasex.comDropCatch.com 428 LLC13 Sep 201414 Sep 201713 Sep 2018
780antalyabayanhizmeti.comeNom, Inc.31 Aug 201431 Aug 201431 Aug 2015
781antalyabayanlar.comName.com, Inc.21 Feb 202526 Feb 202521 Feb 2026
782antalyaescorthizmeti.comeNom, Inc.31 Aug 201431 Aug 201431 Aug 2015
783antalyaevyemekleri.netOnlineNIC, Inc.31 Aug 201431 Aug 201431 Aug 2015
784antalyagures.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Aug 20141 Sep 201431 Aug 2015
785antalyakultursanat.comGMO Internet Inc.31 Jan 202312 Mar 202430 Jan 2024
786antalyaotosanayi.comFBS Inc.31 Aug 201431 Aug 201431 Aug 2015
787antalyatransferim.orgFBS Inc.31 Aug 201413 Sep 201731 Aug 2018
788antalyatransfertaxi.comIHS Telekom, Inc.23 Mar 202119 Mar 202523 Mar 2027
789antalyagranit.netIHS Telekom, Inc.14 Oct 201624 Nov 201714 Oct 2017
790antalya-turlari.comNics Telekomünikasyon Ticaret Ltd. Şti.14 Sep 201414 Sep 201414 Sep 2015
791antalya-turu.comNics Telekomünikasyon Ticaret Ltd. Şti.14 Sep 201414 Sep 201414 Sep 2015
792antalyahediyeci.comFBS Inc.14 Sep 201414 Sep 201414 Sep 2015
793antalyaturu.netName.com, Inc.1 Aug 20181 Aug 20181 Aug 2019
794antalya2go.comHiChina Zhicheng Technology Limited7 Nov 20197 Nov 20197 Nov 2020
795antalyapazarlama.com-25 Nov 202425 Nov 202425 Nov 2025
796antalyarealistikmanken.comFBS Inc.1 Sep 20141 Sep 20141 Sep 2015
797antalyaofismobilyalari.netIHS Telekom, Inc.22 Jul 20221 Sep 202322 Jul 2023
798antalyafuzyonkaynak.comGoDaddy.com, LLC16 Sep 201427 Sep 201616 Sep 2017
799antalyawebgrafik.comNics Telekomünikasyon Ticaret Ltd. Şti.16 Sep 201416 Sep 201416 Sep 2015
800antalyacicekciniz.comFBS Inc.16 Sep 201415 Sep 201716 Sep 2018
801antalyafilmekibi.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Dec 20164 Nov 20234 Dec 2028
802antalyafuzyon.comGoDaddy.com, LLC16 Sep 201427 Sep 201616 Sep 2017
803antalyagrafikweb.comNics Telekomünikasyon Ticaret Ltd. Şti.16 Sep 201416 Sep 201416 Sep 2015
804antalyaistanbulevdenevenakliyat.comFBS Inc.16 Sep 201417 Sep 201416 Sep 2015
805antalyazumrutnakliyat.comIHS Telekom, Inc.6 Jan 20166 Jan 20166 Jan 2017
806antalyamarkatescil.netEveryones Internet, Ltd. dba SoftLayer16 Sep 201425 Sep 201516 Sep 2016
807antalyasnail.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Sep 201416 Sep 201416 Sep 2015
808antalyauydusistemleri.comFBS Inc.16 Sep 201416 Sep 201416 Sep 2015
809antalya-manavgat.comNetwork Solutions, LLC2 Sep 20142 Sep 20142 Sep 2015
810antalya-x.comFBS Inc.2 Sep 20142 Sep 20142 Sep 2015
811antalyabaharsurucukurslari.comIHS Telekom, Inc.2 Sep 201422 Dec 20172 Sep 2018
812antalyacriticalcare2014.orgTucows Domains Inc.29 Aug 20132 Sep 201429 Aug 2015
813antalyadedektor.netNics Telekomünikasyon Ticaret Ltd. Şti.24 May 20213 Aug 202424 May 2024
814antalyadomstroy.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Sep 20145 Aug 20153 Sep 2018
815antalyaik.comGoDaddy.com, LLC2 Sep 20143 Sep 20162 Sep 2017
816antalyapanjurtamircisi.comNics Telekomünikasyon Ticaret Ltd. Şti.2 Sep 20142 Sep 20142 Sep 2015
817antalyapiyanodersi.comIHS Telekom, Inc.15 Dec 201424 Dec 202415 Dec 2025
818antalyavinc.orgIHS Telekom, Inc.30 Jun 20255 Jul 202530 Jun 2026
819antalyatorna.comIHS Telekom, Inc.9 Mar 20199 Mar 20199 Mar 2020
820antalyashotel.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Nov 20146 Nov 201614 Nov 2017
821antalyaseydatel.comFBS Inc.2 Feb 201619 May 20172 Feb 2018
822antalyasecim.comIHS Telekom, Inc.29 Aug 202312 Sep 202529 Aug 2026
823antalyasatilikotel.comNics Telekomünikasyon Ticaret Ltd. Şti.14 Nov 201414 Nov 201414 Nov 2015
824antalyapersonel.comenom371, Incorporated5 May 20196 May 20195 May 2020
825antalyakabir.comİsimtescil Bilişim A.Ş.2 Feb 201629 Jan 20252 Feb 2030
826antalyajobcenter.com----
827antalyailterkardeslerhurda.comFBS Inc.14 Nov 201414 Nov 201414 Nov 2015
828antalyaduskabin.comHongkong Domain Name Information Management Co., L…20 Nov 202230 Dec 202320 Nov 2023
829antalyacikmayedekparcahurda.comFBS Inc.14 Nov 201415 Nov 201414 Nov 2015
830antalya2elotelmalzemesi.comFBS Inc.14 Nov 201414 Nov 201414 Nov 2015
831antalya-rent-acar.comFBS Inc.14 Nov 201414 Nov 201414 Nov 2015
832antalyakameraalarmsistemleri.comAlantron BiliÅŸim Ltd Åžti.17 Sep 201728 Nov 201714 Sep 2018
833antalyakameravealarmsistemleri.comAlantron BiliÅŸim Ltd Åžti.17 Sep 201728 Nov 201714 Sep 2018
834antalyalavazza.comFBS Inc.15 Sep 201415 Sep 201415 Sep 2015
835antalyaotocilingir.comİsimtescil Bilişim A.Ş.19 Mar 201617 Mar 202519 Mar 2026
836antalyatipkitabevi.comFBS Inc.15 Sep 201415 Sep 201415 Sep 2015
837antalyaucuzluk.comFBS Inc.15 Sep 201415 Sep 201415 Sep 2015
838antalyauyduanten.comFBS Inc.15 Sep 201414 Sep 201715 Sep 2021
839antalyavize.comenom417, Incorporated19 Jan 202517 Mar 202519 Jan 2026
840antalyaescort.proPorkbun, LLC1 Oct 20241 Oct 20241 Oct 2025
841antalyacocukmedya.comNics Telekomünikasyon Ticaret Ltd. Şti.3 Sep 20143 Sep 20143 Sep 2015
842antalyaescortt.comDynadot, LLC20 Feb 20241 Apr 202520 Feb 2025
843antalyayosmerkezi.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.3 Sep 20143 Sep 20143 Sep 2015
844antalyacilingirhizmeti.comOnlineNIC, Inc.16 Sep 201416 Sep 201416 Sep 2015
845antalyamusikidernegi.comFBS Inc.16 Sep 201416 Sep 201416 Sep 2015
846antalyaozcelikmakina.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Dec 20185 Dec 20185 Dec 2019
847antalyaetutmerkezleri.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Jun 201615 Jun 201615 Jun 2017
848antalyasaklibahce.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Jun 20186 Jun 20186 Jun 2019
849antalyarentacar-airport.comIHS Telekom, Inc.15 Nov 201415 Nov 201415 Nov 2015
850antalyakalicimakyajegitimi.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Nov 201415 Nov 201415 Nov 2015
851antalyafountain.com-17 Jul 201617 Jul 201617 Jul 2017
852antalyaburada.orgPDR Ltd. d/b/a PublicDomainRegistry.com17 Sep 20142 Sep 201617 Sep 2017
853antalyaotoyikama.comNics Telekomünikasyon Ticaret Ltd. Şti.14 Mar 202514 Mar 202514 Mar 2026
854antalyaparatoner.netFBS Inc.17 Sep 201415 Sep 201717 Sep 2018
855antalyakresi.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Sep 201417 Sep 201417 Sep 2015
856antalyaotokuafor.comDropCatch.com 1091 LLC4 Nov 20174 Nov 20174 Nov 2018
857antalyacocukdishekimi.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Sep 201417 Jan 202517 Sep 2026
858antalyaholidayhotels.comGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
859antalyacazfestivali.netGoDaddy.com, LLC4 Sep 20144 Sep 20144 Sep 2016
860antalyaescortla.orgNetwork Solutions, LLC4 Sep 20144 Sep 20144 Sep 2015
861antalyahuzurevleri.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Sep 20144 Sep 20144 Sep 2015
862antalyajazzfestival.netGMO Internet Inc.12 Sep 2020-12 Sep 2021
863antalyaklimamontaji.comNics Telekomünikasyon Ticaret Ltd. Şti.16 May 202226 Jul 202416 May 2024
864antalyakopekegitim.comGoDaddy.com, LLC23 Nov 202124 Nov 202323 Nov 2025
865antalyamemursen.comReg2C.com Inc.4 Sep 20144 Sep 20144 Sep 2015
866antalyamemursen.orgNics Telekomünikasyon Ticaret Ltd. Şti.26 Sep 201727 Sep 202526 Sep 2026
867antalyazumba.netPDR Ltd. d/b/a PublicDomainRegistry.com1 Feb 20166 Feb 20171 Feb 2018
868antalyazumbadersi.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Sep 201411 Oct 20164 Sep 2017
869antalyarunners.orgAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.14 Nov 201414 Nov 201714 Nov 2018
870antalyajinekolog.infoIHS Telekom, Inc.14 Nov 201414 Nov 201414 Nov 2015
871antalyahidrofor.netIHS Telekom, Inc.27 May 201927 May 202127 May 2021
872antalyaairports.comNordreg AB15 Sep 202429 Sep 202515 Sep 2025
873antalyahavalimaniturkcell.comNics Telekomünikasyon Ticaret Ltd. Şti.18 Sep 201418 Sep 201418 Sep 2015
874antalyaairports.netGoDaddy.com, LLC18 Sep 201418 Sep 201418 Sep 2015
875antalyabrosurdagitimi.comNics Telekomünikasyon Ticaret Ltd. Şti.18 Sep 201419 Sep 201418 Sep 2015
876antalyademirapart.comOnlineNIC, Inc.18 Sep 20145 Mar 201718 Sep 2018
877antalyaairports.infoGoDaddy.com, LLC18 Sep 201418 Sep 201418 Sep 2015
878antalyaoldtown.comRealtime Register B.V.11 Jun 202511 Jun 202511 Jun 2026
879antalyamerkez.comName.com, Inc.25 Apr 201925 May 202525 Apr 2026
880antalyahotelclub.comFBS Inc.17 Nov 201417 Nov 201417 Nov 2015
881antalyaaikido.netIHS Telekom, Inc.5 Sep 201428 Sep 20165 Sep 2017
882antalyacityportal.comGoDaddy.com, LLC30 Dec 201630 Dec 201630 Dec 2017
883antalyacityportal.netPDR Ltd. d/b/a PublicDomainRegistry.com5 Sep 20145 Sep 20145 Sep 2015
884antalyadanakliyat.comAtak Domain Hosting Internet d/b/a Atak Teknoloji5 Sep 201412 Aug 20255 Sep 2026
885antalyaescortr.comName.com, Inc.8 Mar 20198 Mar 20198 Mar 2020
886antalyahavaalaniarackiralama.orgFBS Inc.5 Sep 201427 Apr 20175 Sep 2017
887antalyahavalimaniarabakiralama.orgFBS Inc.5 Sep 201427 Apr 20175 Sep 2017
888antalyahavalimaniotokiralama.orgFBS Inc.5 Sep 201427 Apr 20175 Sep 2017
889antalyamobilyarehberi.comGoDaddy.com, LLC24 Feb 201924 Feb 201924 Feb 2020
890antalyatennis.comFBS Inc.5 Sep 201431 Jul 20175 Sep 2021
891antalyawebofis.comKey-Systems GmbH5 Sep 20145 Sep 20145 Sep 2015
892antalyaairports.orgGoDaddy.com, LLC18 Sep 201418 Sep 201418 Sep 2015
893antalyacambalkon.orgAutomattic Inc.12 Feb 202028 Jan 202512 Feb 2026
894antalyaescortbayan.orgGoDaddy.com, LLC30 Jan 202416 Mar 202530 Jan 2026
895antalyacalismaizni.comPDR Ltd. d/b/a PublicDomainRegistry.com12 May 202012 May 202012 May 2021
896antalyaoturmaizni.comİsimtescil Bilişim A.Ş.25 Feb 202229 Nov 202425 Feb 2026
897antalyaveremsavas.comNics Telekomünikasyon Ticaret Ltd. Şti.19 Sep 201420 Sep 201419 Sep 2015
898antalyayabancipersonel.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Sep 201419 Sep 201419 Sep 2015
899antalyadalisveris.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Sep 201419 Sep 201419 Sep 2015
900antalyayabancicalismaizni.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Sep 201419 Sep 201419 Sep 2015
901antalyayabanciikametizin.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Sep 201419 Sep 201419 Sep 2015
902antalyabalikavituru.comTucows Domains Inc.19 Sep 201423 Sep 201519 Sep 2016
903antalya-cinsel-terapi.comGoDaddy.com, LLC6 Sep 201418 Nov 20226 Sep 2022
904antalya-jinekolog.comGoDaddy.com, LLC6 Sep 201430 Aug 20166 Sep 2017
905antalya-vajinismus.comCNOBIN INFORMATION TECHNOLOGY LIMITED25 Nov 20224 Jan 202425 Nov 2023
906antalyadogaltas.comOnlineNIC, Inc.8 Dec 201620 Dec 20178 Dec 2018
907antalyajaluzicam.comNamesilo, LLC14 May 201915 May 201914 May 2020
908antalyakadindogum.orgGoDaddy.com, LLC6 Sep 201423 Aug 20176 Sep 2018
909antalyapert.comInternet.bs Corp.6 Sep 20146 Sep 20146 Sep 2015
910antalyashopping.comGoogle, Inc.29 Nov 201514 Nov 202429 Nov 2025
911antalyavajinadaraltma.comBeijing Lanhai Jiye Technology Co., Ltd23 Feb 202324 Feb 202523 Feb 2026
912antalyarealties.comDomain.com, LLC13 Sep 200720 Sep 201413 Sep 2015
913antalyadaozeldireksiyondersi.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Sep 201420 Sep 201420 Sep 2015
914antalyasatis.comReg2C.com Inc.20 Sep 201423 Sep 201620 Sep 2017
915antalyaelektrikariza724.comNics Telekomünikasyon Ticaret Ltd. Şti.20 Sep 20148 Sep 202520 Sep 2026
916antalyaicmimari.comBizcn.com, Inc.13 Sep 201220 Sep 201413 Sep 2015
917antalyaegitim.netFBS Inc.11 Sep 201711 Sep 201711 Sep 2018
918antalyaozeldireksiyondersi.netPDR Ltd. d/b/a PublicDomainRegistry.com20 Sep 201420 Sep 201420 Sep 2015
919antalyaemlakilan.netName.com, Inc.6 Apr 20176 Dec 20176 Apr 2018
920antalyakafder.orgGMO Internet Inc.20 Sep 201421 Sep 201420 Sep 2015
921antalyakarlama.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Sep 20149 Oct 20257 Sep 2026
922antalyaklimabakim.comNameling.com LLC2 Feb 20133 Feb 20182 Feb 2019
923antalyayagmurrentacar.comName.com, Inc.17 Nov 201417 Nov 201417 Nov 2015
924antalyaspesialisten.comDomainestic.com Inc.17 Nov 201417 Nov 201417 Nov 2015
925antalyasitesi.comNameCheap, Inc.28 May 201911 Jun 202528 May 2026
926antalyakayserinakliyat.comKey-Systems GmbH17 Nov 201417 Nov 201417 Nov 2015
927antalyakartvizitsiparisi.comIHS Telekom, Inc.17 Nov 201417 Nov 201417 Nov 2015
928antalyajug.comGoDaddy.com, LLC17 Nov 201428 Sep 201617 Nov 2017
929antalyaizreklam.comFBS Inc.17 Nov 201417 Nov 201417 Nov 2015
930antalyaegleniyor.comReg2C.com Inc.18 Nov 201418 Nov 201418 Nov 2015
931antalyaortodonti.com-14 Sep 200620 Aug 202514 Sep 2026
932antalya-tour.comReg2C.com Inc.5 May 20255 Jul 20255 May 2026
933antalyasatis.netReg2C.com Inc.21 Sep 201421 Sep 201421 Sep 2015
934antalyabfit.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Sep 20148 Sep 20148 Sep 2015
935antalyabodybuilding.comIHS Telekom, Inc.8 Sep 20148 Sep 20148 Sep 2015
936antalyahavaalaniarabakiralama.orgFBS Inc.8 Sep 201427 Apr 20178 Sep 2017
937antalyahavaalaniotokiralama.orgFBS Inc.8 Sep 201427 Apr 20178 Sep 2017
938antalyaindirimkarti.comIHS Telekom, Inc.8 Sep 20148 Sep 20148 Sep 2015
939antalyakamoz.comNics Telekomünikasyon Ticaret Ltd. Şti.8 Sep 20148 Sep 20148 Sep 2015
940antalyaklimatamiri.comIHS Telekom, Inc.14 Jun 202413 Jun 202514 Jun 2026
941antalyamasajkeyfi.infoFBS Inc.8 Sep 201419 May 20178 Sep 2017
942antalyamasajsalonu.infoNamesilo, LLC28 Jun 20254 Sep 202528 Jun 2026
943antalyamekanlari.net-2 Mar 20252 Mar 20252 Mar 2026
944antalyamerkezotelleri.netReg2C.com Inc.8 Sep 20148 Sep 20148 Sep 2015
945antalyasporsalonlari.netAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.29 Dec 202029 Dec 202029 Dec 2021
946antalyaspottekstil.comFBS Inc.8 Sep 20148 Sep 20148 Sep 2015
947antalyasuaritmalari.comTucows Domains Inc.8 Sep 201412 Sep 20158 Sep 2016
948antalyabarbarosemlak.comOnlineNIC, Inc.30 Sep 201430 Sep 201430 Sep 2015
949antalyatiyatrofestivali.comNics Telekomünikasyon Ticaret Ltd. Şti.30 Sep 201430 Sep 202530 Sep 2026
950antalyatiyatrofestivali.netNics Telekomünikasyon Ticaret Ltd. Şti.30 Sep 201430 Sep 201430 Sep 2015
951antalyacilingirhizmetleri.comReg2C.com Inc.30 Sep 201430 Sep 201430 Sep 2015
952antalyaakilliev.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Feb 20216 Apr 202525 Feb 2026
953antalyaaksumedya.comFBS Inc.9 Sep 201419 May 20179 Sep 2017
954antalyaamerikankulturkolejias.comReg2C.com Inc.9 Sep 20149 Sep 20149 Sep 2015
955antalyabebekguvenlik.comNics Telekomünikasyon Ticaret Ltd. Şti.9 Sep 20149 Sep 20149 Sep 2015
956antalyaboyahastanesi.comFBS Inc.9 Sep 20149 Sep 20149 Sep 2015
957antalyagarantiguvenlik.comNics Telekomünikasyon Ticaret Ltd. Şti.9 Sep 20149 Sep 20149 Sep 2015
958antalyamarketsepetim.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Sep 20149 Sep 20149 Sep 2015
959antalyaotellerilistesi.comGoDaddy.com, LLC9 Sep 20149 Sep 20149 Sep 2015
960antalyaparfumeri.comGoDaddy.com, LLC9 Sep 20149 Sep 20149 Sep 2015
961antalyasampiyonkokorec.comIHS Telekom, Inc.9 Sep 20149 Sep 20149 Sep 2015
962antalyasmarthome.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Feb 20216 Apr 202525 Feb 2026
963antalya-tour.netTucows Domains Inc.1 Oct 20145 Oct 20181 Oct 2018
964antalyadugunorganizasyon.net1&1 Internet AG1 Oct 20141 Oct 20141 Oct 2015
965antalyainternethizmetleri.comGoDaddy.com, LLC1 Oct 201410 Oct 20161 Oct 2017
966antalya-gunlukkiralik.comAlantron BiliÅŸim Ltd Åžti.1 Oct 20141 Oct 20141 Oct 2015
967antalyaretroguvenlik.comAlantron BiliÅŸim Ltd Åžti.2 Oct 20142 Oct 20142 Oct 2015
968antalyavizeci.comİsimtescil Bilişim A.Ş.17 Jun 20208 May 202517 Jun 2026
969antalyaservisleri.comNics Telekomünikasyon Ticaret Ltd. Şti.17 Feb 202429 Apr 202517 Feb 2025
970antalyademirelinsaat.comNameCheap, Inc.14 Oct 202514 Oct 202514 Oct 2026
971antalyacadirkiralama.orgGoogle, Inc.2 Oct 201422 Sep 20252 Oct 2026
972antalyasuaritma.bizGoDaddy.com, LLC3 Oct 20143 Oct 20142 Oct 2015
973antalyaya.infoGMO Internet Inc.18 Nov 2014-18 Nov 2015
974antalyajug.orgGoDaddy.com, LLC30 Nov 201730 Jan 201830 Nov 2018
975antalyaamerikankulturkolejias.netReg2C.com Inc.9 Sep 20149 Sep 20149 Sep 2015
976antalyaucuzescort.netTucows Domains Inc.9 Sep 201413 Sep 20179 Sep 2017
977antalya-cambalkon.netNameCheap, Inc.12 Mar 202512 Mar 202512 Mar 2026
978antalyadakiralikarac.comTucows Domains Inc.3 Nov 20167 Nov 20173 Nov 2017
979antalyakameralar.comTucows Domains Inc.30 Sep 20134 Oct 201430 Sep 2015
980antalyadaguvenliksistemleri.comTucows Domains Inc.30 Sep 20134 Oct 201430 Sep 2015
981antalyahotels.mobiGoDaddy.com, LLC3 Oct 20143 Oct 20143 Oct 2015
982antalyatabela.netIHS Telekom, Inc.14 Oct 202119 Oct 202414 Oct 2025
983antalyaavm.comGoogle, Inc.15 Oct 202414 May 202515 Oct 2025
984antalyabeachpark.comNamesilo, LLC26 Oct 202330 Aug 202526 Oct 2025
985antalyacopy.com-22 Aug 202322 Sep 202422 Aug 2024
986antalyadanhaberler.comNics Telekomünikasyon Ticaret Ltd. Şti.23 Apr 202131 May 202523 Apr 2026
987antalyafenerbahcelilerdernegi.comFBS Inc.10 Sep 201410 Sep 201410 Sep 2015
988antalyakoltuktamircisi.comFBS Inc.28 Jan 201628 Jan 201628 Jan 2017
989antalyakresfiyatlari.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Sep 201410 Sep 201410 Sep 2015
990antalyakurye.comIHS Telekom, Inc.22 Dec 202421 Feb 202522 Dec 2025
991antalyaotelcilik.comIHS Telekom, Inc.27 Nov 20156 Nov 201627 Nov 2017
992antalyaphotographer.comGoDaddy.com, LLC11 May 202323 Jul 202511 May 2025
993antalyaphotography.comGoDaddy.com, LLC2 Sep 20202 Sep 20202 Sep 2021
994antalyarentacarfirmalari.bizPDR Ltd. d/b/a PublicDomainRegistry.com10 Sep 201410 Sep 20149 Sep 2015
995antalya-prefabrikev.orgPDR Ltd. d/b/a PublicDomainRegistry.com4 Oct 20145 Oct 20144 Oct 2015
996antalyafilmingguide.comFBS Inc.4 Oct 20144 Oct 20144 Oct 2015
997antalyarentacar.us-2 Oct 20162 Oct 20161 Oct 2017
998antalyatemizlikfirmasi.com-4 Aug 20257 Aug 20254 Aug 2026
999antalyakurdu.comReg2C.com Inc.1 Oct 20141 Oct 20161 Oct 2017
1000antalyaterzi.com-19 Sep 202211 Sep 202519 Sep 2026

Displaying 1,000 out of 23,219 domains starting with the keyword "ANTALYA". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=antalya

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now