Our database now contains whois records of 624 Million (624,097,751) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1589 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [624 Million Domains] $10,000 Details

Keyword: ANEXT

Reverse Whois » KEYWORD [anext ]  { 938 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1anext.companyGoDaddy.com, LLC7 Aug 20146 Jan 20177 Aug 2017
2anext.clubGMO Internet Inc.16 Mar 201514 Feb 201715 Mar 2018
3anext.cloudGoDaddy.com, LLC15 Oct 202015 Oct 202015 Oct 2021
4anext.comCSC Corporate Domains, Inc.6 Aug 20032 Aug 20246 Aug 2026
5anext.techGMO Internet Inc.15 Aug 2022-15 Aug 2023
6anext.infoGMO Internet Inc.11 May 201130 Apr 202511 May 2026
7anext.netJapan Registry Services Co., Ltd.13 Sep 200111 Sep 202413 Sep 2025
8anext.de--16 Jun 2012-
9anext.winWest263 International Limited6 Feb 201723 Feb 20175 Feb 2018
10anext.orgGransy s.r.o. d/b/a subreg.cz17 May 201717 Jul 201717 May 2018
11anext.co.uk-3 May 202411 May 20253 May 2025
12anext.guruGoDaddy.com, LLC29 Jun 20184 Jul 201829 Jun 2020
13anext.onlineOVH sas16 Aug 202313 Oct 202416 Aug 2024
14anext.xyzChengdu West Dimension Digital Technology Co., Ltd…9 Nov 202415 Dec 20249 Nov 2025
15anext.creditName.com, Inc.7 Jun 20227 Jun 20237 Jun 2024
16anext.com.br-17 May 201927 Jan 202417 May 2026
17anext.jp-2 Feb 20231 Mar 202431 Mar 2024
18anext.topAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…17 May 202317 May 202317 May 2026
19anext.siteGMO Internet Inc.29 Oct 202311 Dec 202429 Oct 2024
20anext.storeGoDaddy.com, LLC7 Dec 202318 Jan 20257 Dec 2024
21anext.ltdCronon AG25 Jan 202411 Mar 202525 Jan 2026
22anext.shopLimited Liability Company "Registrar of domain nam…26 Jan 202226 Jan 202526 Jan 2025
23anext.ru-14 Feb 2025-14 Feb 2026
24anext.ovhOVH sas12 Jul 202417 Jul 202412 Jul 2025
25anext.bizGMO Internet Inc.1 Sep 20246 Sep 20241 Sep 2025
26anext.spaceCV. Rumahweb Indonesia20 Sep 202414 Oct 202420 Sep 2025
27anext.ai----
28anext.eu----
29anextur.com.tr-8 Apr 1999-7 Apr 2019
30anextour.com.uaInternet NAYANA Inc.2 Dec 20041 Nov 20132 Dec 2018
31anextour.kz----
32anextour.ru-22 Mar 2001-23 Mar 2026
33anextour.comDNC Holdings, Inc.18 Apr 20014 Apr 202418 Apr 2029
34anextraordinarytime.orgDreamHost, LLC17 Oct 200831 Oct 201617 Oct 2017
35anextraordinarytime.netDreamHost, LLC17 Oct 200819 Oct 201617 Oct 2017
36anextool.co.jp-8 Dec 19991 Jan 2025-
37anextraordinarileagueofconsultants.comGoDaddy.com, LLC31 May 20121 Jun 201531 May 2016
38anextraordinaryordinarylife.comGoDaddy.com, LLC15 Oct 201815 Oct 201815 Oct 2019
39anextramile.comGoDaddy.com, LLC4 Aug 202115 Sep 20244 Aug 2024
40anextraordinaryman.comeNom, Inc.10 Apr 200927 Apr 201710 Apr 2018
41anextraordinaryjourney.comGoDaddy.com, LLC1 Jul 202212 Aug 20241 Jul 2024
42anextrapairofhands.comeNom, Inc.18 Jan 200624 Jan 202518 Jan 2026
43anextrainch.comGoDaddy.com, LLC26 Nov 202426 Nov 202426 Nov 2025
44anextremist.comGoDaddy.com, LLC7 Mar 201514 Apr 20157 Mar 2016
45anextraordinaryaffair.comGoDaddy.com, LLC21 Jan 20194 Mar 202521 Jan 2025
46anextrabedvacationrentals.comregister.com, Inc.10 Dec 201015 Nov 202310 Dec 2025
47anextra800amonth.comGoDaddy.com, LLC12 Jun 201413 Jun 201512 Jun 2016
48anextra100amonth.comGoDaddy.com, LLC18 Aug 201418 Aug 201418 Aug 2015
49anextgroup.comDropCatch.com 994 LLC22 Oct 201623 Oct 201722 Oct 2018
50anextraordinarysoul.comGoDaddy.com, LLC10 Nov 201410 Nov 201410 Nov 2015
51anextbd.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Nov 201414 Nov 201414 Nov 2015
52anextraordinarylife.orgGoDaddy.com, LLC14 Nov 201415 Nov 201714 Nov 2020
53anextrazero.comeNom, Inc.16 Nov 201416 Nov 201416 Nov 2018
54anextended.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Nov 201416 Nov 201416 Nov 2015
55anextraordinaryspirit.comNameCheap, Inc.5 Sep 201417 Nov 20245 Sep 2024
56anextrapairofhands.netGoDaddy.com, LLC2 Jan 20252 Jan 20252 Jan 2028
57anextrayou.comGoDaddy.com, LLC10 Sep 201410 Sep 201410 Sep 2015
58anextraman.comeNom, Inc.11 Sep 201411 Sep 201411 Sep 2015
59anextrahand4u.orgTucows Domains Inc.22 Sep 201426 Sep 201522 Sep 2016
60anextrahandservices.comXin Net Technology Corporation2 Aug 20231 Sep 20242 Aug 2024
61anextrahelping.orgGoDaddy.com, LLC20 Nov 201420 Nov 201420 Nov 2015
62anextrapair.comTurnCommerce, Inc. DBA NameBright.com7 Aug 201818 Sep 20247 Aug 2024
63anextrachromosomefulloflove.comWild West Domains, LLC25 Sep 20147 Oct 202425 Sep 2030
64anextrapillow.comKey-Systems GmbH18 Oct 20143 Oct 202418 Oct 2025
65anextensionofme.comGoDaddy.com, LLC26 Nov 201426 Nov 201426 Nov 2015
66anextrastitch.comGoDaddy.com, LLC28 Nov 201428 Nov 201428 Nov 2015
67anextension.comAnnulet LLC4 Jan 201621 Feb 20254 Jan 2026
68anextrahandllc.comGoDaddy.com, LLC4 Feb 20215 Feb 20254 Feb 2026
69anextraordinarynormal.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Dec 20149 Dec 20149 Dec 2015
70anextrahanderrands.comGoDaddy.com, LLC11 Dec 201411 Dec 201411 Dec 2016
71anextgroup.netMat Bao Trading & Service Company Limited d/b/a Ma…23 Dec 201423 Dec 201423 Dec 2015
72anexto.webcam1API GmbH1 Jul 2014-30 Jun 2015
73anextour.agencyInternet Invest, Ltd. dba Imena.ua15 Aug 202420 Aug 202415 Aug 2025
74anextv.websitePDR Ltd. d/b/a PublicDomainRegistry.com13 Mar 201513 Mar 201513 Mar 2016
75anextraordinary.lifeGoDaddy.com, LLC21 Dec 20204 Feb 202521 Dec 2026
76anextraordinarytraveller.comGoDaddy.com, LLC15 Jan 201515 Jan 201515 Jan 2016
77anextraordinarytraveler.comGoDaddy.com, LLC15 Jan 201516 Jan 202515 Jan 2026
78anextraaddedtouch.comGoDaddy.com, LLC21 Jan 201521 Jan 201521 Jan 2016
79anextraordinarywoman31.comWild West Domains, LLC19 Aug 201519 Aug 201519 Aug 2016
80anextbigstep.comregister.com, Inc.29 Jan 201529 Jan 201529 Jan 2016
81anextindia.comGoDaddy.com, LLC19 Aug 201519 Aug 201519 Aug 2017
82anextrapush.comeNom, Inc.2 Feb 20152 Feb 20152 Feb 2016
83anextraordinarycourtyard.comTucows Domains Inc.30 Jan 20123 Feb 201530 Jan 2016
84anextrastep.comGoDaddy.com, LLC1 May 20251 May 20251 May 2026
85anextraordinarydestiny.comFastDomain Inc.2 May 201611 Jun 20172 May 2018
86anextstepsoberliving.comGoDaddy.com, LLC9 Feb 201522 Mar 20259 Feb 2025
87anextour-tour.comRegional Network Information Center, JSC dba RU-CE…10 Feb 201525 Feb 20199 Feb 2022
88anextraspoon.comGoDaddy.com, LLC15 Feb 201516 Feb 202515 Feb 2026
89anextralongvoyage.comHongkong Domain Name Information Management Co., L…6 Nov 20218 Nov 20226 Nov 2022
90anextchapter.comGoDaddy.com, LLC1 Aug 20191 Aug 20191 Aug 2020
91anextconcept.comGoDaddy.com, LLC13 Dec 202112 Dec 202413 Dec 2025
92anextraordinaryaffaire.comTucows Domains Inc.11 Mar 201515 Mar 201811 Mar 2018
93anextravagantevent.comGoDaddy.com, LLC24 Feb 201524 Feb 201524 Feb 2017
94anextraordinaryevent.netGoDaddy.com, LLC26 Feb 201526 Feb 201526 Feb 2016
95anextraminute.orgWild West Domains, LLC24 Aug 201525 Aug 201624 Aug 2017
96anextraminute.comWild West Domains, LLC24 Aug 201525 Aug 202324 Aug 2025
97anextraordinaryworld.comName.com, Inc.1 May 202413 Jun 20251 May 2025
98anextraordinarylady.comNamesilo, LLC12 Mar 20151 Sep 201712 Mar 2018
99anextraordinaryworld.netFabulous.com Pty Ltd.10 Mar 201212 Mar 201510 Mar 2016
100anextio.com1API GmbH26 Jun 20239 Sep 202426 Jun 2024
101anextrovertedintrovert.comLaunchpad, Inc.27 Mar 201512 Mar 201727 Mar 2018
102anextgiantleap.comDomain.com, LLC11 Apr 201511 Apr 201511 Apr 2016
103anextralife.comTucows Domains Inc.22 Apr 201526 Apr 201822 Apr 2018
104anextraguest.comGoDaddy.com, LLC7 Sep 20157 Sep 20157 Sep 2016
105anextrapairofeyes.comGoDaddy.com, LLC25 Apr 201526 Apr 202525 Apr 2026
106anextmove.comLaunchpad, Inc.4 Jan 20227 Jan 20244 Jan 2024
107anexto.comFastDomain Inc.28 Apr 201516 Sep 20241 Oct 2025
108anextour.orgLimited Liability Company "Registrar of domain nam…4 Jun 20164 Jun 20254 Jun 2026
109anextraordinarywoman.netWild West Domains, LLC9 Sep 20159 Sep 20159 Sep 2016
110anextraordinarywoman.orgWild West Domains, LLC9 Sep 201510 Aug 20169 Sep 2017
111anextend.comWix.com Ltd.25 Nov 202425 Nov 202425 Nov 2026
112anextraordinarylife.net-30 Mar 20231 May 202430 Mar 2024
113anextratouchbykay.comTucows Domains Inc.29 Apr 202016 May 202529 Apr 2026
114anextrahandart.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Jun 201530 Aug 202418 Jun 2024
115anextrapairofhands.orgGoDaddy.com, LLC24 Aug 202328 Aug 202424 Aug 2025
116anextraticket.comGoDaddy.com, LLC6 Sep 20197 Sep 20246 Sep 2025
117anextra200helps.com----
118anextrodinaryday.netGoDaddy.com, LLC23 Sep 201523 Sep 201523 Sep 2016
119anextour24.comRegional Network Information Center, JSC dba RU-CE…15 Jan 2018-14 Jan 2019
120anextrapairofhands.infoGoDaddy.com, LLC13 Jul 2015-13 Jul 2016
121anextraordinaryyear.com101domain, Inc.17 Jul 201517 Jul 201717 Jul 2018
122anextrabodymovers.comregister.com, Inc.21 Jul 20158 Jul 202421 Jul 2026
123anextours.comDROPCATCH.COM 774 LLC16 Dec 201615 Nov 202216 Dec 2025
124anextnetwork.comGoDaddy.com, LLC29 Jul 201529 Jul 201529 Jul 2017
125anextensionofhome.com1&1 Internet AG3 Oct 20154 Oct 20163 Oct 2017
126anextrasetofhands.orgGoDaddy.com, LLC4 Feb 202315 May 20254 Feb 2027
127anextra.infoNetwork Solutions, LLC16 Oct 201516 Oct 201516 Oct 2016
128anexturelektrozavodskaya.comDomain.com, LLC3 Nov 20153 Nov 20153 Nov 2016
129anextour20years.comDNC Holdings, Inc.11 Nov 20159 Nov 202011 Nov 2025
130anextotomotiv.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Nov 201512 Nov 201512 Nov 2016
131anexturelektrozav.comFastDomain Inc.17 Nov 201517 Nov 201517 Nov 2016
132anextravel.comMedia Elite Holdings Limited12 Apr 20215 Sep 202412 Apr 2026
133anexty.com-25 Feb 20232 Mar 202425 Feb 2026
134anextgenblog.comNameCheap, Inc.3 Dec 20151 Dec 20243 Dec 2025
135anextbeststep.comGoDaddy.com, LLC5 Dec 20155 Dec 20155 Dec 2016
136anextrahandhere.comGoDaddy.com, LLC6 Dec 20156 Dec 20156 Dec 2017
137anextraordinaryjourneybook.comeNom, Inc.9 Dec 20159 Dec 20159 Dec 2016
138anextour.infoAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…1 Mar 20248 Apr 20251 Mar 2025
139anextrahandvirtualservices.orgGoDaddy.com, LLC15 Dec 201515 Dec 201515 Dec 2016
140anextrahandvirtualservices.infoGoDaddy.com, LLC15 Dec 2015-15 Dec 2016
141anextrahandvirtualservices.netGoDaddy.com, LLC15 Dec 201515 Dec 201515 Dec 2016
142anextrahandvirtualservices.comGoDaddy.com, LLC15 Dec 201516 Dec 202315 Dec 2025
143anextry.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Dec 201522 Dec 201522 Dec 2016
144anextlife.comHiChina Zhicheng Technology Limited25 Dec 201525 Dec 201525 Dec 2016
145anexteraordinaryaffaire.comGoDaddy.com, LLC7 Jan 20167 Jan 20167 Jan 2017
146anextracupoflove.comWild West Domains, LLC13 Jan 201613 Jan 201613 Jan 2017
147anext2new.comGoDaddy.com, LLC18 Jan 201618 Jan 201618 Jan 2017
148anextgenshaman.comDomain.com, LLC22 Jan 20167 Jan 201722 Jan 2018
149anextrahand.netGoDaddy.com, LLC30 Jan 201631 Jan 202530 Jan 2026
150anextensionofyourmind.comeNom, Inc.17 Feb 201631 Jul 201717 Feb 2018
151anextensionofyourmind.neteNom, Inc.17 Feb 201631 Jul 201717 Feb 2018
152anextlevel.comHostinger, UAB9 Aug 20249 Oct 20249 Aug 2025
153anextraincomeformums.comAscio Technologies, Inc. Danmark - Filial af Ascio…22 Feb 201622 Feb 201622 Feb 2017
154anextra.proNetwork Solutions, LLC19 Mar 201118 Jan 201719 Mar 2020
155anextbigcity.netGoDaddy.com, LLC10 Mar 201610 Mar 201610 Mar 2017
156anextbigcity.comGoDaddy.com, LLC10 Mar 201610 Mar 201610 Mar 2017
157anextraordinaryday.netNameCheap, Inc.28 Nov 201130 Oct 202428 Nov 2025
158anextour.onlineLimited Liability Company "Registrar of domain nam…8 Jun 20258 Jun 20258 Jun 2026
159anextraminuteortwo.comWild West Domains, LLC9 Apr 20169 Apr 20169 Apr 2017
160anextethic.comGoDaddy.com, LLC13 Apr 201613 Apr 201613 Apr 2017
161anextrasetofeyes.com-4 Jul 202312 Aug 20244 Jul 2024
162anextraordinarybear.comSynergy Wholesale Pty Ltd14 Apr 201614 Apr 201614 Apr 2017
163anextlevelphenom.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Apr 201616 Apr 201715 Apr 2018
164anextworld.comGoogle, Inc.24 Apr 201625 Feb 201724 Apr 2018
165anextplanet.comGoogle, Inc.24 Apr 201625 Feb 201724 Apr 2018
166anextrapairofhands-services.comWild West Domains, LLC26 Apr 201626 Apr 201626 Apr 2017
167anextravagant.infoNetwork Solutions, LLC26 Apr 201626 Apr 201626 Apr 2017
168anextraordinarymachine.com----
169anextlevelshift.comGoDaddy.com, LLC27 Apr 201627 Apr 201627 Apr 2017
170anextremedreamers.comSiliconHouse.Net Pvt. Ltd.30 May 201429 Jun 201730 May 2018
171anextingertname.net-5 May 20165 May 20165 May 2017
172anextrapairofhandsforyou.comeNom, Inc.5 May 20165 May 20165 May 2017
173anextmap.com-11 May 201611 May 201611 May 2017
174anextrarep.comGoDaddy.com, LLC15 May 201616 May 202515 May 2026
175anextbig.com-25 May 201625 May 201625 May 2017
176anextensionofyou.comGoDaddy.com, LLC11 Jun 201612 Jun 202511 Jun 2026
177anextape.comAscio Technologies, Inc. Danmark - Filial af Ascio…13 Jun 201614 Jun 201713 Jun 2018
178anextstar.comGoogle, Inc.8 Apr 202320 Jun 20258 Apr 2025
179anextrapair.co.ukYour Domain LLC14 Feb 201621 Jan 202314 Feb 2026
180anextfuture.comGMO Internet Inc.28 Jun 201629 May 202428 Jun 2025
181anextraboost.comeNom, Inc.18 Apr 202018 Apr 202018 Apr 2021
182anextrapairofhandsuk.biz1&1 Internet AG18 Oct 201225 Jul 201717 Oct 2017
183anextrovert.com-20 Jul 201620 Jul 201620 Jul 2017
184anextraplate.comTucows Domains Inc.20 Jul 201624 Jul 201720 Jul 2017
185anextragirlyaffair.comTucows Domains Inc.12 Sep 201328 Aug 202412 Sep 2025
186anextourthailand.comDNC Holdings, Inc.7 Oct 20131 Oct 20247 Oct 2027
187anextramind.comGoDaddy.com, LLC12 Nov 20112 May 201312 Nov 2018
188anextek.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Nov 200029 Nov 202429 Nov 2025
189anextrasetofhandsla.comPSI-USA, Inc. dba Domain Robot30 Aug 202330 Oct 202430 Aug 2024
190anextraordinaries.comGoDaddy.com, LLC18 Feb 200615 Apr 201518 Feb 2017
191anextrapaycheck.comGoDaddy.com, LLC26 Feb 20208 May 202426 Feb 2024
192anextraincome.comOmnis Network, LLC8 Dec 20237 Dec 20248 Dec 2025
193anextourismworldwide.comDNC Holdings, Inc.23 May 201414 May 202423 May 2027
194anextur.comDNC Holdings, Inc.6 Aug 200110 Oct 20236 Aug 2025
195anextrahelping.com-22 Feb 202423 Feb 202522 Feb 2026
196anextraterrestrialtouristsguidetoearth.comGoDaddy.com, LLC21 Jul 20174 Oct 202221 Jul 2026
197anextrastaff.comGoDaddy.com, LLC11 Apr 201415 Apr 201611 Apr 2017
198anextrahoureveryday.comGoDaddy.com, LLC4 Jan 20095 Jan 20254 Jan 2026
199anextrakiss.comNetwork Solutions, LLC14 Jul 20045 Mar 201714 Jul 2018
200anextia.comTierraNet Inc. d/b/a DomainDiscover18 Oct 20024 Nov 202418 Oct 2027
201anextone.comKorea Server Hosting Inc.19 Jul 20138 May 202419 Jul 2025
202anextraroomstorage.comGoDaddy.com, LLC7 Aug 20128 Aug 20147 Aug 2016
203anextband.comChengdu West Dimension Digital Technology Co., Ltd…13 Apr 201913 Apr 201913 Apr 2020
204anextrateaspoonoflove.comBizcn.com, Inc.25 Jul 202026 Jul 202025 Jul 2021
205anextraegg.comSynergy Wholesale Pty Ltd15 Nov 20121 Sep 202315 Nov 2030
206anextraordinarywoman.comregister.com, Inc.6 Mar 20066 Mar 20066 Mar 2018
207anextmillennium.comGoDaddy.com, LLC6 Aug 20147 Aug 20156 Aug 2016
208anextgeneration.com-2 Aug 20223 Aug 20232 Aug 2024
209anextras.comCSC Corporate Domains, Inc.11 Aug 20107 Aug 202411 Aug 2025
210anextogrinddvd.comCSC Corporate Domains, Inc.26 Aug 200927 Jul 202426 Aug 2025
211anextraordinarylifenow.comNameCheap, Inc.29 Mar 201829 Mar 201829 Mar 2019
212anextremelylongdomainnamejustfortesting.comDNC Holdings, Inc.10 May 20061 May 201710 May 2018
213anextrabrain.comTucows Domains Inc.29 Apr 201628 Apr 202529 Apr 2026
214anextrovertaffair.comGoDaddy.com, LLC28 Jul 201428 Jul 201528 Jul 2016
215anextra.comName.com, Inc.10 Feb 200420 Mar 202510 Feb 2026
216anextraordinaryday.comCloudFlare, Inc.3 May 202512 May 20253 May 2026
217anexter.comName.com, Inc.8 Apr 202221 Jun 20258 Apr 2025
218anextools.comHiChina Zhicheng Technology Limited4 Jul 201024 Jul 20244 Jul 2025
219anextstepnow.comeNom, Inc.6 Dec 20134 Nov 20146 Dec 2016
220anextrayear.comGoDaddy.com, LLC25 Jul 200830 Jun 201425 Jul 2016
221anextrahour.comGoDaddy.com, LLC4 May 20105 May 20254 May 2026
222anextralargepenis.comDreamHost, LLC31 Oct 200223 Aug 202431 Aug 2025
223anextraordinaryexperience.comeNom, Inc.7 Mar 20128 Mar 20257 Mar 2026
224anextraordinarytown.comGoDaddy.com, LLC29 Jan 200514 Apr 201529 Jan 2017
225anextraordinaryevent.comTucows Domains Inc.23 Sep 200927 Sep 201823 Sep 2018
226anextrade.comTurnCommerce, Inc. DBA NameBright.com23 Jun 201412 Feb 202523 Jun 2025
227anexta.comNameCheap, Inc.29 May 200422 May 202429 May 2028
228anextratouch.comFastDomain Inc.13 May 200928 Apr 202513 May 2026
229anextis.com1&1 Internet AG14 Mar 200515 Mar 201714 Mar 2018
230anextendedfamily.comGoDaddy.com, LLC13 Sep 202025 Oct 202413 Sep 2024
231anextrahandrepair.comTucows Domains Inc.7 May 200811 May 20217 May 2021
232anextraining.comNameCheap, Inc.4 Aug 2019-4 Aug 2020
233anextraordinaryaspielife.comAscio Technologies, Inc. Danmark - Filial af Ascio…17 Jul 201417 Jul 201617 Jul 2016
234anextrovertedaffair.comGoDaddy.com, LLC28 Jul 201428 Jul 201528 Jul 2016
235anexterior.comregister.com, Inc.3 Dec 20013 Nov 20243 Dec 2025
236anextravoice.comTucows Domains Inc.19 Dec 200829 Nov 202419 Dec 2025
237anextraday.comDomain.com, LLC22 May 202324 Apr 202522 May 2026
238anextrapenny.comTucows Domains Inc.25 Aug 201319 Mar 202525 Aug 2025
239anexteriorinc.comeNom, Inc.22 May 200728 Apr 202522 May 2027
240anextraordinarymind.comNetwork Solutions, LLC14 Mar 201213 Jan 202214 Mar 2027
241anextz.comHiChina Zhicheng Technology Limited20 Jul 201320 Jun 202320 Jul 2025
242anextourismgroup.comDNC Holdings, Inc.1 Nov 201028 Oct 20241 Nov 2025
243anextech.comTurnCommerce, Inc. DBA NameBright.com20 Sep 201313 Nov 202420 Sep 2025
244anextraordinarylifestudy.comDomain.com, LLC15 Nov 201226 Oct 202415 Nov 2025
245anextool.comHiChina Zhicheng Technology Limited20 Oct 201014 Nov 202420 Oct 2025
246anextravagant.comTurnCommerce, Inc. DBA NameBright.com24 Nov 201718 Nov 202024 Nov 2025
247anextraroomselfstorage.comGoDaddy.com, LLC7 Aug 20128 Aug 20147 Aug 2016
248anextradba.comeNom, Inc.11 Aug 200416 Jul 201611 Aug 2016
249anextraordinaryplace.comGoDaddy.com, LLC22 Jul 201423 Jul 202422 Jul 2025
250anextraordinarytime.comFastDomain Inc.13 Jun 200629 May 202513 Jun 2026
251anextraordinarylife.comTurnCommerce, Inc. DBA NameBright.com24 May 200515 Jan 202024 May 2025
252anextraleveladaykeepsthegirlaway.comGandi SAS4 Nov 201312 Nov 20184 Nov 2019
253anextremelyinconvenienttruth.comGoDaddy.com, LLC8 May 20117 May 20258 May 2026
254anextstep.comAnnulet LLC1 Oct 200526 Aug 20241 Oct 2025
255anextraboostof.comGoDaddy.com, LLC16 Aug 201117 Aug 202416 Aug 2025
256anextrahand.comregister.com, Inc.23 Mar 200422 Feb 202423 Mar 2027
257anextravagantlove.comFastDomain Inc.9 Sep 20139 Sep 20179 Sep 2018
258anextogrind.comCSC Corporate Domains, Inc.26 Aug 200927 Jul 202426 Aug 2025
259anextrapairofhands4you.comName.com, Inc.15 Jan 202329 Mar 202415 Jan 2024
260anextweb.comDynadot, LLC1 Dec 20125 Feb 20251 Dec 2025
261anextrasetofhands.comGoDaddy.com, LLC31 Jan 20211 Feb 202531 Jan 2026
262anextrashot.comGoDaddy.com, LLC1 Aug 20231 Aug 20241 Aug 2025
263anextremeclean.comGoDaddy.com, LLC6 Aug 201313 Aug 20236 Aug 2025
264anextremedreamlimo.comTucows Domains Inc.1 Nov 20053 Oct 20241 Nov 2025
265anextraroom.comGoDaddy.com, LLC3 Oct 20114 Oct 20243 Oct 2026
266anextra200amonth.comWild West Domains, LLC8 May 201019 Nov 201518 Nov 2016
267anextraordinarymile.comWild West Domains, LLC12 Jun 20139 Jun 201612 Jun 2017
268anextra500amonth.comWild West Domains, LLC8 May 201019 Nov 201518 Nov 2016
269anextragrand.com-28 Jul 201628 Jul 201628 Jul 2018
270anextgenerationlv.comFastDomain Inc.5 Aug 20169 Aug 20245 Aug 2025
271anextracloset.comGoDaddy.com, LLC13 Jan 202513 Jan 202513 Jan 2030
272anexttt.com-7 Aug 20167 Aug 20167 Aug 2017
273anextrapennysignatureinc.comeNom, Inc.26 Aug 20168 Oct 201726 Aug 2017
274anextlevelproduction.comGoDaddy.com, LLC19 Dec 202019 Dec 202019 Dec 2022
275anextlevelproduction.net-26 Aug 201626 Aug 201626 Aug 2017
276anextlevelproduction.orgGoDaddy.com, LLC26 Aug 20167 Oct 201726 Aug 2018
277anextlevelproduction.infoGoDaddy.com, LLC26 Aug 20167 Oct 201726 Aug 2018
278anextraeye.comGoDaddy.com, LLC25 Feb 201925 Feb 201925 Feb 2020
279anextrashift.comTucows Domains Inc.1 Oct 20241 Oct 20241 Oct 2025
280anextra3k.com-20 Sep 201620 Sep 201620 Sep 2017
281anexthotel.comNameCheap, Inc.6 Oct 20166 Sep 20246 Oct 2025
282anextrahand.infoGoDaddy.com, LLC4 May 201215 Jun 20244 May 2024
283anextraordinarylifestudy.infoDomain.com, LLC15 Nov 201231 Oct 202415 Nov 2025
284anextradomain.info1&1 Internet AG16 Jan 201416 Jan 201616 Jan 2017
285anexta.netRealtime Register B.V.1 Sep 202212 Nov 20231 Sep 2023
286anextremeclean.netGoDaddy.com, LLC19 Apr 201020 Apr 202519 Apr 2026
287anextras.netCSC Corporate Domains, Inc.11 Aug 20107 Aug 202411 Aug 2025
288anextra.netCSC Corporate Domains, Inc.11 Aug 20107 Aug 202411 Aug 2025
289anexter.netDNSPod, Inc.16 Mar 202319 Jan 202516 Mar 2026
290anextraordinarylifestudy.netDomain.com, LLC15 Nov 201226 Oct 202415 Nov 2025
291anextel.netGoDaddy.com, LLC18 Feb 201119 Feb 201618 Feb 2018
292anextraordinarytown.netGoDaddy.com, LLC24 Jan 200919 Apr 201524 Jan 2017
293anextradomain.net1&1 Internet AG16 Jan 201417 Jan 201616 Jan 2017
294anextraordinarday.net-13 Oct 201613 Oct 201613 Oct 2017
295anextruckco.comeNom, Inc.15 Oct 201626 Nov 201715 Oct 2017
296anextour.netNamesilo, LLC15 Mar 20222 Feb 202515 Mar 2026
297anextstep.orgeNom, Inc.2 Jan 200112 Jan 20252 Jan 2026
298anextendedfamily.orgPSI-USA, Inc. dba Domain Robot8 Nov 20128 Nov 20248 Nov 2025
299anextradomain.org1&1 Internet AG16 Jan 201417 Jan 201616 Jan 2017
300anextrahand.orgGoogle, Inc.14 Feb 202315 Mar 202414 Feb 2024
301anextur.orgRegional Network Information Center, JSC dba RU-CE…24 Feb 201010 Apr 202524 Feb 2026
302anextramile.orgGoDaddy.com, LLC6 Jun 20137 Aug 20136 Jun 2018
303anextraordinarylifestudy.orgDomain.com, LLC15 Nov 201231 Oct 202415 Nov 2025
304anextraordinarytown.orgGoDaddy.com, LLC24 Jan 20091 Nov 201724 Jan 2018
305anextre.xyzUniregistrar Corp2 Jun 201623 Sep 20162 Jun 2017
306anextrapairofhands.co.nz-19 Jun 20034 Aug 2024-
307anextraspecialdesign.comregister.com, Inc.29 Oct 201628 Oct 202429 Oct 2025
308anextel.comCosmotown, Inc.6 Jun 20237 Jun 20246 Jun 2025
309anextele.comGoDaddy.com, LLC27 Aug 202227 Aug 202227 Aug 2023
310anextelecom.com-4 Nov 20164 Nov 20164 Nov 2017
311anextramillion.com-6 Nov 20166 Nov 20166 Nov 2017
312anextourchina.comDNC Holdings, Inc.16 Nov 201629 Nov 202116 Nov 2026
313anextrame.comGoDaddy.com, LLC17 Nov 201617 Nov 201617 Nov 2017
314anextempore.comTucows Domains Inc.20 Nov 201624 Nov 202220 Nov 2023
315anextremelovestory.comGoDaddy.com, LLC2 Dec 20162 Dec 20162 Dec 2018
316anextour.reisenunited-domains AG2 Dec 201618 Mar 20202 Dec 2020
317anextrawritehand.comGoDaddy.com, LLC12 Dec 201612 Dec 201612 Dec 2018
318anextraslice.comBeijing Lanhai Jiye Technology Co., Ltd31 May 20251 Jun 202531 May 2026
319anextrasetofhandsvancouver.comGoDaddy.com, LLC5 Jan 201720 Jan 20245 Jan 2026
320anextraordinarygift.comeNom, Inc.5 Jan 201716 Feb 20185 Jan 2018
321anextraseat.comNetEarth One Inc. d/b/a NetEarth19 Jan 201712 Jan 201819 Jan 2019
322anextournsk.comRegional Network Information Center, JSC dba RU-CE…5 Feb 201725 Feb 20174 Feb 2018
323anextraordinarymom.comFastDomain Inc.10 Feb 201710 Feb 201710 Feb 2018
324anextra.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 Feb 201723 May 201725 Feb 2018
325anextreme.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 Feb 201725 Feb 201725 Feb 2018
326anexternal.xyzDNC Holdings, Inc.27 Mar 202127 Mar 202127 Mar 2022
327anextensive.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 Feb 201725 Feb 201725 Feb 2018
328anextended.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 Feb 201723 May 201725 Feb 2018
329anextourufa.comLimited Liability Company "Registrar of domain nam…1 Dec 20191 Dec 20191 Dec 2020
330anextours.netNamesilo, LLC13 Mar 201719 Jan 201813 Mar 2018
331anextour1.comGransy s.r.o. d/b/a subreg.cz15 Mar 201729 Mar 201715 Mar 2018
332anextrahelp.comNeubox Internet S.A. de C.V.15 Mar 201715 May 201715 Mar 2018
333anextour.marketeNom, Inc.23 Mar 20179 Oct 201723 Mar 2018
334anextremelycrediblesource.comGoDaddy.com, LLC24 Mar 201724 Mar 201724 Mar 2018
335anexthomeacreageinidaho.comGoDaddy.com, LLC26 Mar 201726 Mar 201726 Mar 2018
336anextraordinarystorm.comGoDaddy.com, LLC26 Mar 201726 Mar 201726 Mar 2018
337anextwear.comGoDaddy.com, LLC31 Mar 201731 Mar 201731 Mar 2018
338anextour.de--13 Jan 2023-
339anextravagant.partyNameCheap, Inc.21 Apr 201726 Apr 201721 Apr 2018
340anextu.comEranet International Limited2 Oct 20202 Oct 20202 Oct 2021
341anextraordinarylove.comRealtime Register B.V.30 Apr 201730 Apr 202530 Apr 2026
342anextensionofyoufl.comGoDaddy.com, LLC8 May 20178 May 20178 May 2018
343anextravagant.netNetwork Solutions, LLC12 May 201712 May 201712 May 2018
344anextrafive.comGoogle, Inc.15 May 201715 May 201715 May 2018
345anextrablessing.comGoogle, Inc.20 May 201720 May 201720 May 2018
346anextensionofyoufl.orgTucows Domains Inc.8 Jun 20177 Sep 20178 Jun 2018
347anextravaganttruth.comGoDaddy.com, LLC12 Jun 201712 Jun 201712 Jun 2019
348anexturkiye.comNetwork Solutions, LLC17 Feb 201714 May 202417 Feb 2026
349anextrapairofhandshomeservices.comGoDaddy.com, LLC15 Jun 201715 Jun 201715 Jun 2018
350anextraplaceatthetable.infoGoDaddy.com, LLC21 Jul 20174 Sep 202421 Jul 2025
351anextraplaceatthetable.orgGoDaddy.com, LLC21 Jul 20174 Sep 202421 Jul 2025
352anextrasweetguy.comFastDomain Inc.12 Aug 201712 Aug 201712 Aug 2018
353anextraordinarylifepro.comTucows Domains Inc.26 Aug 201730 Aug 201826 Aug 2018
354anextensionofyourfamily.comTucows Domains Inc.1 Sep 20175 Sep 20211 Sep 2021
355anextraordinarymother.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Sep 201722 Oct 20205 Sep 2021
356anextraordinarygirl.comTucows Domains Inc.23 Sep 201727 Sep 202223 Sep 2022
357anextremeimage.comXin Net Technology Corporation11 May 202116 Oct 202111 May 2022
358anextra.lifeGoDaddy.com, LLC22 Oct 201722 Oct 201722 Oct 2018
359anextratouchboutique.comeNom, Inc.23 Oct 201722 Oct 201723 Oct 2018
360anextraordinaryjourneythywillnotmine.comeNom, Inc.14 Nov 201714 Nov 201714 Nov 2018
361anextraordinarywayofliving.comLaunchpad, Inc.30 Nov 201730 Nov 201730 Nov 2018
362anextremechef.comNetwork Solutions, LLC30 Dec 201730 Dec 201730 Dec 2018
363anextraincome.co.uk-6 Jun 20123 Jun 20176 Jun 2018
364anextour.co.uk-13 Oct 20111 Oct 202413 Oct 2027
365anextraordinarylife.co.uk-30 Jan 201730 Jan 202430 Jan 2025
366anextra.co.uk-26 Jun 201121 Jun 202426 Jun 2025
367anextension.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…20 Apr 201621 Apr 201620 Apr 2019
368anextradomain.co.ukReserved16 Jan 201428 Jan 201616 Jan 2018
369anextrahand.co.uk-2 May 20083 May 20252 May 2026
370anextraslice.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…15 Aug 20155 Mar 201715 Aug 2018
371anextrovertedoyster.comTucows Domains Inc.7 Jan 201811 Jan 20217 Jan 2021
372anextramile.co.ukWebagentur.at Internet Services GmbH d/b/a domainn…19 Sep 201212 Sep 201619 Sep 2018
373anextraordinaryspirit.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…5 Sep 201429 Aug 20175 Sep 2019
374anextrapairofhandsuk.co.ukReserved18 Oct 201220 Dec 201718 Oct 2018
375anextour.storeNameKing.com Inc.27 Mar 202311 May 202427 Mar 2024
376anextrapairofhands.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…17 May 201617 May 201617 May 2018
377anextlevelphoto.comDomain.com, LLC29 Jan 201829 Jan 201829 Jan 2020
378anextourserov.comGoogle, Inc.10 Feb 201810 Feb 201810 Feb 2019
379anextgen.comSquarespace Domains LLC15 Jun 202131 May 202515 Jun 2026
380anextourism.comGMO Internet Inc.20 Jun 202520 Jun 202520 Jun 2026
381anextraday.dk-15 Aug 2017-31 Aug 2018
382anextremepointofview.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Mar 201824 Mar 201824 Mar 2019
383anextrades.infoGoDaddy.com, LLC31 Mar 201830 May 201831 Mar 2021
384anextrade.infoGoDaddy.com, LLC31 Mar 201831 Mar 201831 Mar 2021
385anextraordinarypath.comAutomattic Inc.3 Apr 20183 Apr 20183 Apr 2019
386anextraordinaryquintet.comHosting Concepts B.V. dba Openprovider9 Apr 20189 Apr 20189 Apr 2019
387anextraordinarylife879807500.comAutomattic Inc.21 Apr 201821 Apr 201821 Apr 2019
388anextour.toursGoDaddy.com, LLC28 Mar 201824 Mar 201828 Mar 2019
389anextrabuck.comNameCheap, Inc.10 May 201821 Jun 202510 May 2025
390anextraordinarygod.comNetwork Solutions, LLC15 May 201815 May 201815 May 2021
391anextour-rostov.comRegtime Ltd.23 May 201823 May 202523 May 2026
392anextour-irkutsk.comBeget LLC30 May 20185 Aug 202430 May 2024
393anextrahandconciergeservices.comName.com, Inc.4 Jun 20184 Jun 20184 Jun 2020
394anextratablespoonoflove.comNameCheap, Inc.8 Jun 20188 Jun 20188 Jun 2019
395anextrahand-services.comregister.com, Inc.24 Mar 202225 Mar 202324 Mar 2024
396anextrahandconcierge.comTurnCommerce, Inc. DBA NameBright.com13 Jun 201812 Feb 202513 Jun 2025
397anextrahandconcierge.netPDR Ltd. d/b/a PublicDomainRegistry.com4 Sep 20204 Sep 20204 Sep 2021
398anextra25perhour.comGoDaddy.com, LLC13 Jun 201813 Jun 201813 Jun 2019
399anextra25perhour.infoGoDaddy.com, LLC13 Jun 201813 Jun 201813 Jun 2019
400anextechnologies.com1&1 Internet AG18 Jun 20185 Oct 201818 Jun 2026
401anextour.siteLimited Liability Company "Registrar of domain nam…27 Apr 20245 Jun 202527 Apr 2025
402anextrahandhomecare.comregister.com, Inc.27 Jun 201827 Jun 201827 Jun 2019
403anextraordinarylifeworkshops.comWild West Domains, LLC28 Jun 201828 Jun 201828 Jun 2019
404anextraordinarylifeworkshop.comWild West Domains, LLC28 Jun 201828 Jun 201828 Jun 2019
405anextour.proRegional Network Information Center, JSC dba RU-CE…31 Oct 20193 Nov 202431 Oct 2025
406anextendingtribe.comWebfusion Ltd.5 Jul 20185 Jul 20185 Jul 2020
407anextgenwellness.comWild West Domains, LLC14 Jul 201814 Jul 201814 Jul 2019
408anextendedsabbatical.comFastDomain Inc.20 Jul 201820 Jul 201820 Jul 2019
409anextv.comDNC Holdings, Inc.14 Aug 202021 Jul 202314 Aug 2026
410anextlevelyou.comTucows Domains Inc.10 Aug 201820 Sep 202410 Aug 2024
411anextour-b2c.onlineLimited Liability Company "Registrar of domain nam…2 Sep 2018-2 Sep 2019
412anextrahand.storeName.com, Inc.6 Sep 20186 Sep 20186 Sep 2019
413anextrahand.helpName.com, Inc.6 Sep 20186 Sep 20186 Sep 2019
414anextrahand.lifeName.com, Inc.6 Sep 20186 Sep 20186 Sep 2019
415anextrahand.servicesName.com, Inc.6 Sep 20186 Sep 20186 Sep 2019
416anextrajeff.comAmazon Registrar, Inc.12 Sep 201812 Sep 201812 Sep 2019
417anextrasetofhands18.comWild West Domains, LLC16 Sep 201816 Sep 201816 Sep 2019
418anextour.lifeRegtime Ltd.22 Sep 201822 Sep 201822 Sep 2019
419anextrabyte.comGoDaddy.com, LLC8 Oct 20188 Oct 20188 Oct 2019
420anextraordinaryordinary.comFastDomain Inc.31 Oct 201831 Oct 201831 Oct 2019
421anextrasensorylife.comGoDaddy.com, LLC8 Dec 20188 Dec 20188 Dec 2020
422anextour-ua.comAtak Domain Hosting Internet d/b/a Atak Teknoloji10 Dec 20188 Dec 202210 Dec 2023
423anextour-gorodok.comHosting Ukraine LLC11 Dec 201811 Dec 201811 Dec 2019
424anextrahandservice.comWild West Domains, LLC7 Jan 20197 Jan 20197 Jan 2020
425anextourkem.comNetwork Solutions, LLC9 Jan 20199 Jan 20199 Jan 2020
426anextintores.comGoDaddy.com, LLC10 Jan 201910 Jan 201910 Jan 2020
427anextechbd.comBigRock Solutions Ltd.13 Jan 201913 Jan 201913 Jan 2020
428anextroadinaryaffair.comGoDaddy.com, LLC18 Jan 201918 Jan 201918 Jan 2020
429anextraordinarilyordinarylife.comGoDaddy.com, LLC29 Jan 201929 Jan 201929 Jan 2020
430anextrahandconstruction.comGoDaddy.com, LLC2 Feb 20192 Feb 20192 Feb 2020
431anextramom.comNameCheap, Inc.11 Feb 201911 Feb 201911 Feb 2020
432anextensionofyourself.comDynadot, LLC18 Feb 201918 Feb 201918 Feb 2020
433anextdeal.comGoDaddy.com, LLC27 Feb 201927 Feb 201927 Feb 2020
434anextdayresume.comGoDaddy.com, LLC10 Mar 201910 Mar 201910 Mar 2020
435anextrahandhomecarellc.comFastDomain Inc.18 Mar 201925 Jan 202518 Mar 2026
436anextremeoriginal.netGoDaddy.com, LLC23 Mar 20193 Apr 202423 Mar 2025
437anextremeoriginal.comGoDaddy.com, LLC23 Mar 20192 May 202523 Mar 2026
438anextraunit.comGoDaddy.com, LLC3 Apr 201915 Jun 20243 Apr 2024
439anextraordinaryadventure.comAutomattic Inc.4 Apr 20194 Apr 20194 Apr 2020
440anextr.comBeget LLC8 Apr 20192 Apr 20248 Apr 2027
441anextremeinvention.comNameCheap, Inc.20 Apr 201920 Apr 201920 Apr 2020
442anextrain.comNamesilo, LLC22 Apr 201923 Apr 201922 Apr 2020
443anextremelyabbreviatedwebtitle.comLiquidNet Ltd.25 Apr 201925 Apr 201925 Apr 2020
444anextraordinarywebsite.comDomainsAtCost Corporation27 Apr 201927 Apr 201927 Apr 2020
445anextravagantjourney.comGoDaddy.com, LLC25 May 201925 May 201925 May 2020
446anextour.companyPDR Ltd. d/b/a PublicDomainRegistry.com27 May 20193 Apr 202527 May 2026
447anextinvestment.comNameCheap, Inc.3 Jun 20193 Jun 20193 Jun 2020
448anextinctreality.comGoDaddy.com, LLC6 Jun 20196 Jun 20196 Jun 2020
449anextensionofart.comWix.com Ltd.7 Jun 201911 Jun 20227 Jun 2022
450anextop.comGabia, Inc.24 Jun 201925 Jun 201924 Jun 2020
451anextradrop.comDomainPeople, Inc.4 Jul 20194 Jul 20194 Jul 2020
452anextradroplet.comDomainPeople, Inc.4 Jul 20194 Jul 20194 Jul 2020
453anextraleaf.comTucows Domains Inc.18 Feb 20187 Feb 202518 Feb 2026
454anextour.clubHosting Ukraine LLC20 May 2021-20 May 2022
455anextour56.comRegional Network Information Center, JSC dba RU-CE…25 Jul 2019-24 Jul 2020
456anextraordinaryperson.comNameCheap, Inc.26 Jul 20192 Apr 202526 Jul 2026
457anexthesiallc.comXin Net Technology Corporation1 Apr 20235 Apr 20241 Apr 2025
458anextraordinaryjourney.netWix.com Ltd.15 Aug 201925 Oct 202315 Aug 2023
459anextendedhand.comWix.com Ltd.24 Aug 202225 Jul 202424 Aug 2025
460anextoure.comHosting Ukraine LLC23 Aug 201923 Aug 201923 Aug 2020
461anextrapairofhandsllc.comGoDaddy.com, LLC25 Aug 201926 Aug 202425 Aug 2026
462anextraordinarywedding.comNameCheap, Inc.28 Aug 2019-28 Aug 2020
463anextendedlife.comGoDaddy.com, LLC4 Sep 20194 Sep 20194 Sep 2020
464anexterlor.comGoogle, Inc.10 Sep 201911 Sep 201910 Sep 2020
465anextraset.comGoDaddy.com, LLC12 Sep 201913 Sep 202412 Sep 2029
466anextep.comGoDaddy.com, LLC17 Sep 201917 Sep 201917 Sep 2021
467anextinguishingfire.comGoogle, Inc.6 Oct 20196 Oct 20196 Oct 2020
468anextdarkelectronic.comHiChina Zhicheng Technology Limited24 Oct 201924 Oct 201924 Oct 2020
469anextourlevoberezhnaya.comHosting Concepts B.V. dba Openprovider28 Jan 20237 Jan 202528 Jan 2026
470anextourist.comLimited Liability Company "Registrar of domain nam…11 Nov 201927 Oct 202411 Nov 2025
471anextraham.netNamesilo, LLC16 Nov 201917 Nov 202416 Nov 2025
472anextour.bizInternet Invest, Ltd. dba Imena.ua13 Nov 201913 Nov 201913 Nov 2020
473anexterminator.comNameCheap, Inc.16 Nov 2019-16 Nov 2020
474anextraham.comNamesilo, LLC16 Nov 201917 Nov 202416 Nov 2025
475anextere.comDomain.com, LLC17 Nov 201928 Oct 202417 Nov 2025
476anextzen.comGoDaddy.com, LLC20 Nov 201920 Nov 201920 Nov 2020
477anextour-krasnodar.comHosting Ukraine LLC21 Nov 2019-21 Nov 2020
478anextraordinary.coachTucows Domains Inc.25 Nov 201931 Oct 202425 Nov 2025
479anextraordinary.comTucows Domains Inc.25 Nov 201926 Oct 202425 Nov 2025
480anextrovertinaworldofintroverts.comNameCheap, Inc.25 Nov 2019-25 Nov 2020
481anextur.clubRegional Network Information Center, JSC dba RU-CE…2 Dec 20192 Dec 20192 Dec 2020
482anextraordinaryofficer.comGoDaddy.com, LLC7 Dec 20197 Dec 20197 Dec 2021
483anextour-moscow.comenom429, Incorporated19 Feb 202517 Mar 202519 Feb 2026
484anextofkin.comGoDaddy.com, LLC15 Dec 201915 Dec 201915 Dec 2020
485anextofkincard.comGoDaddy.com, LLC15 Dec 201915 Dec 201915 Dec 2020
486anextrasetofhands.netWix.com Ltd.12 Jan 202013 Dec 202212 Jan 2026
487anextrahundredperday.comNameCheap, Inc.7 Feb 2020-7 Feb 2021
488anextract.comGoDaddy.com, LLC9 Feb 202022 Mar 20259 Feb 2025
489anextourbank.comDNC Holdings, Inc.18 Feb 202014 Feb 202518 Feb 2026
490anextourcard.comDNC Holdings, Inc.19 Feb 202014 Feb 202519 Feb 2026
491anextourbank.netDNC Holdings, Inc.18 Feb 202014 Feb 202518 Feb 2026
492anextourcard.netDNC Holdings, Inc.19 Feb 202014 Feb 202519 Feb 2026
493anextremelife.comTucows Domains Inc.26 Feb 20202 Mar 202126 Feb 2021
494anextrapaychecks.comGoDaddy.com, LLC26 Feb 20208 May 202426 Feb 2024
495anextourgolf.comDNC Holdings, Inc.2 Mar 202014 Feb 20252 Mar 2026
496anextraordinaryroad.comGoDaddy.com, LLC6 Mar 202011 Mar 20246 Mar 2026
497anextar.comDreamHost, LLC18 Mar 202018 Mar 202018 Mar 2021
498anexttours.comGoDaddy.com, LLC18 Mar 202018 Mar 202018 Mar 2021
499anextraordinaryyou.comFastDomain Inc.21 Mar 202021 Mar 202021 Mar 2021
500anextremlylongwebsitename.comNameCheap, Inc.1 Apr 20202 Mar 20241 Apr 2025
501anextremelylongurl.comNameCheap, Inc.1 Apr 20202 Mar 20241 Apr 2025
502anextremelylongdomainname.comNameCheap, Inc.1 Apr 20202 Apr 20251 Apr 2026
503anextround.comGoDaddy.com, LLC4 Apr 202016 Jun 20234 Apr 2023
504anext-amenagement.com1&1 Internet AG22 Apr 20204 Jun 202422 Apr 2024
505anextn.comGoDaddy.com, LLC6 May 202018 Jul 20236 May 2023
506anextract.netGoogle, Inc.15 May 202015 May 202015 May 2021
507anextlevellove.comGoDaddy.com, LLC9 May 202020 Jul 20249 May 2024
508anextraapron.comGoDaddy.com, LLC24 May 202025 May 202524 May 2026
509anextamerica.comGoDaddy.com, LLC31 May 20201 Jun 202531 May 2026
510anextranormal.farmNameCheap, Inc.17 Jun 202017 Jun 202017 Jun 2021
511anextratip.comGoDaddy.com, LLC9 Jul 20209 Jul 20209 Jul 2021
512anextlevelstaffing.comGoDaddy.com, LLC16 Oct 201728 Oct 202116 Oct 2022
513anextdoor.comGoDaddy.com, LLC2 Feb 20243 Feb 20252 Feb 2026
514anextrareach.comGoogle, Inc.6 Aug 20207 Aug 20236 Aug 2024
515anextfloor.comHiChina Zhicheng Technology Limited7 Aug 20207 Aug 20207 Aug 2021
516anextrasetofhandsyyc.comGoDaddy.com, LLC16 Aug 202016 Aug 202016 Aug 2021
517anextour-sakh.comLimited Liability Company "Registrar of domain nam…17 Aug 202017 Aug 202017 Aug 2021
518anextremsolution.comGoDaddy.com, LLC22 Aug 202022 Aug 202022 Aug 2021
519anextremelaptop.comGoDaddy.com, LLC24 Aug 20205 Oct 202324 Aug 2023
520anextproject.comLaunchpad, Inc.25 Aug 202025 Aug 202025 Aug 2021
521anext-us.comWeb Commerce Communications Limited dba WebNic.cc28 Aug 202028 Aug 202028 Aug 2029
522anextparkatentivert.restDynadot, LLC14 Feb 202027 Feb 202014 Feb 2021
523anextourcard.infoDNC Holdings, Inc.19 Feb 202019 Feb 202519 Feb 2026
524anextgenerationenergycompany.infoCSC Corporate Domains, Inc.4 Apr 201931 Mar 20254 Apr 2026
525anextlevelco.comGoDaddy.com, LLC10 Sep 202022 Nov 202310 Sep 2023
526anextraordinaryopportunity.comMoniker Online Services LLC18 Dec 202221 Jan 202518 Dec 2025
527anextraordinarybrandendeavor.comGoDaddy.com, LLC25 Sep 202025 Sep 202025 Sep 2021
528anexterion.comGoogle, Inc.25 Sep 202025 Sep 202025 Sep 2021
529anexti.comGoDaddy.com, LLC22 Mar 202423 Mar 202522 Mar 2026
530anextraordinarycommunity.comGoDaddy.com, LLC9 Nov 20209 Nov 20209 Nov 2021
531anextrahour.storeAscio Technologies, Inc. Danmark - Filial af Ascio…9 Nov 20209 Nov 20249 Nov 2024
532anexthome.comGoDaddy.com, LLC18 Nov 202019 Nov 202318 Nov 2026
533anextraspecial.designregister.com, Inc.3 Dec 20203 Dec 20203 Dec 2021
534anextraone.comGoDaddy.com, LLC5 Dec 20206 Dec 20245 Dec 2025
535anextlvl.comGoogle, Inc.16 Dec 202016 Dec 202016 Dec 2021
536anextourkrsk.comRegional Network Information Center, JSC dba RU-CE…23 Dec 2020-22 Dec 2021
537anextrasetofhands.ca-27 Oct 20173 Oct 202327 Oct 2025
538anextsoft.comGandi SAS17 Jan 202117 Jan 202117 Jan 2022
539anextday7.comNameCheap, Inc.18 Jan 2021-18 Jan 2022
540anextdaze8.comNameCheap, Inc.18 Jan 2021-18 Jan 2022
541anextmove9.comNameCheap, Inc.18 Jan 2021-18 Jan 2022
542anextsteps8.comNameCheap, Inc.18 Jan 2021-18 Jan 2022
543anextrading.comBeijing Lanhai Jiye Technology Co., Ltd2 May 20233 Jun 20252 May 2025
544anextron.comDynadot5 LLC16 Feb 202117 Feb 202116 Feb 2022
545anextra100dollars.comSquarespace Domains LLC20 Feb 202121 Feb 202420 Feb 2025
546anextour-kiev.comInternet Invest, Ltd. dba Imena.ua6 Mar 20216 Mar 20216 Mar 2022
547anexttime.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Mar 20218 Mar 20216 Mar 2022
548anextensionofbeauty.comTucows Domains Inc.12 Mar 202116 Mar 202212 Mar 2022
549anextensionofbeautystudio.comTucows Domains Inc.12 Mar 202116 Mar 202212 Mar 2022
550anextragift.comGoDaddy.com, LLC22 Mar 20212 Jun 202322 Mar 2023
551anextro.xyzNameCheap, Inc.6 Apr 20216 Apr 20216 Apr 2022
552anextabiz.comNameCheap, Inc.4 May 20214 Apr 20254 May 2026
553anextsilk.comName.com, Inc.13 May 202113 May 202113 May 2022
554anextour.websiteHosting Ukraine LLC20 May 2021-20 May 2022
555anextourp.onlineHosting Ukraine LLC20 May 2021-20 May 2022
556anexthomerealtor.comGoogle, Inc.25 May 202125 Jul 202425 May 2024
557anextlevellife.comGoDaddy.com, LLC30 May 202131 May 202530 May 2026
558anextour-agency.onlineHosting Ukraine LLC3 Jun 20217 Jun 20223 Jun 2023
559anextranotch.comGransy s.r.o. d/b/a subreg.cz6 Jun 202131 May 20257 Jun 2026
560anextrades.comNameCheap, Inc.22 Nov 20223 Jan 202422 Nov 2023
561anextlevelmindset.onlineTucows Domains Inc.18 Jun 202022 Jun 202118 Jun 2022
562anextlevelmindset.comTucows Domains Inc.18 Jun 202022 Jun 202118 Jun 2021
563anextlevelmindset.netTucows Domains Inc.18 Jun 202022 Jun 202118 Jun 2021
564anextourprimeservice.onlineLimited Liability Company "Registrar of domain nam…24 Jun 20212 Aug 202424 Jun 2024
565anextroversion.comAutomattic Inc.9 Jul 202121 Sep 20249 Jul 2024
566anextour72.comLimited Liability Company "Registrar of domain nam…13 Jul 202124 Jun 202513 Jul 2026
567anextourmaldives.comNamesilo, LLC14 Jul 202112 Jun 202514 Jul 2026
568anextreme.comXin Net Technology Corporation26 Jul 202110 Dec 202126 Jul 2022
569anextin.xyzNamesilo, LLC30 Jul 202030 Jul 202130 Jul 2022
570anextcell.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…4 Aug 202117 Aug 20214 Aug 2026
571anextraordinarycoach.comeNom, Inc.6 Aug 20216 Aug 20216 Aug 2022
572anext0ur.netGoogle, Inc.17 Aug 202117 Aug 202117 Aug 2022
573anextraa.comregister.com, Inc.21 Aug 202121 Aug 202121 Aug 2022
574anextravel.onlineLimited Liability Company "Registrar of domain nam…29 Aug 2021-29 Aug 2022
575anextlevelmindset.usTucows Domains Inc.18 Jun 202022 Jun 202118 Jun 2022
576anextcar.comGoDaddy.com, LLC19 Sep 20211 Dec 202419 Sep 2024
577anextraffic.xyzDynadot, LLC23 Dec 20222 Feb 202423 Dec 2023
578anextface.comNamesilo, LLC7 Nov 20218 Nov 20217 Nov 2022
579anextax.bizGoogle, Inc.16 Nov 202126 Jun 202516 Nov 2025
580anextworknews.comGoDaddy.com, LLC8 Dec 20218 Dec 20218 Dec 2022
581anextdoornews.comGoDaddy.com, LLC8 Dec 20218 Dec 20218 Dec 2022
582anextworks.comGoDaddy.com, LLC8 Dec 20218 Dec 20218 Dec 2022
583anextwork.comGoDaddy.com, LLC8 Dec 20218 Dec 20218 Dec 2022
584anextour.xyzDynadot, LLC1 Jun 20242 Jun 20251 Jun 2026
585anexten.questNameCheap, Inc.15 Dec 202115 Dec 202115 Dec 2022
586anextgtech.comHosting Concepts B.V. dba Openprovider15 Dec 202115 Dec 202115 Dec 2022
587anextrapixel.comWild West Domains, LLC7 Jan 20227 Jan 20227 Jan 2023
588anextourpriority.storeBeget LLC14 Jan 202214 Jan 202214 Jan 2023
589anextour-priority.storeBeget LLC14 Jan 202220 Jan 202214 Jan 2024
590anextourpriority.comBeget LLC14 Jan 202214 Jan 202214 Jan 2023
591anextour-priority.comBeget LLC14 Jan 202214 Jan 202214 Jan 2023
592anextours.onlineLimited Liability Company "Registrar of domain nam…25 Jan 202210 Jan 202525 Jan 2026
593anextourselection-class.comInternet Invest, Ltd. dba Imena.ua26 Jan 202226 Jan 202226 Jan 2023
594anextra10k.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Feb 20224 Feb 20224 Feb 2023
595anextour.coInterNetworX Ltd. & Co. KG2 Jul 20237 Jul 20242 Jul 2024
596anextur.travelRegional Network Information Center, JSC dba RU-CE…24 Feb 201010 Apr 202523 Feb 2026
597anextour.travelRegional Network Information Center, JSC dba RU-CE…24 Feb 201010 Apr 202523 Feb 2026
598anextraordinarylife.clubGoDaddy.com, LLC7 Apr 202219 May 20237 Apr 2023
599anextvid.comAutomattic Inc.16 Nov 202416 Nov 202416 Nov 2025
600anextraordinaryweb.siteDiaMatrix C.C.24 Apr 202230 Apr 202324 Apr 2024
601anexternal.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…28 Apr 20225 Jun 202328 Apr 2023
602anextent.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…14 May 202215 May 202314 May 2023
603anextour.globalDNC Holdings, Inc.30 May 20224 Jun 202230 May 2027
604anextbank.orgDynadot, LLC6 Jun 20225 Jun 20236 Jun 2023
605anextbank.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Jun 20222 Sep 20226 Jun 2024
606anextbank.coHangzhou AiMing Network Co., LTD6 Jun 202211 Jun 20236 Jun 2023
607anextbank.creditName.com, Inc.7 Jun 20227 Jun 20237 Jun 2024
608anextbank.asiaAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Jun 20226 Jun 20236 Jun 2024
609anextbank.netHangzhou AiMing Network Co., LTD6 Jun 202212 Aug 20236 Jun 2023
610anextdao.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Jun 20227 Jun 20236 Jun 2024
611anextmedia.comAbove.com Pty Ltd.6 Jun 202218 Jul 20236 Jun 2023
612anextmeta.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Jun 20227 Jun 20236 Jun 2024
613anextwallet.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Jun 20227 Jun 20246 Jun 2025
614anextcoin.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…2 May 20252 May 20252 May 2026
615anextpay.comGoDaddy.com, LLC11 Oct 202429 Apr 202511 Oct 2026
616anextcrypto.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Jun 20227 Jun 20236 Jun 2024
617anextdigital.comHangzhou AiMing Network Co., LTD6 Jun 202212 Aug 20236 Jun 2023
618anextnft.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Jun 20227 Jun 20236 Jun 2024
619anextfi.comHangzhou AiMing Network Co., LTD6 Jun 202212 Aug 20236 Jun 2023
620anextwin.icuDynadot, LLC14 Jun 202224 Aug 202314 Jun 2023
621anextinsurance.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…15 Jun 202216 Jun 202315 Jun 2023
622anextfund.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…28 Aug 202324 Jan 202428 Aug 2025
623anextranickel.comGoDaddy.com, LLC24 Sep 201723 Sep 202324 Sep 2025
624anextouregypt.comInternet Domain Services BS Corp3 Jul 20224 Jul 20233 Jul 2024
625anextour.ru.comNameKing.com Inc.18 Jun 202518 Jun 202518 Jun 2026
626anextour-sibiria.onlineLimited Liability Company "Registrar of domain nam…11 Jul 20228 Sep 202211 Jul 2024
627anextendedhelp.comWix.com Ltd.13 Jul 202213 Jun 202513 Jul 2026
628anextraperson.comGoDaddy.com, LLC19 Jul 202230 Aug 202419 Jul 2024
629anextransfer.comGoogle, Inc.27 Jul 202226 Aug 202427 Jul 2024
630anexteachertalks.comFastDomain Inc.28 Jul 202229 Aug 202328 Jul 2023
631anextrading.netNameCheap, Inc.31 Jul 202212 Oct 202331 Jul 2023
632anextrahandgeneralservices.comGoDaddy.com, LLC2 Aug 202213 Oct 20232 Aug 2023
633anextraordinaryevening.comWix.com Ltd.26 May 202426 May 202426 May 2026
634anextraordinaryidea.orgTucows Domains Inc.24 Nov 202429 Nov 202424 Nov 2025
635anextraordinaryadvantage.comDynadot, LLC26 Aug 20225 Oct 202326 Aug 2023
636anextraordinaryordinaryawakening.comCrazy Domains FZ-LLC29 Aug 202228 Aug 202429 Aug 2025
637anextraodinarylife.comWix.com Ltd.9 Sep 202219 Nov 20249 Sep 2024
638anextline.artNameCheap, Inc.15 Sep 202231 Aug 202315 Sep 2024
639anextline.comNameCheap, Inc.15 Sep 202227 Oct 202315 Sep 2023
640anextle.comMedia Elite Holdings Limited16 Sep 202217 Sep 202316 Sep 2023
641anexth.comNameCheap, Inc.10 Dec 202410 Mar 202510 Dec 2025
642anextg.comCloud Yuqu LLC28 Feb 202528 Feb 202528 Feb 2026
643anextraordinarytravelertx.comTucows Domains Inc.5 Oct 20226 Sep 20245 Oct 2025
644anextvr.comAmazon Registrar, Inc.5 Oct 202218 Nov 20245 Oct 2024
645anextorium.spaceAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…12 Oct 202212 Oct 202212 Oct 2023
646anextramitchell.comEpik Inc.11 Oct 202222 Nov 202311 Oct 2023
647anexte.comHostinger, UAB14 Oct 202219 Sep 202414 Oct 2025
648anextraordinarymarriage.comSquarespace Domains LLC5 Apr 202217 May 20255 Apr 2025
649anextraordinarychurch.comGoDaddy.com, LLC29 Nov 20171 Dec 202429 Nov 2025
650anextramile.uk-28 Oct 20222 Nov 202328 Oct 2023
651anextraordinaire.comName.com, Inc.1 Nov 202214 Jan 20241 Nov 2023
652anextrasomething.comGoDaddy.com, LLC4 Nov 202216 Jan 20254 Nov 2024
653anextradings.comGoDaddy.com, LLC26 Nov 20227 Feb 202426 Nov 2023
654anextours.shopLimited Liability Company "Registrar of domain nam…9 Oct 202115 Oct 20239 Oct 2024
655anextremelygoofymovie.storeGoDaddy.com, LLC8 Dec 20229 Dec 20238 Dec 2024
656anextrightstep.comTucows Domains Inc.15 Dec 202225 Jan 202515 Dec 2024
657anextm.info1&1 Internet AG18 Dec 20221 Feb 202518 Dec 2025
658anextm.com1&1 Internet AG18 Dec 202218 Dec 202218 Dec 2025
659anextraordinaryu.comFastDomain Inc.5 Jan 202318 Mar 20245 Jan 2024
660anexttrack.comDynadot, LLC5 Jan 202316 Mar 20245 Jan 2024
661anextour.bestURL Solutions, Inc.3 Jan 202018 Feb 20223 Jan 2024
662anextbank.africaHosteur SARL28 Jul 202131 Jan 202528 Jul 2025
663anextraordinarylife.onlineTucows Domains Inc.30 Jun 201912 Jul 202430 Jun 2025
664anextec.com.br-17 Jun 202024 Jun 202417 Jun 2025
665anextour.by-10 Apr 20175 Apr 202410 Apr 2026
666anextraordinarylife.ca-13 Jan 201514 Jan 202513 Jan 2027
667anextrasetofhands.proGoDaddy.com, LLC4 Feb 202315 May 20254 Feb 2027
668anextour.com.pl-23 Sep 202211 Jan 202323 Sep 2027
669anextraordinaryentrepreneur.comGoDaddy.com, LLC1 Oct 20172 Oct 20241 Oct 2025
670anextraspotatthetable.comGoDaddy.com, LLC21 Jul 201724 Jul 202321 Jul 2025
671anextraplaceatthetable.comGoDaddy.com, LLC21 Jul 201724 Jul 202321 Jul 2025
672anextivahealth.comGoDaddy.com, LLC22 Feb 202322 Feb 202322 Feb 2028
673anextremelygoofymovie.onlineGoDaddy.com, LLC23 Feb 202323 Feb 202323 Feb 2024
674anextfreedom.comGoDaddy.com, LLC11 Jul 201711 Jul 202311 Jul 2025
675anextour-spb.com-20 Apr 202322 May 202420 Apr 2024
676anextesia.comeNom, Inc.23 Feb 20238 Feb 202523 Feb 2026
677anextrainingrewards.comDynadot, LLC2 Mar 202311 Apr 20242 Mar 2024
678anextourkaliningrad.onlineLimited Liability Company "Registrar of domain nam…9 Mar 202317 Apr 20249 Mar 2024
679anextour.ae----
680anexts.comDomain.com, LLC18 Feb 20187 Feb 202518 Feb 2026
681anextlevelstate.comFastDomain Inc.8 Mar 201821 Feb 20258 Mar 2026
682anexttestament.comGoDaddy.com, LLC23 Mar 201821 Mar 202523 Mar 2026
683anextrasliceofnewyork.comGoDaddy.com, LLC12 Mar 202313 Mar 202512 Mar 2027
684anextendedfamilyoffice.comGoDaddy.com, LLC24 May 201825 May 202524 May 2026
685anextour.asiaKey-Systems GmbH16 Mar 20233 Feb 202516 Mar 2026
686anextour-online.comWix.com Ltd.30 Apr 202431 Mar 202530 Apr 2026
687anextgenerationenergycompany.comCSC Corporate Domains, Inc.4 Apr 201931 Mar 20254 Apr 2026
688anextraders.comWix.com Ltd.15 Mar 20237 Apr 202415 Mar 2025
689anextlevelfilm.comWix.com Ltd.3 Dec 20233 Dec 20233 Dec 2026
690anextour.pressRegional Network Information Center, JSC dba RU-CE…23 Mar 202311 Mar 202523 Mar 2026
691anextrahourofsunshine.comWix.com Ltd.9 Nov 202010 Oct 20249 Nov 2026
692anextourgorodok.comGoDaddy.com, LLC3 Apr 202115 Apr 20233 Apr 2024
693anextourspb.comBeget LLC6 Apr 20217 Apr 20236 Apr 2024
694anextraguy.comNameCheap, Inc.18 May 202118 Apr 202218 May 2023
695anextrascoop.comSquarespace Domains LLC25 Aug 202110 Aug 202425 Aug 2025
696anextbank.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…1 Sep 202129 Aug 20241 Sep 2025
697anextraordinaryoccasion.comeNom, Inc.9 Dec 202324 Nov 20249 Dec 2025
698anextoken.comNics Telekomünikasyon Ticaret Ltd. Şti.27 Dec 202127 Dec 202127 Dec 2026
699anextrahandvirtual.comSquarespace Domains LLC18 Jan 20223 Jan 202518 Jan 2026
700anextramileeveryday.comGoDaddy.com, LLC22 Feb 20226 May 202322 Feb 2023
701anextechnology.comGoDaddy.com, LLC11 Apr 202310 Apr 202511 Apr 2026
702anextlevelleader.comSquarespace Domains LLC11 Apr 202327 Mar 202511 Apr 2026
703anext-shipping.comGoDaddy.com, LLC21 Apr 20223 May 202321 Apr 2024
704anextrarainbow.comGoDaddy.com, LLC4 May 202229 Sep 20224 May 2027
705anextloan.comNameKing.com Inc.7 Jun 202221 Jul 20247 Jun 2024
706anextchain.comNameKing.com Inc.7 Jun 202221 Jul 20247 Jun 2024
707anextdigitalbank.comNameKing.com Inc.7 Jun 202221 Jul 20247 Jun 2024
708anextplus.comNameKing.com Inc.7 Jun 202221 Jul 20247 Jun 2024
709anextoor.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Apr 202315 Apr 202414 Apr 2025
710anextech.co.in-23 Jun 201612 Jun 202523 Jun 2026
711anextourbank.infoDNC Holdings, Inc.18 Feb 202019 Feb 202518 Feb 2026
712anextrapaycheck.infoGoDaddy.com, LLC26 Feb 20208 May 202426 Feb 2024
713anextour.techRegional Network Information Center, JSC dba RU-CE…21 Apr 202311 Mar 202521 Apr 2026
714anextour.cloudRegional Network Information Center, JSC dba RU-CE…21 Apr 202316 Mar 202521 Apr 2026
715anextvr.linkAmazon Registrar, Inc.5 Oct 202218 Nov 20245 Oct 2024
716anextourturkiye.comGoDaddy.com, LLC19 Apr 20231 Jul 202419 Apr 2024
717anextouruk.comGoDaddy.com, LLC19 Apr 202320 Apr 202519 Apr 2026
718anextraplaceatthetable.netGoDaddy.com, LLC21 Jul 201724 Jul 202321 Jul 2025
719anextourturkiye.co.uk-19 Apr 202311 Aug 202319 Apr 2024
720anextgenerationenergycompany.netCSC Corporate Domains, Inc.4 Apr 201931 Mar 20254 Apr 2026
721anexternal.netAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…28 Apr 20225 Jun 202328 Apr 2023
722anextensionofyourteam.com-24 Apr 20233 Jun 202424 Apr 2024
723anextraordinarychurch.orgGoDaddy.com, LLC29 Nov 201713 Jan 202529 Nov 2025
724anextremeoriginal.orgGoDaddy.com, LLC23 Mar 20194 May 202523 Mar 2025
725anextgenerationenergycompany.orgCSC Corporate Domains, Inc.4 Apr 20195 Apr 20254 Apr 2026
726anextraham.orgNamesilo, LLC16 Nov 201931 Dec 202416 Nov 2025
727anextraplate.org1&1 Internet AG5 Jan 202019 Feb 20255 Jan 2026
728anextourcard.orgDNC Holdings, Inc.19 Feb 202019 Feb 202519 Feb 2026
729anextourbank.orgDNC Holdings, Inc.18 Feb 202019 Feb 202518 Feb 2026
730anextrahammer.org1&1 Internet AG27 Sep 202010 Nov 202427 Sep 2024
731anextraone.orgLaunchpad, Inc.14 Jan 202128 Mar 202514 Jan 2025
732anextraminute.netGoDaddy.com, LLC28 Apr 202310 May 202428 Apr 2025
733anextraordinarybooklist.orgDreamHost, LLC8 Mar 202214 Jun 20258 Mar 2028
734anextransport.pl-5 Nov 201529 Oct 20245 Nov 2025
735anextrapairofhands.uk-17 Apr 201918 Apr 202517 Apr 2028
736anexte.vipNameCheap, Inc.6 Nov 202221 Nov 20236 Nov 2023
737anexthing.comGoogle, Inc.11 May 202322 Jun 202511 May 2025
738anextthing.comGoogle, Inc.11 May 202311 Jul 202411 May 2024
739anextraday.onlineDomain.com, LLC22 May 202329 Apr 202522 May 2026
740anextiva.comTucows Domains Inc.25 May 20235 Aug 202425 May 2024
741anextbank.ioDynadot, LLC6 Jun 20229 Jun 20236 Jun 2023
742anextour.devDNC Holdings, Inc.8 Jun 202313 Jun 20238 Jun 2026
743anextin.comGoDaddy.com, LLC6 Jun 202318 Aug 20246 Jun 2024
744anextrabonus.infoGoDaddy.com, LLC12 Jun 202313 Jun 202512 Jun 2026
745anextrabonus.orgGoDaddy.com, LLC12 Jun 202313 Jun 202512 Jun 2026
746anextrabonus.comGoDaddy.com, LLC12 Jun 202313 Jun 202512 Jun 2026
747anextrabonus.netGoDaddy.com, LLC12 Jun 202313 Jun 202512 Jun 2026
748anextraordinaryordinaryman.comGoDaddy.com, LLC13 Jun 202325 Jul 202413 Jun 2024
749anextraordinaryordinarywoman.comGoDaddy.com, LLC13 Jun 202325 Jul 202413 Jun 2024
750anextsolution.com1&1 Internet AG24 Dec 202413 Feb 202524 Dec 2025
751anextour.pl-20 Nov 20194 Nov 202420 Nov 2025
752anextraordinary.co.uk-25 Nov 201926 Oct 202125 Nov 2023
753anext-tokyo.comGMO Internet Inc.8 Aug 202313 May 20258 Aug 2026
754anextradaughter.comGoDaddy.com, LLC14 Aug 202325 Sep 202414 Aug 2024
755anextrasister.comGoDaddy.com, LLC14 Aug 202325 Sep 202414 Aug 2024
756anextramonth.comGoDaddy.com, LLC26 Aug 202327 Aug 202426 Aug 2025
757anextramonthofincome.comGoDaddy.com, LLC14 Sep 202315 Sep 202414 Sep 2025
758anextere.onlineDomain.com, LLC29 Sep 202323 Sep 202429 Sep 2025
759anextbroker.comNameCheap, Inc.12 Oct 202313 Oct 202412 Oct 2025
760anextour.ltEPAG Domainservices GmbH21 Nov 2016-22 Nov 2025
761anexttreaney.netNameCheap, Inc.25 Oct 202326 Oct 202425 Oct 2025
762anextelimkel.netNameCheap, Inc.27 Oct 202328 Oct 202427 Oct 2025
763anexthesiall.comGoDaddy.com, LLC1 Nov 202313 Jan 20251 Nov 2024
764anextrahandcleaning.comCrazy Domains FZ-LLC13 Nov 202327 Jan 202513 Nov 2024
765anextraspacetoshare.comGoDaddy.com, LLC25 Nov 20235 Feb 202525 Nov 2024
766anextourbeds.comNics Telekomünikasyon Ticaret Ltd. Şti.6 Dec 202325 Oct 20246 Dec 2025
767anexttherzer.co.uk-6 Dec 20236 Dec 20246 Dec 2024
768anextradoseofcurious.comWix.com Ltd.11 Dec 202314 May 202411 Dec 2025
769anextdata.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…15 Mar 202519 Mar 202515 Mar 2026
770anextdt.comChengdu West Dimension Digital Technology Co., Ltd…16 Dec 202329 Jan 202516 Dec 2024
771anexttech.comChengdu West Dimension Digital Technology Co., Ltd…16 Dec 202329 Jan 202516 Dec 2024
772anexture.inHosting Concepts B.V. dba Openprovider27 Mar 20211 Apr 202527 Mar 2026
773anextcloud.comChengdu West Dimension Digital Technology Co., Ltd…10 Jan 202423 Feb 202510 Jan 2025
774anextour72.onlineLimited Liability Company "Registrar of domain nam…12 Jan 202420 Feb 202512 Jan 2025
775anextraordinarylifebyrichardfranza.comeNom, Inc.12 Jan 202427 Feb 202412 Jan 2027
776anextraordinaryplace.org1&1 Internet AG20 Jan 202426 Jan 202520 Jan 2026
777anextrem-anestesia-extrema.comDinahosting s.l.31 Jan 202424 Jan 202531 Jan 2026
778anextgeni.chatDNSPod, Inc.2 Feb 202423 Jan 20252 Feb 2026
779anextdoor.orgGoDaddy.com, LLC2 Feb 202416 Mar 20252 Feb 2025
780anextgeni.comDNSPod, Inc.2 Feb 202419 Jan 20252 Feb 2026
781anextdoor.netGoDaddy.com, LLC2 Feb 202416 Mar 20252 Feb 2025
782anextralargepenis.onlineDomain.com, LLC2 Feb 202418 Mar 20252 Feb 2025
783anextax.comGoDaddy.com, LLC5 Feb 202419 Mar 20255 Feb 2025
784anextour.in101domain, Inc.19 Jan 202412 Apr 202519 Jan 2027
785anextradingco.comGoDaddy.com, LLC10 Feb 202421 Feb 202510 Feb 2026
786anextractor.fanDynadot, LLC13 Feb 202425 Mar 202513 Feb 2025
787anextechnologyllc.comRealtime Register B.V.21 Feb 202428 Feb 202521 Feb 2026
788anextrapairofhands.com.au--2 Jan 2025-
789anextlevel.com.br-23 Nov 20239 Dec 202423 Nov 2024
790anext-kanagawa.comGMO Internet Inc.13 Mar 202426 Feb 202513 Mar 2026
791anextensi.comNameCheap, Inc.21 Mar 202419 Feb 202521 Mar 2026
792anextensio.onlineNameCheap, Inc.2 Apr 202414 May 20252 Apr 2025
793anextravagantlywildlife.comGoDaddy.com, LLC2 Apr 20244 Apr 20252 Apr 2026
794anextour18.comLimited Liability Company "Registrar of domain nam…3 Apr 20247 May 20243 Apr 2026
795anextra-de.cfdNameCheap, Inc.7 Apr 202419 May 20257 Apr 2025
796anextindustry.comHostinger, UAB8 Apr 20246 Apr 20258 Apr 2026
797anextoursh.onlineLimited Liability Company "Registrar of domain nam…18 Apr 202426 Jun 202518 Apr 2025
798anextrasetofhandsyyc.ca-14 Jul 202025 Aug 202414 Jul 2024
799anextra500.comName.com, Inc.26 Apr 20248 Jun 202526 Apr 2025
800anexta.ru-21 Jun 2010-21 Jun 2026
801anexte.ru-19 Apr 2024-19 Apr 2025
802anextek.ru-30 Jul 2007-30 Jul 2025
803anextel.ru-22 Feb 2011-22 Feb 2026
804anextour-agency.ru-23 Jul 2020-23 Jul 2026
805anextour-56.ru-26 Dec 2023-26 Dec 2024
806anextour-74.ru-2 Dec 2024-2 Dec 2025
807anextour-agent.ru-29 Mar 2017-29 Mar 2025
808anextour-ekb.ru-12 Jul 2017-12 Jul 2026
809anextour-evropolis.ru-18 May 2023-18 May 2024
810anextourspb.ru-31 Oct 2024-31 Oct 2025
811anextour-krasnodar.ru-21 Apr 2022-21 Apr 2025
812anextour-nvrsk.ru-15 Oct 2024-15 Oct 2025
813anextour-online.ru-16 Jan 2025-16 Jan 2026
814anextour-posad.ru-17 Aug 2021-17 Aug 2025
815anextour-pro.ru-17 Sep 2024-17 Sep 2025
816anextour-sochi.ru-14 May 2024-14 May 2026
817anextour-ug.ru-31 Jan 2018-31 Jan 2026
818anextour-ukhta.ru-9 Feb 2022-9 Feb 2026
819anextour-vologda.ru-26 Oct 2023-26 Oct 2025
820anextour-zelenograd.ru-1 Mar 2023-1 Mar 2025
821anextour1.ru-25 Aug 2021-25 Aug 2024
822anextour30.ru-19 Apr 2023-19 Apr 2026
823anextour36.ru-5 Nov 2023-5 Nov 2025
824anextour54.ru-8 Oct 2024-8 Oct 2025
825anextour66.ru-14 Sep 2023-14 Sep 2025
826anextour70.ru-30 Mar 2017-30 Mar 2024
827anextour74.ru-23 May 2019-23 May 2026
828anextourpenza.ru-20 Mar 2023-20 Mar 2025
829anextourpoisk.ru-15 Sep 2017-15 Sep 2025
830anextourprimeservice.ru-24 Jun 2021-24 Jun 2024
831anextur.ru-19 Aug 2002-19 Aug 2025
832anextour-kazan.ru-15 Dec 2017-15 Dec 2025
833anextour-moscow.ru-10 Nov 2017-10 Nov 2025
834anextour-shop.ru-29 Mar 2017-29 Mar 2026
835anextour22.ru-24 Oct 2023-24 Oct 2025
836anextour38.ru-3 Nov 2023-3 Nov 2025
837anextour56.ru-2 Feb 2018-2 Feb 2026
838anextour72.ru-12 Jan 2024-12 Jan 2025
839anextourazimut.ru-29 Sep 2021-29 Sep 2025
840anextourbiysk.ru-20 Jun 2023-20 Jun 2024
841anextourchel.ru-23 May 2019-23 May 2026
842anextourism.ru-4 May 2023-4 May 2024
843anextourismgroup.ru-27 Jun 2013-27 Jun 2026
844anextourkit.ru-30 Oct 2023-30 Oct 2024
845anextourmsk.ru-6 Aug 2024-6 Aug 2025
846anextournsk.ru-7 Mar 2024-7 Mar 2025
847anextourrus.ru-4 Oct 2023-4 Oct 2025
848anextours.ru-18 Oct 2019-18 Oct 2025
849anextoursh.ru-18 Apr 2024-18 Apr 2026
850anextourufa.ru-15 Apr 2019-15 Apr 2024
851anextourv.ru-11 Jul 2019-11 Jul 2025
852anextourvl.ru-4 Jan 2022-4 Jan 2026
853anextr.ru-29 May 2018-29 May 2026
854anextravel.ru-13 Apr 2014-13 Apr 2026
855anextur-kazan.ru-1 Mar 2019-1 Mar 2026
856anextur24.ru-22 Sep 2017-22 Sep 2025
857anexturizm.ru-5 Jan 2022-5 Jan 2026
858anexturonline.ru-26 Feb 2023-26 Feb 2025
859anexturufa.ru-11 Jul 2019-11 Jul 2026
860anextor.se-3 Jan 202327 Dec 20243 Jan 2026
861anextour.se-18 Nov 201613 Nov 202418 Nov 2025
862anextrahour.se-9 Nov 202019 Nov 20249 Nov 2024
863anextstation.com.br-13 May 202327 May 202513 May 2025
864anextra.frOVH sas10 Jan 202411 Jan 202510 Jan 2026
865anextour-arz.ru-17 May 2024-17 May 2026
866anexteng.comNamesilo, LLC17 May 202417 May 202517 May 2026
867anextrejoy.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…24 May 20246 Jun 202524 May 2026
868anextrahandteam.comGoDaddy.com, LLC31 May 20246 Apr 202531 May 2025
869anextraai.comGoDaddy.com, LLC1 Jun 20246 Jun 20251 Jun 2026
870anexterra.comGoDaddy.com, LLC5 Jun 202410 Jun 20255 Jun 2026
871anexterra.netEpik Inc.6 Jun 20247 Jun 20256 Jun 2026
872anextouragentstvo.onlineLimited Liability Company "Registrar of domain nam…23 Jun 202424 Jun 202523 Jun 2026
873anextouragentstvo.ru-23 Jun 2024-23 Jun 2026
874anextbest.site1&1 Internet AG29 Jun 202429 Aug 202429 Jun 2025
875anextrabatch.comWix.com Ltd.5 Jul 20245 Jun 20255 Jul 2026
876anextsteps.comGoDaddy.com, LLC8 Jul 20248 Jul 20248 Jul 2025
877anextrip.comGoogle, Inc.19 Jul 202419 Jul 202419 Jul 2025
878anexterra.cloudNameCheap, Inc.27 Jul 20241 Aug 202427 Jul 2025
879anexterra.onlineNameCheap, Inc.27 Jul 20246 Aug 202427 Jul 2025
880anexterra.siteNameCheap, Inc.27 Jul 20246 Aug 202427 Jul 2025
881anexterra.llcNameCheap, Inc.27 Jul 20241 Aug 202427 Jul 2025
882anextrascoopvr.comTucows Domains Inc.5 Aug 20245 Aug 20245 Aug 2025
883anextspin.comGoDaddy.com, LLC9 Aug 20249 Aug 20249 Aug 2025
884anextadventure.comGandi SAS10 Aug 202410 Aug 202410 Aug 2025
885anextraordinaryfuture.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Aug 202420 Oct 202419 Aug 2025
886anextnode.comNameCheap, Inc.24 Aug 202424 Aug 202424 Aug 2025
887anextlevellife.orgTucows Domains Inc.26 Aug 20216 Oct 202426 Aug 2024
888anextraordinarycompany.co.uk-30 Aug 202430 Aug 202430 Aug 2025
889anextlevelchurch.infoGoDaddy.com, LLC2 Sep 20247 Sep 20242 Sep 2025
890anextlevelchurch.orgGoDaddy.com, LLC2 Sep 20247 Sep 20242 Sep 2025
891anextlevelchurch.netGoDaddy.com, LLC2 Sep 20242 Sep 20242 Sep 2025
892anextlevelchurch.comGoDaddy.com, LLC2 Sep 20242 Sep 20242 Sep 2027
893anexture.comNameCheap, Inc.6 Sep 20246 Sep 20246 Sep 2025
894anextour-kuz.ru-10 Sep 2024-10 Sep 2025
895anextrapairofhands.servicesTucows Domains Inc.11 Sep 202416 Sep 202411 Sep 2025
896anextgenhub.comGoDaddy.com, LLC5 Oct 20245 Oct 20245 Oct 2025
897anextuor.ru-8 Oct 2024-8 Oct 2025
898anextezy.ru-30 Oct 2024-30 Oct 2025
899anextraordinaryfriendship.comeNom, Inc.6 Nov 20246 Nov 20246 Nov 2025
900anextechsolutions.comNordreg AB7 Nov 20247 Nov 20247 Nov 2025
901anextsolutions.netGoogle, Inc.11 Nov 202426 Nov 202411 Nov 2025
902anextgenai.onlineNetwork Solutions, LLC22 Nov 202427 Nov 202422 Nov 2025
903anextgenai.comNetwork Solutions, LLC22 Nov 202422 Nov 202422 Nov 2025
904anextraskill.comGoDaddy.com, LLC25 Nov 202425 Nov 202425 Nov 2025
905anextraedge.comGoDaddy.com, LLC9 Dec 20249 Dec 20249 Dec 2025
906anextours.storeNameCheap, Inc.9 Dec 202416 Dec 20249 Dec 2025
907anextool-order.netJapan Registry Services Co., Ltd.12 Dec 202412 Dec 202412 Dec 2025
908anextnet.comMetaregistrar BV Applications14 Dec 202429 Dec 202414 Dec 2025
909anextest.techHostinger, UAB16 Dec 202421 Dec 202416 Dec 2025
910anextrust.comHostinger, UAB25 Dec 20246 Mar 202525 Dec 2025
911anextour.worldGoDaddy.com, LLC9 Jan 202514 Jan 20259 Jan 2026
912anextracookie.comGMO Internet Inc.22 Jan 202522 Jan 202522 Jan 2026
913anextx.comGoDaddy.com, LLC28 Jan 202515 Mar 202528 Jan 2026
914anextstep.agencyNameCheap, Inc.28 Jan 20252 Feb 202528 Jan 2026
915anextraspecialdiary.comNetwork Solutions, LLC10 Feb 202510 Feb 202510 Feb 2026
916anextinctionevent.comAmazon Registrar, Inc.16 Feb 202516 Feb 202516 Feb 2026
917anextbattery.comGoDaddy.com, LLC22 Feb 202522 Feb 202522 Feb 2028
918anextour.vipNameCheap, Inc.6 Mar 202529 Mar 20256 Mar 2026
919anextrustpro.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Mar 20259 May 20259 Mar 2026
920anextinfotech.comInterNetworX Ltd. & Co. KG14 Mar 20251 Apr 202514 Mar 2026
921anextour-omsk.ru-16 Mar 2025-16 Mar 2026
922anextremelycoolwebsite.orgNameCheap, Inc.20 Mar 202525 Mar 202520 Mar 2026
923anextensionofyouwi.comGoDaddy.com, LLC24 Mar 202524 Mar 202524 Mar 2026
924anextide.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…20 May 202426 Mar 202520 May 2026
925anextdoor.siteNameCheap, Inc.28 Mar 20251 May 202528 Mar 2026
926anextcard.comGoDaddy.com, LLC2 Apr 20252 Apr 20252 Apr 2027
927anextoblako.comGMO Internet Inc.16 Apr 202516 Apr 202516 Apr 2026
928anextus.comGoDaddy.com, LLC25 Apr 202525 Apr 202525 Apr 2026
929anextourmarketing.co.uk-28 Apr 202528 Apr 202528 Apr 2026
930anextrastep.orgGoDaddy.com, LLC1 May 20256 May 20251 May 2026
931anextra.ioNameCheap, Inc.6 Mar 20229 Feb 20256 Mar 2026
932anextraordinaryordinarylife.blogAutomattic Inc.5 May 202510 May 20255 May 2026
933anextourbank.xxxDNC Holdings, Inc.18 Feb 202022 May 202518 Feb 2026
934anextour.xxxDNC Holdings, Inc.15 Dec 201122 May 202515 Dec 2025
935anextourcard.xxxDNC Holdings, Inc.19 Feb 202022 May 202519 Feb 2026
936anextradingforex.liveGoDaddy.com, LLC10 Jun 202510 Jun 202510 Jun 2026
937anextal.comGoDaddy.com, LLC16 Jun 202516 Jun 202516 Jun 2026
938anextraspoon.co.uk-23 Jun 202524 Jun 202523 Jun 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=anext

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now