Our database now contains whois records of 674 Million (674,160,949) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1595 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [674 Million Domains] $10,000 Details

Keyword: ANECDOTES

Reverse Whois » KEYWORD [anecdotes ]  { 234 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1anecdotes.onlineNameCheap, Inc.1 Jan 20241 Jan 20261 Jan 2027
2anecdotes.comGandi SAS1 Mar 199929 Jan 20261 Mar 2027
3anecdotes.workeNom, Inc.15 Apr 201615 Apr 201615 Apr 2017
4anecdotes.xyzDynadot, LLC9 Jan 20269 Jan 20269 Jan 2027
5anecdotes.linkGMO Internet Inc.24 Apr 20164 Jun 201724 Apr 2017
6anecdotes.bizPDR Ltd. d/b/a PublicDomainRegistry.com21 Sep 201721 Sep 201721 Sep 2018
7anecdotes.usDynadot, LLC13 Apr 202413 Feb 202613 Apr 2027
8anecdotes.infoInternet Domain Services BS Corp15 May 202528 Nov 202515 May 2026
9anecdotes.netAnnulet LLC3 Oct 20014 Oct 20253 Oct 2026
10anecdotes.orgGoDaddy.com, LLC6 Nov 202426 Oct 20256 Nov 2026
11anecdotes.frOVH sas17 May 202030 Jun 202517 May 2026
12anecdotes.lifeGoDaddy.com, LLC16 Aug 202327 Sep 202416 Aug 2024
13anecdotes.ltdAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 Nov 201719 Nov 201719 Nov 2018
14anecdotes.co.uk-15 Apr 200414 Apr 202515 Apr 2026
15anecdotes.tipsName.com, Inc.9 Mar 20185 May 20189 Mar 2019
16anecdotes.cloudNameCheap, Inc.26 Jan 20219 Mar 202526 Jan 2025
17anecdotes.travelNameCheap, Inc.16 Aug 20225 Aug 2025-
18anecdotes.aiCloudFlare, Inc.2 Jan 202012 Dec 20252 Jan 2030
19anecdotes.uk-10 Jun 20199 Jun 202510 Jun 2026
20anecdotes.oneGoDaddy.com, LLC3 Nov 20223 Nov 20223 Nov 2023
21anecdotes.appNameCheap, Inc.3 Dec 202419 Nov 2025-
22anecdotes.inkPorkbun, LLC15 Dec 202225 Jan 202415 Dec 2023
23anecdotes.devCloudFlare, Inc.14 Jun 202130 Jun 202514 Jun 2026
24anecdotes.bestNameKing.com Inc.28 Apr 202412 Jun 202528 Apr 2025
25anecdotes.fun-21 Jun 202526 Jun 202521 Jun 2026
26anecdotes.site-15 Apr 202424 Apr 202515 Apr 2026
27anecdotes.inGoDaddy.com, LLC15 Sep 201331 May 202515 Sep 2027
28anecdotes.ovhOVH sas3 Oct 20144 Oct 20233 Oct 2024
29anecdotes.lolNameCheap, Inc.2 May 202313 Jun 20242 May 2024
30anecdotes.blogHostinger, UAB18 Aug 202317 Aug 202518 Aug 2026
31anecdotes.techHostinger, UAB9 Jan 202422 Feb 20259 Jan 2025
32anecdotes.liveGoDaddy.com, LLC6 Feb 202420 Mar 20256 Feb 2025
33anecdotes.storeGoDaddy.com, LLC6 Feb 202420 Mar 20256 Feb 2025
34anecdotes.worldGoDaddy.com, LLC17 Apr 202412 Apr 202517 Apr 2026
35anecdotes.shopNameCheap, Inc.1 Jul 202113 Aug 20241 Jul 2024
36anecdotes.ru-2 Jun 2015-2 Jun 2026
37anecdotes.eu----
38anecdotes.proNameKing.com Inc.27 Jun 202427 Jun 202527 Jun 2026
39anecdotes.studioSquarespace Domains LLC24 Aug 202529 Aug 202524 Aug 2026
40anecdotescity.comOVH sas20 Aug 201420 Aug 201420 Aug 2015
41anecdotesfromantiquity.netFastDomain Inc.14 Apr 201518 Mar 202514 Apr 2027
42anecdotesclothing.comMarcaria.com International, Inc.24 Dec 201424 Dec 201424 Dec 2015
43anecdotesfromantiquity.comFastDomain Inc.18 Apr 201518 Mar 202518 Apr 2026
44anecdotesofanunexaminedlife.comWild West Domains, LLC6 May 20156 May 20156 May 2016
45anecdotesofaramblingsoul.comNetwork Solutions, LLC4 Jun 20154 Jun 20154 Jun 2018
46anecdotestudios.comGoDaddy.com, LLC18 Sep 201530 Nov 202418 Sep 2024
47anecdotesdecuisine.comInternet Domain Services BS Corp24 May 201927 May 201924 May 2020
48anecdotesoflife.comBigRock Solutions Ltd.11 Oct 20197 Oct 202111 Oct 2030
49anecdotes-digitales.comOVH sas5 Oct 20155 Oct 20155 Oct 2016
50anecdotesandalcohol.comGoogle, Inc.7 Nov 201528 Nov 20157 Nov 2016
51anecdotesfromlaos.comFastDomain Inc.13 Nov 201513 Nov 201613 Nov 2017
52anecdotes-limoges.comGMO Internet Inc.17 Dec 201518 Jan 201717 Dec 2017
53anecdotesandteachersnotes.comGoogle, Inc.30 Dec 201530 Dec 201530 Dec 2016
54anecdotesynonym.usGoDaddy.com, LLC31 Dec 201531 Dec 201530 Dec 2016
55anecdoteswithantidotes.comFastDomain Inc.29 Jun 202031 Jul 202329 Jun 2023
56anecdoteshistoriques.comOnline SAS28 Sep 20209 Jan 202628 Sep 2026
57anecdotesaidealapersonne.comNetwork Solutions, LLC10 Apr 201610 Apr 201610 Apr 2017
58anecdoteshistoriques.netWild West Domains, LLC19 Apr 201620 Mar 202519 Apr 2026
59anecdotesgaza.xyzGMO Internet Inc.8 Jun 201617 Jun 20168 Jun 2017
60anecdotesclub.comGoDaddy.com, LLC10 Jul 201612 Jul 201710 Jul 2018
61anecdotesdunpapa.comSquarespace Domains LLC12 Jul 201627 Jun 202512 Jul 2026
62anecdotesdesign.comGoDaddy.com, LLC10 Jun 201910 Jun 201910 Jun 2020
63anecdotesolutions.comGoDaddy.com, LLC18 Jun 200314 Jun 202518 Jun 2026
64anecdotes-and-observations.com-12 May 202413 May 202512 May 2026
65anecdotesdemerde.comOVH sas6 May 20105 May 20176 May 2018
66anecdotes-sexes.comOVH sas21 Jul 201022 Jul 202321 Jul 2024
67anecdotes-sexy.comDynadot, LLC23 Jul 200821 Oct 201623 Jul 2018
68anecdotesdechineurs.comGMO Internet Inc.19 Dec 202330 Jan 202519 Dec 2024
69anecdotesfromthepeak.comHu Yi Global Information Hong Kong Limited1 Apr 201426 Apr 20161 Apr 2017
70anecdotesandapples.comFastDomain Inc.10 May 201024 Apr 202510 May 2026
71anecdotesandreflections.comGoDaddy.com, LLC22 Aug 200823 Aug 202411 Aug 2025
72anecdotes-spatiales.comOVH sas5 Jan 20126 Jan 20255 Jan 2027
73anecdoteservices.comGoDaddy.com, LLC17 Jun 201318 Jun 202517 Jun 2026
74anecdotes-papiersdesoie.comActive Market Domains LLC22 Jul 20244 Sep 202522 Jul 2025
75anecdotesgame.comGoDaddy.com, LLC3 Apr 20124 Apr 20163 Apr 2018
76anecdotes-togo.comGoDaddy.com, LLC10 Apr 201211 Apr 201610 Apr 2017
77anecdotesovercoffee.comeNom, Inc.17 Jan 201316 Dec 201417 Jan 2017
78anecdotes5a7.comGoDaddy.com, LLC25 Jan 201226 Jan 202625 Jan 2027
79anecdotesguide.comGoDaddy.com, LLC9 Dec 201230 Oct 20159 Dec 2016
80anecdotesandadventures.comWild West Domains, LLC13 Apr 201414 Mar 201613 Apr 2017
81anecdoteshcr.comOVH sas30 Jul 201630 Jul 201630 Jul 2017
82anecdotesabroad.comDNSPod, Inc.14 Jun 202117 Jun 202114 Jun 2022
83anecdotesbyzoila.comBeijing Lanhai Jiye Technology Co., Ltd22 Nov 202223 Nov 202422 Nov 2025
84anecdoteshort.us-3 Oct 20163 Oct 20162 Oct 2017
85anecdoteseat.us-3 Oct 20163 Oct 20162 Oct 2017
86anecdotescary.us-4 Oct 20164 Oct 20163 Oct 2017
87anecdotestyle.usUniregistrar Corp4 Oct 20164 Oct 20163 Oct 2017
88anecdotesum.us-4 Oct 20164 Oct 20163 Oct 2017
89anecdotesnap.us-7 Oct 20167 Oct 20166 Oct 2017
90anecdotesampantidotes.comGoogle, Inc.30 Oct 201629 Nov 201730 Oct 2017
91anecdotesofadisabledgay.netTucows Domains Inc.8 Dec 201612 Dec 20188 Dec 2018
92anecdotesforthesoul.comTucows Domains Inc.26 Dec 201630 Dec 201726 Dec 2017
93anecdotesmagazine.comAutomattic Inc.25 Jan 202625 Jan 202625 Jan 2028
94anecdotespotterystudio.com-23 May 202526 May 202523 May 2026
95anecdotesapp.comHostinger, UAB27 Jun 201727 Aug 201727 Jun 2018
96anecdotesbyaddie.comGoogle, Inc.1 Aug 20171 Aug 20171 Aug 2018
97anecdotesilly.comNameCheap, Inc.10 Sep 20179 Sep 202510 Sep 2026
98anecdotes-historiques.com1&1 Internet AG23 Sep 201716 Apr 202523 Sep 2026
99anecdotesarekillingyou.comNameCheap, Inc.10 Oct 201710 Sep 202310 Oct 2024
100anecdotesanonymous.comGoogle, Inc.14 Oct 201711 Dec 201714 Oct 2018
101anecdotesformymom.comAutomattic Inc.22 Oct 201722 Oct 201722 Oct 2018
102anecdotesandevidence.comAutomattic Inc.9 Dec 20179 Dec 20179 Dec 2018
103anecdotesoftware.co.uk-11 Dec 201211 Nov 201611 Dec 2018
104anecdotesdesign.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…15 Feb 201323 Feb 201615 Feb 2018
105anecdotespublishing.co.ukOVH sas15 May 201715 May 201715 May 2018
106anecdotesbyscarlet.comFastDomain Inc.10 Mar 201810 Mar 201810 Mar 2019
107anecdotesandaspirations.comNameCheap, Inc.17 Mar 201817 Mar 201817 Mar 2019
108anecdotesofabohemian.comGoogle, Inc.20 Mar 201820 Mar 201820 Mar 2019
109anecdotesfromsoccer.comLaunchpad, Inc.25 Jul 201825 Jul 201825 Jul 2019
110anecdotesofrecovery.comAutomattic Inc.31 Jul 201831 Jul 201831 Jul 2019
111anecdotesdevoyage.comGoDaddy.com, LLC6 Aug 20186 Aug 20186 Aug 2019
112anecdotesdunevie.comAutomattic Inc.30 Aug 201830 Aug 201830 Aug 2019
113anecdotesearch.comGoDaddy.com, LLC26 Sep 201826 Sep 201826 Sep 2019
114anecdotesofevidence.comNameCheap, Inc.22 Oct 201822 Oct 201822 Oct 2019
115anecdotesfr.onlineNameCheap, Inc.2 Nov 20182 Nov 20182 Nov 2019
116anecdotesonlife.comFastDomain Inc.28 Nov 201828 Nov 201828 Nov 2019
117anecdotesofmotherhood.comGoDaddy.com, LLC13 Dec 201813 Dec 201813 Dec 2019
118anecdotesforlife.comNetwork Solutions, LLC3 Jan 20193 Jan 20193 Jan 2020
119anecdotesautomobiles.comOVH sas17 Jan 201917 Jan 201917 Jan 2020
120anecdotesbook.comTucows Domains Inc.2 May 20196 May 20212 May 2021
121anecdotesaboutyou.comGoDaddy.com, LLC7 Jun 20197 Jun 20197 Jun 2020
122anecdotespodcast.comGoDaddy.com, LLC2 Nov 202017 Nov 20242 Nov 2025
123anecdoteskincare.comFastDomain Inc.4 Sep 20194 Sep 20194 Sep 2020
124anecdotestodoteon.comeNom, Inc.5 Sep 201918 Oct 20245 Sep 2024
125anecdotescents.comGoDaddy.com, LLC5 Sep 20196 Sep 20255 Sep 2026
126anecdotesewing.comAutomattic Inc.7 Oct 20197 Oct 20197 Oct 2020
127anecdotesforyou.comWix.com Ltd.17 Oct 201917 Oct 201917 Oct 2020
128anecdotesofexplorers.comGoDaddy.com, LLC17 Oct 201928 Nov 202117 Oct 2022
129anecdotesbyashi.comAutomattic Inc.13 Dec 201913 Dec 201913 Dec 2020
130anecdotesofahlulbayt.comGoDaddy.com, LLC30 Mar 20201 Mar 202530 Mar 2027
131anecdotestudio.comWix.com Ltd.1 Jun 202426 Aug 20251 Jun 2027
132anecdotesofmomlife.comAutomattic Inc.5 May 202023 Nov 20255 May 2026
133anecdotesandepisodes.comFastDomain Inc.21 May 202021 May 202021 May 2021
134anecdotesocial.comLaunchpad, Inc.19 Jun 20204 Jun 202519 Jun 2026
135anecdotesbareblues.comGoDaddy.com, LLC27 Jun 202027 Jun 202027 Jun 2021
136anecdotesoffashion.comTucows Domains Inc.9 Jul 202019 Sep 20239 Jul 2023
137anecdotes107.comGoDaddy.com, LLC4 Aug 20205 Sep 20254 Aug 2026
138anecdotesofficial.comTucows Domains Inc.24 Aug 202028 Aug 202224 Aug 2023
139anecdotesalon.comGoDaddy.com, LLC6 Sep 202018 Nov 20236 Sep 2023
140anecdotesite.comName.com, Inc.22 Sep 202022 Sep 202022 Sep 2021
141anecdotesway.comGoDaddy.com, LLC25 Sep 202025 Sep 202025 Sep 2021
142anecdotesandverses.comAutomattic Inc.2 Nov 20202 Nov 20202 Nov 2021
143anecdotes-and-itineraries.comFastDomain Inc.3 Jan 20213 Jan 20213 Jan 2022
144anecdotesenior.guruPorkbun, LLC8 Jan 20218 Jan 20218 Jan 2022
145anecdotesofages.comGoogle, Inc.14 Jan 202114 Jan 202114 Jan 2022
146anecdotesales.comDynadot, LLC9 Feb 20219 Feb 20219 Feb 2022
147anecdotescine.comHostinger, UAB18 Apr 202126 Apr 202518 Apr 2026
148anecdotesph.comGoogle, Inc.18 Apr 202118 Apr 202118 Apr 2022
149anecdotesandaphorisms.comLaunchpad, Inc.5 May 20215 May 20215 May 2022
150anecdotesandart.comGoogle, Inc.30 Oct 202115 Oct 202530 Oct 2026
151anecdotestories.comeNom, Inc.19 Nov 202114 Nov 202519 Nov 2026
152anecdotesofaish.comGoDaddy.com, LLC6 Dec 20217 Dec 20216 Dec 2022
153anecdotesx.xyzGoDaddy.com, LLC15 Jan 202227 Mar 202415 Jan 2024
154anecdotes-about-me.comNetowl, Inc.18 May 202219 May 202518 May 2025
155anecdotes-labs.comGoogle, Inc.17 May 20222 May 202517 May 2026
156anecdotesforawkwardfolks.comSquarespace Domains LLC8 Aug 202224 Jul 20258 Aug 2026
157anecdotesfromanalien.comFastDomain Inc.8 Aug 20229 Sep 20238 Aug 2023
158anecdotestravel.comGoDaddy.com, LLC16 Aug 202218 Jul 202516 Aug 2026
159anecdotesofmylife.comHosting Concepts B.V. dba Openprovider5 Sep 202215 Nov 20235 Sep 2023
160anecdoteswithao.comGoDaddy.com, LLC11 Dec 202222 Jan 202511 Dec 2024
161anecdoteschannel.comNameCheap, Inc.25 Dec 20225 Feb 202425 Dec 2023
162anecdotesavvy.comNameCheap, Inc.31 Dec 202213 Mar 202431 Dec 2023
163anecdotesamongus.comNameCheap, Inc.31 Dec 202213 Mar 202431 Dec 2023
164anecdotesmovie.comCosmotown, Inc.15 Jan 202326 Mar 202415 Jan 2024
165anecdotesmorristown.comGoogle, Inc.17 Jan 202317 Jan 202317 Jan 2024
166anecdotesofamadwoman.blog-18 Sep 202530 Nov 202518 Sep 2026
167anecdotespeak.comNameCheap, Inc.1 Feb 20232 Feb 20241 Feb 2025
168anecdotesofanaddict.comGoDaddy.com, LLC23 Jan 20184 Feb 202423 Jan 2025
169anecdotesandavocados.comWix.com Ltd.8 Apr 202010 Mar 20258 Apr 2026
170anecdotesofrn.comWix.com Ltd.13 Jan 20211 Feb 202413 Jan 2027
171anecdotesofacaregiver.comGoDaddy.com, LLC2 Apr 202114 May 20242 Apr 2024
172anecdotes74.comInfomaniak Network SA9 Dec 202125 Nov 20259 Dec 2026
173anecdotesmatter.comGoDaddy.com, LLC9 May 202210 May 20249 May 2026
174anecdotesquotations.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Jul 202213 Aug 20236 Jul 2023
175anecdotesfromhell.netSquarespace Domains LLC29 Aug 202120 Aug 202529 Aug 2026
176anecdotesandoils.onlineCrazy Domains FZ-LLC5 Jun 20205 Jun 20235 Jun 2024
177anecdotesandart.orgGoogle, Inc.30 Oct 202120 Oct 202530 Oct 2026
178anecdotesanimations.comKey-Systems GmbH2 May 202327 Nov 20252 May 2026
179anecdotest.com.de--10 Nov 2023-
180anecdotesai.comDROPCATCH.COM 812 LLC17 Nov 202517 Nov 202517 Nov 2026
181anecdotessf.comAmazon Registrar, Inc.7 Sep 202313 Jan 20267 Sep 2026
182anecdotesofagirl.comNetwork Solutions, LLC3 Oct 202318 Sep 20253 Oct 2026
183anecdotesstar.comNameCheap, Inc.4 Oct 202316 Dec 20254 Oct 2025
184anecdotesoftheages.comGoDaddy.com, LLC8 Oct 20238 Oct 20238 Oct 2026
185anecdotestothemind.comWix.com Ltd.28 Oct 202328 Sep 202528 Oct 2027
186anecdotesoftware.comSquarespace Domains LLC1 Dec 202312 Feb 20261 Dec 2025
187anecdotesoftwares.comSquarespace Domains LLC1 Dec 202312 Feb 20261 Dec 2025
188anecdotesystems.comSquarespace Domains LLC1 Dec 202312 Feb 20261 Dec 2025
189anecdotesofahyperlyselfawaremiddleclasshuman.comGoDaddy.com, LLC26 Dec 202327 Dec 202526 Dec 2026
190anecdotescan.shopNameCheap, Inc.11 Jan 20249 Feb 202411 Jan 2025
191anecdotesx.comNamesilo, LLC26 Jan 20248 Jan 202626 Jan 2027
192anecdotesexperiences.comGoDaddy.com, LLC16 Apr 20247 Apr 202516 Apr 2026
193anecdotesswifty.comNameCheap, Inc.24 Apr 20245 Jun 202524 Apr 2025
194anecdotescollective.comGoDaddy.com, LLC24 May 202424 May 202424 May 2027
195anecdoteskin.comGoDaddy.com, LLC3 Jun 20246 Jun 20253 Jun 2026
196anecdotescount.comCloudFlare, Inc.9 Jun 202414 Jun 20249 Jun 2029
197anecdotes-test.comCloudFlare, Inc.17 Jun 202427 Jul 202517 Jun 2025
198anecdotes-trust.comAmazon Registrar, Inc.18 Jun 202418 Jun 202418 Jun 2025
199anecdotesolutions.infoGoDaddy.com, LLC12 Jul 202417 Jul 202512 Jul 2026
200anecdotesolutions.siteGoDaddy.com, LLC12 Jul 202417 Jul 202512 Jul 2026
201anecdotesolutions.techGoDaddy.com, LLC12 Jul 202417 Jul 202512 Jul 2026
202anecdotes-integ.comAmazon Registrar, Inc.14 Jul 20246 May 202514 Jul 2025
203anecdotesonline.comAutomattic Inc.20 Jul 202423 Nov 202520 Jul 2026
204anecdotesandscribblednotes.blogAutomattic Inc.25 Aug 202420 Nov 202525 Aug 2026
205anecdotesandantidotes.comWix.com Ltd.28 Aug 202428 Aug 202428 Aug 2026
206anecdotesexperts.comGoDaddy.com, LLC4 Nov 20245 Nov 20254 Nov 2026
207anecdotesandagendas.comSquarespace Domains LLC15 Nov 202415 Nov 202415 Nov 2025
208anecdotesdata.comNameCheap, Inc.19 Nov 202416 Nov 202519 Nov 2026
209anecdoteshealth.comSquarespace Domains LLC9 Dec 202420 Jan 20269 Dec 2025
210anecdotesbyartists.comGoDaddy.com, LLC13 Dec 202428 Jan 202613 Dec 2026
211anecdotesvault.comNameCheap, Inc.11 Jan 202512 Jan 202611 Jan 2027
212anecdotesbohemian.comNameCheap, Inc.18 Feb 202518 Feb 202518 Feb 2026
213anecdotesdresser.comNameCheap, Inc.21 Mar 202521 Mar 202521 Mar 2026
214anecdotesharbor.comNameCheap, Inc.24 Mar 202524 Mar 202524 Mar 2026
215anecdotessaturn.comNameCheap, Inc.24 Mar 202524 Mar 202524 Mar 2026
216anecdotesamber.comNameCheap, Inc.26 Mar 202527 Mar 202526 Mar 2026
217anecdotesar.comHostinger, UAB19 Apr 202519 Apr 202519 Apr 2026
218anecdotescollection.comKey-Systems GmbH16 May 202527 Nov 202516 May 2026
219anecdotestrust-integ.comAmazon Registrar, Inc.18 May 202518 May 202518 May 2026
220anecdotesf.comPorkbun, LLC30 Jun 202530 Jun 202530 Jun 2026
221anecdoteservice.comNameCheap, Inc.9 Jul 20259 Jul 20259 Jul 2026
222anecdotesconamor.comNameCheap, Inc.29 Jul 202529 Jul 202529 Jul 2026
223anecdotesandquotes.comSquarespace Domains LLC1 Aug 20251 Aug 20251 Aug 2026
224anecdotesg.comGoogle, Inc.4 Aug 20254 Aug 20254 Aug 2026
225anecdotesandtea.comCloudFlare, Inc.19 Aug 202526 Aug 202519 Aug 2026
226anecdotes-and-antidotes.comSquarespace Domains LLC7 Sep 202528 Sep 20257 Sep 2026
227anecdotesfromtheheart.comDreamHost, LLC11 Oct 202511 Oct 202511 Oct 2026
228anecdotesbyash.storeTucows Domains Inc.24 Oct 202510 Nov 202524 Oct 2026
229anecdotesbyash.comTucows Domains Inc.24 Oct 202524 Oct 202524 Oct 2026
230anecdotesstarryheart.comNameCheap, Inc.7 Nov 20257 Nov 20257 Nov 2026
231anecdotescallowness.inkNameCheap, Inc.5 Jan 20265 Jan 20265 Jan 2027
232anecdotesinternal.comName.com, Inc.21 Jan 202621 Jan 202621 Jan 2027
233anecdotes-ai.comCloudFlare, Inc.26 Jan 202626 Jan 202626 Jan 2027
234anecdotesgrc.comCloudFlare, Inc.26 Jan 202626 Jan 202626 Jan 2027

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=anecdotes

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now