With support for 
Keyword: ALLENS
Reverse Whois » KEYWORD [allens ] { 5,638 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | allens.com.au | - | - | 27 Sep 2023 | - |
| 2 | allens.rentals | Melbourne IT, Ltd | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 3 | allens.properties | Melbourne IT, Ltd | 13 Feb 2015 | 17 Jan 2017 | 13 Feb 2018 |
| 4 | allens.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 5 | allens.news | Gandi SAS | 14 Aug 2015 | 16 Jul 2023 | 14 Aug 2024 |
| 6 | allens.asia | Tucows Domains Inc. | 20 Oct 2016 | 5 Nov 2017 | 20 Oct 2018 |
| 7 | allens.club | eNom, Inc. | 23 Jun 2019 | 27 May 2023 | 23 Jun 2024 |
| 8 | allens.link | Alpnames Limited | 3 Mar 2016 | 13 Apr 2017 | 3 Mar 2017 |
| 9 | allens.online | Tucows Domains Inc. | 7 Mar 2016 | 23 Apr 2024 | 7 Mar 2025 |
| 10 | allens.com | Tucows Domains Inc. | 5 Dec 1996 | 18 Aug 2023 | 2 Sep 2024 |
| 11 | allens.ie | - | 9 Jul 2007 | 19 Aug 2023 | 10 Jul 2024 |
| 12 | allens.florist | GoDaddy.com, LLC | 6 Apr 2014 | 12 Apr 2024 | 6 Apr 2026 |
| 13 | allens.email | NameCheap, Inc. | 10 Jun 2021 | 10 Jun 2021 | 10 Jun 2022 |
| 14 | allens.london | Uniregistrar Corp | 25 Aug 2014 | 16 Apr 2024 | 25 Aug 2024 |
| 15 | allens.net | GoDaddy.com, LLC | 12 Jan 1998 | 2 Jul 2023 | 2 Jul 2024 |
| 16 | allens.org | Google, Inc. | 9 Jul 2001 | 22 Feb 2024 | 9 Jul 2026 |
| 17 | allens.info | Network Solutions, LLC | 26 Oct 2001 | 27 Aug 2020 | 26 Oct 2025 |
| 18 | allens.mobi | Mesh Digital Limited | 28 Apr 2014 | 21 Apr 2016 | 28 Apr 2018 |
| 19 | allens.us | GoDaddy.com, LLC | 22 Sep 2009 | 27 Sep 2023 | 21 Sep 2024 |
| 20 | allens.xyz | Dynadot, LLC | 28 Nov 2023 | 3 Jan 2024 | 28 Nov 2024 |
| 21 | allens.ca | Webnames.ca Inc. | 21 Feb 2001 | 18 Apr 2024 | 21 Feb 2025 |
| 22 | allens.place | Google, Inc. | 19 May 2023 | 19 May 2024 | 19 May 2025 |
| 23 | allens.site | Network Solutions, LLC | 3 Oct 2018 | 3 Oct 2018 | 3 Oct 2019 |
| 24 | allens.family | Google, Inc. | 20 Jul 2020 | 6 Jun 2024 | 20 Jul 2024 |
| 25 | allens.coffee | GoDaddy.com, LLC | 26 Apr 2017 | 29 Sep 2017 | 26 Apr 2018 |
| 26 | allens.studio | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Jun 2017 | 9 Oct 2017 | 19 Jun 2018 |
| 27 | allens.live | eNom, Inc. | 29 Oct 2017 | 30 Oct 2017 | 29 Oct 2018 |
| 28 | allens.co.uk | - | 8 Sep 1997 | 27 Jul 2023 | 8 Sep 2024 |
| 29 | allens.me.uk | - | 2 Sep 2002 | 1 Sep 2022 | 2 Sep 2024 |
| 30 | allens.support | Tucows Domains Inc. | 17 Jan 2018 | 21 Jan 2019 | 17 Jan 2020 |
| 31 | allens.photo | Network Solutions, LLC | 18 Jul 2018 | 18 Jul 2018 | 18 Jul 2019 |
| 32 | allens.dev | Google, Inc. | 5 Mar 2019 | 19 Apr 2024 | 5 Mar 2025 |
| 33 | allens.wtf | 1API GmbH | 16 Oct 2019 | 30 Nov 2023 | 16 Oct 2024 |
| 34 | allens.co | Network Solutions, LLC | 6 Oct 2019 | 11 Oct 2019 | 6 Oct 2020 |
| 35 | allens.team | Name.com, Inc. | 7 May 2020 | 7 May 2020 | 7 May 2021 |
| 36 | allens.world | 1&1 Internet AG | 20 Jul 2020 | 18 Nov 2022 | 20 Jul 2024 |
| 37 | allens.icu | Dynadot, LLC | 23 Jun 2022 | 2 Sep 2023 | 23 Jun 2023 |
| 38 | allens.realty | Epik Inc. | 28 Sep 2020 | 14 Nov 2021 | 28 Sep 2022 |
| 39 | allens.tools | Name.com, Inc. | 18 May 2021 | 18 May 2021 | 18 May 2022 |
| 40 | allens.life | GoDaddy.com, LLC | 2 Jul 2021 | 16 Aug 2023 | 2 Jul 2024 |
| 41 | allens.cleaning | register.com, Inc. | 1 Sep 2021 | 1 Sep 2021 | 1 Sep 2022 |
| 42 | allens.furniture | register.com, Inc. | 24 Sep 2021 | 24 Sep 2021 | 24 Sep 2022 |
| 43 | allens.biz | Moniker Online Services LLC | 4 Oct 2012 | 8 Oct 2021 | 3 Oct 2021 |
| 44 | allens.pro | GoDaddy.com, LLC | 3 Dec 2021 | 28 Jul 2023 | 3 Dec 2031 |
| 45 | allens.fitness | Automattic Inc. | 26 Feb 2022 | 11 Feb 2024 | 26 Feb 2025 |
| 46 | allens.one | GoDaddy.com, LLC | 6 Nov 2022 | 18 Dec 2023 | 6 Nov 2023 |
| 47 | allens.space | Hostinger, UAB | 13 Nov 2022 | 13 Nov 2022 | 13 Nov 2023 |
| 48 | allens.xxx | Webnames.ca Inc. | 6 Dec 2011 | 2 May 2024 | 6 Dec 2025 |
| 49 | allens.best | NameCheap, Inc. | 28 Mar 2022 | 12 Apr 2023 | 28 Mar 2024 |
| 50 | allens.autos | Dynadot, LLC | 24 Mar 2022 | 25 Mar 2023 | 24 Mar 2024 |
| 51 | allens.band | NameCheap, Inc. | 23 Feb 2022 | 5 May 2024 | 23 Feb 2024 |
| 52 | allens.blog | GoDaddy.com, LLC | 21 Nov 2016 | 7 Jun 2024 | 21 Nov 2024 |
| 53 | allens.cafe | 1API GmbH | 16 Oct 2019 | 30 Nov 2023 | 16 Oct 2024 |
| 54 | allens.camera | Network Solutions, LLC | 13 Aug 2022 | 25 Sep 2023 | 13 Aug 2023 |
| 55 | allens.cloud | 1&1 Internet AG | 5 Apr 2023 | 5 Apr 2024 | 5 Apr 2025 |
| 56 | allens.it | - | 22 Apr 2012 | 4 May 2024 | 22 Apr 2024 |
| 57 | allens.lawyer | GoDaddy.com, LLC | 29 Jun 2019 | 13 Aug 2023 | 29 Jun 2024 |
| 58 | allens.law | GoDaddy.com, LLC | 29 Jun 2019 | 6 Jul 2023 | 29 Jun 2024 |
| 59 | allens.nyc | GoDaddy.com, LLC | 24 Apr 2022 | 25 Apr 2024 | 24 Apr 2025 |
| 60 | allens.page | Google, Inc. | 19 Jan 2020 | 4 Mar 2024 | 19 Jan 2025 |
| 61 | allens.uk | - | 1 Jul 2019 | 30 Jan 2024 | 1 Jul 2025 |
| 62 | allens.store | Hostinger, UAB | 15 Jul 2023 | 14 Sep 2023 | 15 Jul 2024 |
| 63 | allens.top | DNSPod, Inc. | 13 Aug 2023 | - | 13 Aug 2033 |
| 64 | allens.cc | Porkbun, LLC | 4 Oct 2023 | 4 Oct 2023 | 4 Oct 2024 |
| 65 | allens.cx | - | 4 Oct 2023 | 9 Oct 2023 | 4 Oct 2024 |
| 66 | allens.money | GoDaddy.com, LLC | 25 Oct 2023 | 30 Oct 2023 | 25 Oct 2024 |
| 67 | allens.today | Name.com, Inc. | 28 Nov 2023 | 15 Mar 2024 | 28 Nov 2024 |
| 68 | allens.services | Name.com, Inc. | 28 Nov 2023 | 18 Apr 2024 | 28 Nov 2024 |
| 69 | allens.uk.com | Webfusion Ltd. | 25 Nov 2010 | 17 Apr 2024 | 25 Nov 2025 |
| 70 | allens.ai | - | - | - | - |
| 71 | allens.nl | - | 23 Jan 2022 | 5 Jul 2023 | - |
| 72 | allens.au | - | - | 18 Aug 2023 | - |
| 73 | allens.me | NameCheap, Inc. | 29 Apr 2011 | 29 Apr 2024 | 29 Apr 2025 |
| 74 | allens.ru | - | 9 Jul 2019 | - | 9 Jul 2024 |
| 75 | allens.eu | - | - | - | - |
| 76 | allensboots.com | GoDaddy.com, LLC | 16 Aug 1999 | 6 Jun 2024 | 16 Aug 2033 |
| 77 | allenschool.edu | - | 5 May 2003 | 5 Jul 2017 | 31 Jul 2018 |
| 78 | allensinc.com | Network Solutions, LLC | 10 Sep 1997 | 2 May 2019 | 9 Sep 2025 |
| 79 | allensolly.com | Amazon Registrar, Inc. | 6 Jan 1997 | 9 Jan 2023 | 5 Jan 2031 |
| 80 | allensapp.com | Tucows Domains Inc. | 28 Feb 1999 | 30 Jan 2024 | 28 Feb 2025 |
| 81 | allensofmayfair.co.uk | - | 18 Jul 2018 | 10 Feb 2022 | 18 Jul 2024 |
| 82 | allensamuels.com | Domain.com, LLC | 10 Oct 1996 | 24 Sep 2023 | 9 Oct 2024 |
| 83 | allensflowers.com | Network Solutions, LLC | 13 Feb 2000 | 5 Feb 2018 | 13 Feb 2027 |
| 84 | allenslifestyle.com | Net-Chinese Co., Ltd. | 24 May 2013 | 23 Feb 2023 | 24 May 2024 |
| 85 | allensmusiccentre.co.uk | - | 28 Feb 2000 | 20 Feb 2024 | 28 Feb 2025 |
| 86 | allensportsusa.com | GoDaddy.com, LLC | 21 Feb 2007 | 10 Sep 2022 | 21 Feb 2030 |
| 87 | allenslife.com | Tucows Domains Inc. | 18 Sep 2014 | 22 Sep 2019 | 18 Sep 2019 |
| 88 | allenscartoons.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 89 | allenstone.com | FastDomain Inc. | 15 Feb 2011 | 1 Mar 2024 | 15 Feb 2025 |
| 90 | allensrv.com | GoDaddy.com, LLC | 24 Oct 2014 | 25 Oct 2022 | 24 Oct 2024 |
| 91 | allensswimwear.co.uk | - | 12 Apr 2000 | 2 Feb 2024 | 12 Apr 2025 |
| 92 | allensias.com | GoDaddy.com, LLC | 25 May 2010 | 26 May 2015 | 25 May 2016 |
| 93 | allensautosalvage.com | Google, Inc. | 13 Nov 2019 | 13 Nov 2019 | 13 Nov 2020 |
| 94 | allens-a-team.com | HiChina Zhicheng Technology Limited | 11 Nov 2018 | 11 Nov 2018 | 11 Nov 2019 |
| 95 | allensmarket.com | TurnCommerce, Inc. DBA NameBright.com | 18 Aug 2015 | 12 Aug 2020 | 18 Aug 2024 |
| 96 | allenswellness.com | Above.com Pty Ltd. | 11 Oct 2018 | 17 Oct 2023 | 11 Oct 2024 |
| 97 | allensusedcar.com | GoDaddy.com, LLC | 26 Oct 2014 | 27 Oct 2023 | 26 Oct 2024 |
| 98 | allensusedautos.com | GoDaddy.com, LLC | 26 Oct 2014 | 27 Oct 2023 | 26 Oct 2024 |
| 99 | allensubseaconsulting.com | Tucows Domains Inc. | 23 Oct 2011 | 27 Oct 2014 | 23 Oct 2015 |
| 100 | allenstaxidermy.com | InsaneNames LLC | 26 Oct 2014 | 27 Oct 2017 | 26 Oct 2018 |
| 101 | allenskin.com | GoDaddy.com, LLC | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 102 | allensabet.com | NameCheap, Inc. | 27 Oct 2014 | 27 Sep 2023 | 27 Oct 2024 |
| 103 | allenstines.com | GoDaddy.com, LLC | 21 May 2014 | 22 May 2015 | 21 May 2016 |
| 104 | allensecurity.com | GoDaddy.com, LLC | 20 Apr 1999 | 31 Mar 2024 | 20 Apr 2025 |
| 105 | allens-cruz.com | GoDaddy.com, LLC | 27 Oct 2014 | 28 Oct 2016 | 27 Oct 2017 |
| 106 | allensusedcars.us | GoDaddy.com, LLC | 11 Feb 2020 | 17 Feb 2024 | 11 Feb 2026 |
| 107 | allensgeeks.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 108 | allensclassiccars.com | DropCatch.com 421 LLC | 28 Oct 2014 | 29 Oct 2017 | 28 Oct 2018 |
| 109 | allenspark.co | GoDaddy.com, LLC | 20 Jul 2010 | 29 Jun 2017 | 19 Jul 2018 |
| 110 | allenseo.info | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 111 | allensorganics.com | GoDaddy.com, LLC | 10 Sep 2018 | 10 Sep 2018 | 10 Sep 2019 |
| 112 | allensmichel.com | Internet Invest, Ltd. dba Imena.ua | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 113 | allensconstruction1989.com | register.com, Inc. | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 114 | allensbuprojects.com | eNom, Inc. | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 115 | allenstree-service.com | Name.com, Inc. | 28 Oct 2013 | 30 Oct 2014 | 28 Oct 2015 |
| 116 | allenscaddofishing.com | GoDaddy.com, LLC | 30 Oct 2014 | 31 Aug 2015 | 30 Oct 2017 |
| 117 | allensportsmassage.com | GoDaddy.com, LLC | 23 Jun 2011 | 2 Jun 2023 | 23 Jun 2024 |
| 118 | allensupply.com | GoDaddy.com, LLC | 8 Mar 2005 | 11 Mar 2024 | 8 Mar 2025 |
| 119 | allensanders.com | GoDaddy.com, LLC | 2 Nov 2007 | 7 Nov 2023 | 2 Nov 2025 |
| 120 | allensphotoblog.com | Above.com Pty Ltd. | 2 Apr 2020 | 17 May 2022 | 2 Apr 2025 |
| 121 | allensmills.com | GoDaddy.com, LLC | 26 Apr 2008 | 1 Apr 2024 | 26 Apr 2025 |
| 122 | allensamuelschevroletwaco.com | Network Solutions, LLC | 14 Jun 2002 | 27 Jul 2020 | 14 Jun 2020 |
| 123 | allenscartersvilleflorist.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Feb 2005 | 28 Feb 2024 | 24 Feb 2025 |
| 124 | allensflowersboutique.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Nov 2004 | 9 Feb 2024 | 2 Nov 2024 |
| 125 | allenshop.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Oct 2006 | 13 Dec 2023 | 11 Oct 2024 |
| 126 | allensid.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2006 | 21 Feb 2024 | 9 Sep 2024 |
| 127 | allensportwear.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jun 2007 | 11 May 2017 | 6 Jun 2018 |
| 128 | allenspeaks.com | GoDaddy.com, LLC | 30 Apr 2001 | 16 Nov 2023 | 16 Nov 2024 |
| 129 | allensangels.com | pair Networks, Inc. d/b/a pairNIC | 9 Feb 2012 | 5 Feb 2015 | 9 Feb 2016 |
| 130 | allensykeswm.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 31 Oct 2014 | 25 Oct 2016 | 31 Oct 2018 |
| 131 | allensykeswealthmanagement.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 31 Oct 2014 | 25 Oct 2016 | 31 Oct 2018 |
| 132 | allensperformance.com | eNom, Inc. | 5 Jun 2001 | 7 May 2023 | 5 Jun 2024 |
| 133 | allensfoodmarket.com | GoDaddy.com, LLC | 20 Jan 2009 | 2 Mar 2024 | 20 Jan 2025 |
| 134 | allensprinklerrepair.com | GoDaddy.com, LLC | 13 Apr 2010 | 11 Feb 2024 | 13 Apr 2025 |
| 135 | allensflowers.org | GoDaddy.com, LLC | 25 May 2014 | 26 May 2024 | 25 May 2025 |
| 136 | allensamuelshyundaifortworth.com | Network Solutions, LLC | 5 Jul 2007 | 1 Jul 2019 | 5 Jul 2020 |
| 137 | allensparkcommunitychurch.org | Tucows Domains Inc. | 29 Jun 2011 | 5 Jun 2023 | 29 Jun 2024 |
| 138 | allensgreatercommercialcleaning.com | register.com, Inc. | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2015 |
| 139 | allenscommunitytheatre.net | GoDaddy.com, LLC | 6 Apr 2012 | 7 Apr 2024 | 6 Apr 2025 |
| 140 | allensflowers.biz | GoDaddy.com, LLC | 25 May 2014 | 25 May 2024 | 24 May 2025 |
| 141 | allensteachingfiles.com | eNom, Inc. | 5 Aug 2019 | 16 Jun 2023 | 5 Aug 2024 |
| 142 | allenscoin.com | - | - | - | - |
| 143 | allenskayaker.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Jun 2015 | 27 Jun 2015 | 27 Jun 2016 |
| 144 | allensports.org | GoDaddy.com, LLC | 3 Dec 1999 | 17 Jan 2024 | 3 Dec 2024 |
| 145 | allensretail.com | NameCheap, Inc. | 19 Mar 2006 | 27 Apr 2024 | 19 Mar 2025 |
| 146 | allensunloans.com | GoDaddy.com, LLC | 6 Jun 2012 | 18 Jun 2015 | 6 Jun 2016 |
| 147 | allensparklodgebnb.com | FastDomain Inc. | 9 May 2014 | 24 Apr 2024 | 9 May 2025 |
| 148 | allenshop232.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Nov 2014 | 2 Nov 2014 | 2 Nov 2015 |
| 149 | allensarlo.com | Xiamen ChinaSource Internet Service Co., Ltd. | 8 Sep 2022 | 9 Sep 2023 | 8 Sep 2024 |
| 150 | allensguide.com | GoDaddy.com, LLC | 20 Mar 2002 | 21 Mar 2024 | 20 Mar 2025 |
| 151 | allenstexasboots.com | GoDaddy.com, LLC | 16 Mar 2009 | 17 Mar 2024 | 16 Mar 2025 |
| 152 | allensamuel.com | GoDaddy.com, LLC | 19 May 2020 | 20 May 2024 | 19 May 2025 |
| 153 | allensworthentertainment.com | Key-Systems GmbH | 30 Sep 2021 | 27 Dec 2022 | 30 Sep 2024 |
| 154 | allensflowers.info | GoDaddy.com, LLC | 25 May 2014 | 26 May 2024 | 25 May 2025 |
| 155 | allenslane.org | GoDaddy.com, LLC | 1 Aug 1999 | 15 Sep 2023 | 1 Aug 2024 |
| 156 | allensauto.com | GoDaddy.com, LLC | 22 Jul 1997 | 1 Jul 2023 | 21 Jul 2024 |
| 157 | allensdepartmentstore.com | Global Domain Name Trading Center Ltd | 25 Oct 2023 | 25 Oct 2023 | 25 Oct 2024 |
| 158 | allenstreeservice.com | Tucows Domains Inc. | 29 Aug 2001 | 20 Feb 2023 | 29 Aug 2025 |
| 159 | allensignstudio.com | Network Solutions, LLC | 7 Sep 2000 | 4 Aug 2022 | 7 Sep 2025 |
| 160 | allensponyexpress.com | GoDaddy.com, LLC | 5 Jul 1999 | 1 Nov 2022 | 5 Jul 2024 |
| 161 | allensautoyl.com | GoDaddy.com, LLC | 29 May 2014 | 10 Jun 2023 | 29 May 2024 |
| 162 | allenstables.com | Tucows Domains Inc. | 26 Mar 2014 | 25 Mar 2024 | 26 Mar 2025 |
| 163 | allensamuelschevroletcorpus.com | GMO Internet Inc. | 9 Oct 2022 | 15 Mar 2024 | 9 Oct 2024 |
| 164 | allensfoundation.com | Namesilo, LLC | 5 Aug 2010 | 17 May 2024 | 5 Aug 2024 |
| 165 | allensplrcodes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2016 |
| 166 | allensbankprimary.com | GoDaddy.com, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 167 | allensmith.net | easyDNS Technologies, Inc. | 19 Jul 1999 | 4 Jul 2023 | 19 Jul 2024 |
| 168 | allensamuelsdodgekaty.com | Dynadot6 LLC | 17 Mar 2021 | 2 Aug 2023 | 17 Mar 2025 |
| 169 | allenswelldrilling.com | Tucows Domains Inc. | 8 Jun 2004 | 24 May 2024 | 8 Jun 2025 |
| 170 | allensflowers.net | GoDaddy.com, LLC | 25 May 2014 | 26 May 2024 | 25 May 2025 |
| 171 | allenswoodworking.com | GoDaddy.com, LLC | 27 Jun 2013 | 28 Jun 2023 | 27 Jun 2024 |
| 172 | allensamuelsfortworth.com | Chengdu West Dimension Digital Technology Co., Ltd… | 21 Feb 2024 | 21 Feb 2024 | 21 Feb 2025 |
| 173 | allenslandscapesupplydepot.ca | - | - | - | - |
| 174 | allensummerhillfuneralhomes.com | - | - | - | - |
| 175 | allenschreibermd.com | Wild West Domains, LLC | 5 Jun 2011 | 31 May 2024 | 5 Jun 2025 |
| 176 | allensamuelstyler.com | Beijing Lanhai Jiye Technology Co., Ltd | 2 Apr 2021 | 28 Feb 2024 | 2 Apr 2025 |
| 177 | allensamuelsalliance.com | Uniregistrar Corp | 25 Aug 2020 | 26 Aug 2023 | 25 Aug 2024 |
| 178 | allensdrugs.com | EunamesOregon.com LLC | 18 Nov 2019 | 19 Nov 2019 | 18 Nov 2020 |
| 179 | allensgreen.net | GoDaddy.com, LLC | 15 Jun 2009 | 15 Jun 2015 | 15 Jun 2016 |
| 180 | allenswood.com | TurnCommerce, Inc. DBA NameBright.com | 8 Sep 2015 | 2 Sep 2020 | 8 Sep 2024 |
| 181 | allenscustomdecorating.com | GoDaddy.com, LLC | 16 Jun 2009 | 17 Jun 2015 | 16 Jun 2016 |
| 182 | allensportsclub.com | GoDaddy.com, LLC | 5 Nov 2014 | 6 Nov 2023 | 5 Nov 2026 |
| 183 | allensirizi.com | GoDaddy.com, LLC | 5 Nov 2014 | 6 Nov 2023 | 5 Nov 2024 |
| 184 | allenselectricalservice.com | Wix.com Ltd. | 11 Jul 2019 | 11 Jul 2019 | 11 Jul 2020 |
| 185 | allenstux.com | GMO Internet Inc. | 7 Aug 2023 | 8 Sep 2023 | 7 Aug 2024 |
| 186 | allenserviceinc.com | DropCatch.com 1515 LLC | 8 Nov 2019 | 15 Jan 2020 | 8 Nov 2024 |
| 187 | allensketch.com | Tucows Domains Inc. | 17 Aug 2013 | 20 Aug 2014 | 17 Aug 2015 |
| 188 | allensoddsandends.com | Tucows Domains Inc. | 17 Aug 2010 | 20 Aug 2014 | 17 Aug 2015 |
| 189 | allensurgicalassociates.com | Tucows Domains Inc. | 17 Aug 2010 | 21 Aug 2014 | 17 Aug 2015 |
| 190 | allenscorner.com | Google, Inc. | 1 Mar 2022 | 23 Apr 2024 | 1 Mar 2025 |
| 191 | allenseo.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Sep 2023 | 27 Sep 2023 | 27 Sep 2024 |
| 192 | allensservices.net | register.com, Inc. | 21 Nov 2012 | 11 Nov 2015 | 21 Nov 2017 |
| 193 | allenstanley.com | GoDaddy.com, LLC | 15 Jul 2016 | 22 Sep 2022 | 15 Jul 2024 |
| 194 | allenshofe.info | Tucows Domains Inc. | 22 Aug 2014 | 26 Aug 2023 | 22 Aug 2024 |
| 195 | allenslawnandlandscaping.com | NameCheap, Inc. | 18 Apr 2022 | 19 Mar 2024 | 18 Apr 2025 |
| 196 | allenstownautomotive.com | eNom, Inc. | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 197 | allensharriff.com | Google, Inc. | 13 Mar 2019 | 13 Mar 2019 | 13 Mar 2020 |
| 198 | allensescapes.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 199 | allensautorecycling.com | Wild West Domains, LLC | 6 Nov 2014 | 7 Nov 2016 | 6 Nov 2017 |
| 200 | allensirizi.net | GoDaddy.com, LLC | 5 Nov 2014 | 6 Nov 2023 | 5 Nov 2024 |
| 201 | allenstceramics.com | GoDaddy.com, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 202 | allensinstruments.com | GoDaddy.com, LLC | 23 Aug 2014 | 24 Aug 2016 | 23 Aug 2018 |
| 203 | allensplumbingmn.com | register.com, Inc. | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 204 | allenshomebiz.com | 1&1 Internet AG | 28 Dec 2017 | 28 Dec 2017 | 28 Dec 2018 |
| 205 | allensearch.us | GoDaddy.com, LLC | 12 Aug 2014 | 12 Aug 2014 | 11 Aug 2015 |
| 206 | allensearches.com | GoDaddy.com, LLC | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 207 | allenslocksmithllc.com | Tucows Domains Inc. | 12 Aug 2014 | 16 Aug 2015 | 12 Aug 2016 |
| 208 | allenswellnessnow.com | GoDaddy.com, LLC | 13 Aug 2014 | 24 Aug 2016 | 13 Aug 2017 |
| 209 | allensflowermarketreseda.net | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 210 | allensprintingandmore.com | Tucows Domains Inc. | 24 Aug 2014 | 28 Aug 2015 | 24 Aug 2016 |
| 211 | allensacres.com | HiChina Zhicheng Technology Limited | 13 Nov 2019 | 14 Nov 2019 | 13 Nov 2020 |
| 212 | allensauctioncentre.com | Domain.com, LLC | 25 Aug 2014 | 5 Jul 2021 | 25 Aug 2024 |
| 213 | allensdesigns.com | 1&1 Internet AG | 25 Aug 2014 | 26 Aug 2014 | 25 Aug 2015 |
| 214 | allenstore.com | Dynadot, LLC | 13 Mar 2019 | 5 Jan 2024 | 13 Mar 2025 |
| 215 | allensearch.info | GoDaddy.com, LLC | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 216 | allensouthernelectricmobileal.com | Tucows Domains Inc. | 12 Aug 2010 | 15 Aug 2014 | 12 Aug 2015 |
| 217 | allensportspub.com | Network Solutions, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 218 | allensteakhouse.com | Network Solutions, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 219 | allenspired.com | GoDaddy.com, LLC | 28 Aug 2014 | 16 Sep 2022 | 28 Aug 2024 |
| 220 | allenstreeserviceva.com | Tucows Domains Inc. | 24 Aug 2011 | 29 Aug 2014 | 24 Aug 2015 |
| 221 | allenstaxi.com | DROPCATCH.COM 843 LLC | 3 Nov 2016 | 4 Nov 2017 | 3 Nov 2018 |
| 222 | allensleadsystem.com | eNom, Inc. | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 223 | allensafari.com | register.com, Inc. | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 224 | allenschoolblackboard.com | Key-Systems GmbH | 18 Aug 2014 | 22 Sep 2017 | 18 Aug 2018 |
| 225 | allenshomedecor.com | register.com, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 226 | allensilk.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 9 Aug 2021 | 9 Aug 2021 | 9 Aug 2022 |
| 227 | allenspiers.com | Tucows Domains Inc. | 8 Sep 2013 | 13 Sep 2014 | 8 Sep 2015 |
| 228 | allenschmitstamps.com | GoDaddy.com, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 229 | allensautoserviceaz.com | Tucows Domains Inc. | 13 Nov 2014 | 17 Nov 2016 | 13 Nov 2016 |
| 230 | allensworldofjunk.com | GoDaddy.com, LLC | 16 Sep 2014 | 17 Sep 2016 | 16 Sep 2017 |
| 231 | allensconcretellc.com | DropCatch.com 401 LLC | 16 Sep 2014 | 17 Sep 2017 | 16 Sep 2018 |
| 232 | allenshen.com | 1API GmbH | 15 Aug 2019 | 26 Dec 2021 | 15 Aug 2024 |
| 233 | allensystemsgroupinc.com | Tucows Domains Inc. | 13 Sep 2013 | 17 Sep 2014 | 13 Sep 2015 |
| 234 | allensellsaz.com | Media Elite Holdings Limited | 27 Nov 2020 | 27 Nov 2020 | 27 Nov 2021 |
| 235 | allenstowingservices.com | NameCheap, Inc. | 7 Dec 2023 | 7 Dec 2023 | 7 Dec 2024 |
| 236 | allenstreetconsulting.com | GoDaddy.com, LLC | 14 Nov 2014 | 26 Oct 2022 | 14 Nov 2024 |
| 237 | allensdesigngroup.com | Namesilo, LLC | 25 Apr 2022 | 25 Apr 2024 | 25 Apr 2025 |
| 238 | allens44.com | Tucows Domains Inc. | 14 Nov 2014 | 18 Nov 2016 | 14 Nov 2016 |
| 239 | allensprimitives.com | eNom, Inc. | 4 Dec 2015 | 4 Dec 2015 | 4 Dec 2017 |
| 240 | allenspestcontrol.net | Tucows Domains Inc. | 10 Nov 2010 | 14 Nov 2014 | 10 Nov 2015 |
| 241 | allensebookworld.com | eNom, Inc. | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 242 | allensexteriorenhamncements.com | Name.com, Inc. | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 243 | allenslps.org | Tucows Domains Inc. | 12 Sep 2007 | 16 Sep 2014 | 12 Sep 2015 |
| 244 | allens-auto.com | Name.com, Inc. | 10 Dec 2017 | 10 Dec 2017 | 10 Dec 2018 |
| 245 | allenseyecare.com | register.com, Inc. | 17 Sep 2014 | 13 Sep 2022 | 17 Sep 2024 |
| 246 | allens-carpet-cleaning.com | register.com, Inc. | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 247 | allensexteriorenhancement.com | Name.com, Inc. | 18 Sep 2014 | 20 Sep 2015 | 18 Sep 2016 |
| 248 | allenstoolrepair.com | register.com, Inc. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 249 | allenscottphotography.com | GoDaddy.com, LLC | 19 Sep 2014 | 17 Sep 2022 | 19 Sep 2025 |
| 250 | allenshelton.com | DropCatch.com 379 LLC | 3 Feb 2018 | 6 Feb 2018 | 3 Feb 2019 |
| 251 | allenscabwaldorf.com | register.com, Inc. | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 252 | allensamuelscdjroxford.com | GoDaddy.com, LLC | 19 Sep 2014 | 20 Sep 2023 | 19 Sep 2024 |
| 253 | allensabatement.com | GoDaddy.com, LLC | 20 Sep 2014 | 2 Oct 2016 | 20 Sep 2017 |
| 254 | allensworthconsulting.com | GoDaddy.com, LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 255 | allensbbq.com | GoDaddy.com, LLC | 20 Sep 2014 | 31 Aug 2023 | 20 Sep 2024 |
| 256 | allensmarathon.com | Tucows Domains Inc. | 17 Sep 2010 | 22 Sep 2014 | 17 Sep 2015 |
| 257 | allensgiftworld.net | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2014 | 18 Sep 2015 |
| 258 | allensamuelsoxford.com | GoDaddy.com, LLC | 9 Sep 2014 | 10 Sep 2023 | 9 Sep 2024 |
| 259 | allenscreek-trading.us | Domain.com, LLC | 2 Oct 2014 | 8 Aug 2015 | 1 Oct 2017 |
| 260 | allenscreek.us | Domain.com, LLC | 2 Oct 2014 | - | 1 Oct 2016 |
| 261 | allenshomerepair.net | register.com, Inc. | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 262 | allensteelco.com | MAFF Inc. | 27 Apr 2021 | 6 Jul 2023 | 27 Apr 2023 |
| 263 | allenshowstaffing.com | Tucows Domains Inc. | 19 Nov 2014 | 23 Nov 2015 | 19 Nov 2016 |
| 264 | allensheetmetal.com | GoDaddy.com, LLC | 18 Nov 2014 | 17 Sep 2022 | 18 Nov 2024 |
| 265 | allensabstracts.com | DropCatch.com 732 LLC | 22 Dec 2017 | 22 Dec 2017 | 22 Dec 2018 |
| 266 | allensamuelsoxford.net | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2023 | 10 Sep 2024 |
| 267 | allensplumbingandpainting.com | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 268 | allenscreek-trading.com | Domain.com, LLC | 2 Oct 2014 | 15 Sep 2015 | 2 Oct 2017 |
| 269 | allenstevens.com | DropCatch.com 625 LLC | 18 Dec 2021 | 17 Feb 2024 | 18 Dec 2023 |
| 270 | allensamuelchryslerdodogejeepram.com | GoDaddy.com, LLC | 19 Nov 2014 | 20 Nov 2023 | 19 Nov 2024 |
| 271 | allensouthrealty.com | Internet.bs Corp. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 272 | allensouthrealtysellers.com | Internet.bs Corp. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 273 | allenspencer.net | Beijing Lanhai Jiye Technology Co., Ltd | 24 Nov 2022 | 23 Dec 2023 | 24 Nov 2024 |
| 274 | allensgunshopva.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2016 |
| 275 | allensmartmedia.com | Tucows Domains Inc. | 30 Sep 2012 | 3 Oct 2014 | 30 Sep 2015 |
| 276 | allenspear.com | GoDaddy.com, LLC | 22 Sep 2014 | 27 Dec 2023 | 22 Sep 2026 |
| 277 | allenscustomgutters.com | Tucows Domains Inc. | 3 Jan 2011 | 19 Dec 2023 | 3 Jan 2025 |
| 278 | allensflowersinc.net | Network Solutions, LLC | 6 Nov 2017 | 6 Sep 2023 | 6 Nov 2024 |
| 279 | allensautoservice.com | GoDaddy.com, LLC | 7 Feb 2016 | 15 Feb 2024 | 7 Feb 2025 |
| 280 | allensigntn.com | Tucows Domains Inc. | 21 Sep 2010 | 25 Sep 2014 | 21 Sep 2015 |
| 281 | allensradiators.com | GoDaddy.com, LLC | 7 Oct 2014 | 8 Oct 2023 | 7 Oct 2024 |
| 282 | allenspools.net | Google, Inc. | 9 Sep 2021 | 9 Sep 2021 | 9 Sep 2022 |
| 283 | allenstantongroup.com | GoDaddy.com, LLC | 8 Oct 2014 | 9 Oct 2022 | 8 Oct 2024 |
| 284 | allenskangenwater.com | GoDaddy.com, LLC | 27 Sep 2014 | 27 Sep 2014 | 27 Sep 2016 |
| 285 | allensmiledesigns.com | Name.com, Inc. | 21 Nov 2014 | 23 Oct 2016 | 21 Nov 2017 |
| 286 | allenstarre.us | Tucows Domains Inc. | 25 Sep 2013 | 28 Sep 2014 | 24 Sep 2014 |
| 287 | allensimone.com | GoDaddy.com, LLC | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 288 | allensflowersandplants.net | GoDaddy.com, LLC | 20 Nov 2014 | 5 Oct 2016 | 20 Nov 2017 |
| 289 | allensamuelschevroletwacocontest.com | GoDaddy.com, LLC | 29 Sep 2014 | 29 Sep 2014 | 29 Sep 2015 |
| 290 | allenstarr.com | GoDaddy.com, LLC | 22 Nov 2014 | 22 Nov 2014 | 22 Nov 2016 |
| 291 | allenstreeserviceandlandscaping.com | register.com, Inc. | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 292 | allenscreektrading.com | Domain.com, LLC | 11 Oct 2014 | 15 Sep 2015 | 11 Oct 2018 |
| 293 | allensangles.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 294 | allensbushire.com | Protocol Internet Technology Limited T/A Hosting I… | 18 Jun 2021 | 15 Jun 2023 | 18 Jun 2024 |
| 295 | allenstownhotel.com | CSC Corporate Domains, Inc. | 25 Sep 2014 | 23 Aug 2023 | 25 Sep 2024 |
| 296 | allensteelconstruction.com | GoDaddy.com, LLC | 25 Sep 2014 | 29 Sep 2023 | 25 Sep 2024 |
| 297 | allensindianjewelry.com | eNom, Inc. | 23 Aug 2016 | 18 Aug 2017 | 23 Aug 2018 |
| 298 | allensz.com | GMO Internet Inc. | 15 Feb 2020 | 15 Feb 2020 | 15 Feb 2021 |
| 299 | allensibarani.com | 1&1 Internet AG | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 300 | allensamuelsfiatalfaromeo.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 301 | allensamuelsalfaromeofiattemple.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 302 | allensamuelsalfaromeofiatkilleen.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 303 | allensamuelsalfaromeofiat.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 304 | allensamuelsalfaromeo.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 305 | allensex.com | Fabulous.com Pty Ltd. | 14 Oct 2007 | 15 May 2017 | 14 Oct 2017 |
| 306 | allensteinanddurbinreview.info | 1&1 Internet AG | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 307 | allenstrombosky.com | Tucows Domains Inc. | 16 Oct 2014 | 1 Oct 2023 | 16 Oct 2024 |
| 308 | allenstreeservdaytonabch.com | Tucows Domains Inc. | 15 Oct 2007 | 19 Oct 2014 | 15 Oct 2015 |
| 309 | allenstechstuff.com | Mesh Digital Limited | 19 Oct 2014 | 19 Oct 2014 | 19 Oct 2016 |
| 310 | allenspoems.com | HiChina Zhicheng Technology Limited | 18 Oct 2014 | 8 Feb 2018 | 18 Oct 2018 |
| 311 | allensmilecenter.com | GoDaddy.com, LLC | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 312 | allenscurrentauctions.com | Domain.com, LLC | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 313 | allenschofield.com | Tucows Domains Inc. | 25 Nov 2014 | 10 Nov 2023 | 25 Nov 2024 |
| 314 | allensamuelsfiatalfaromeo.net | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 315 | allensamuelsalfaromeofiattemple.net | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 316 | allensamuelsalfaromeofiatkilleen.net | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 317 | allensamuelsalfaromeofiat.net | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 318 | allensamuelsalfaromeo.net | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 319 | allensshoesonline.com | GoDaddy.com, LLC | 19 Oct 2014 | 6 Jun 2016 | 19 Oct 2017 |
| 320 | allenslist.com | Wix.com Ltd. | 6 Feb 2023 | 13 May 2024 | 6 Feb 2025 |
| 321 | allensalazar.com | GoDaddy.com, LLC | 26 Nov 2014 | 26 Nov 2022 | 26 Nov 2024 |
| 322 | allensrendeavors.info | Wild West Domains, LLC | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2016 |
| 323 | allensformalwear.com | Wild West Domains, LLC | 9 Mar 2019 | 9 Mar 2024 | 9 Mar 2025 |
| 324 | allensparkvisitor.com | Network Solutions, LLC | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 325 | allensalligators.com | eNom, Inc. | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 326 | allenswidescreentv.com | Tucows Domains Inc. | 29 Nov 2013 | 3 Dec 2014 | 29 Nov 2015 |
| 327 | allensparklivery.com | Wild West Domains, LLC | 9 May 2021 | 9 May 2021 | 9 May 2022 |
| 328 | allensnowrealty.com | GoDaddy.com, LLC | 3 Dec 2014 | 4 Dec 2023 | 3 Dec 2025 |
| 329 | allensealcoatingandstriping.com | Network Solutions, LLC | 3 Dec 2014 | 25 Mar 2015 | 3 Dec 2017 |
| 330 | allensperfectskin.com | eNom, Inc. | 5 Dec 2014 | 5 Dec 2014 | 5 Dec 2015 |
| 331 | allensageman.com | Wild West Domains, LLC | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 332 | allenshydro.com | Wild West Domains, LLC | 8 Dec 2014 | 9 Dec 2016 | 8 Dec 2017 |
| 333 | allensellshomes.com | Launchpad, Inc. | 5 Oct 2021 | 5 Oct 2021 | 5 Oct 2022 |
| 334 | allensdaughter.com | FastDomain Inc. | 17 Feb 2019 | 17 Feb 2019 | 17 Feb 2020 |
| 335 | allens2001.com | Tucows Domains Inc. | 5 Dec 2011 | 30 Nov 2023 | 5 Dec 2024 |
| 336 | allensvillecommunitychurch.com | Tucows Domains Inc. | 9 Dec 2014 | 13 Dec 2018 | 9 Dec 2018 |
| 337 | allensellshomes.net | 1&1 Internet AG | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 338 | allenschrockbuilders.com | register.com, Inc. | 8 Dec 2008 | 7 Nov 2023 | 8 Dec 2024 |
| 339 | allensoilanspropane.com | GoDaddy.com, LLC | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 340 | allens-affiliate-internet-marketing.com | Active Registrar, Inc. | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 341 | allenstanfordofficial.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 342 | allenssalvage.com | Epik Inc. | 12 Nov 2010 | 23 Nov 2017 | 12 Nov 2018 |
| 343 | allens-affiliate-internet-marketing.net | Active Registrar, Inc. | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 344 | allensperfumers.com | GoDaddy.com, LLC | 17 Dec 2014 | 9 Jan 2024 | 17 Dec 2024 |
| 345 | allenspaintingokc.com | Tucows Domains Inc. | 16 Dec 2014 | 20 Dec 2016 | 16 Dec 2016 |
| 346 | allensgutters.com | GoDaddy.com, LLC | 6 Mar 2018 | 15 Feb 2024 | 6 Mar 2025 |
| 347 | allenspaintingokc2.com | eNom, Inc. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 348 | allenshayanlaw.com | GoDaddy.com, LLC | 18 Dec 2014 | 19 Dec 2022 | 18 Dec 2024 |
| 349 | allenslots.com | GoDaddy.com, LLC | 19 Dec 2014 | 20 Dec 2022 | 19 Dec 2024 |
| 350 | allensaffiliatemarketing.com | 1&1 Internet AG | 20 Dec 2014 | 20 Dec 2014 | 20 Dec 2015 |
| 351 | allensuccess.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 352 | allens100.com | GoDaddy.com, LLC | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2016 |
| 353 | allensnewandusedcars.com | Tucows Domains Inc. | 22 Dec 2010 | 26 Dec 2014 | 22 Dec 2015 |
| 354 | allenscookieco.com | 1&1 Internet AG | 1 Oct 2020 | 1 Oct 2020 | 1 Oct 2021 |
| 355 | allenshealthcare.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 356 | allensoleil.com | FastDomain Inc. | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 357 | allenslockandkey.com | TurnCommerce, Inc. DBA NameBright.com | 17 Mar 2018 | 11 Mar 2021 | 17 Mar 2024 |
| 358 | allensfund.com | eNom, Inc. | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 359 | allensphotography.com | Annulet LLC | 29 Dec 2014 | 15 Feb 2024 | 29 Dec 2024 |
| 360 | allensmokedetectorrepair.com | GoDaddy.com, LLC | 30 Dec 2014 | 17 Sep 2022 | 30 Dec 2024 |
| 361 | allensmicroarmor.com | Wild West Domains, LLC | 31 Dec 2014 | 30 Nov 2023 | 31 Dec 2024 |
| 362 | allensimonephotography.com | Wild West Domains, LLC | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2016 |
| 363 | allensautorepair.net | NameCheap, Inc. | 30 Dec 2014 | 30 Nov 2023 | 30 Dec 2024 |
| 364 | allenstaffings.com | Tucows Domains Inc. | 29 Dec 2013 | 2 Jan 2015 | 29 Dec 2015 |
| 365 | allenstownpost50.com | DomainPeople, Inc. | 2 Jan 2015 | 4 Dec 2016 | 2 Jan 2018 |
| 366 | allensitsecurityconsulting.com | - | 6 Sep 2016 | 6 Sep 2016 | 6 Sep 2017 |
| 367 | allensaffikiatemarketingweb.com | GoDaddy.com, LLC | 2 Jan 2015 | 3 Jan 2015 | 2 Jan 2016 |
| 368 | allenstownexplorerpost50.com | DomainPeople, Inc. | 3 Jan 2015 | 5 Dec 2016 | 3 Jan 2018 |
| 369 | allensellshouses.com | NameCheap, Inc. | 9 Apr 2021 | - | 9 Apr 2022 |
| 370 | allensellshouses.info | GoDaddy.com, LLC | 3 Jan 2015 | 4 Jan 2017 | 3 Jan 2018 |
| 371 | allensaffiliatemarketingi.info | GoDaddy.com, LLC | 2 Jan 2015 | 3 Jan 2015 | 2 Jan 2016 |
| 372 | allensaffikiatemarketingweb.org | GoDaddy.com, LLC | 2 Jan 2015 | 3 Jan 2015 | 2 Jan 2016 |
| 373 | allenstethoscopes.xyz | Network Solutions, LLC | 21 Jul 2014 | 21 Jul 2014 | 21 Jul 2015 |
| 374 | allenstownah.xyz | Network Solutions, LLC | 18 Jul 2014 | 18 Jul 2014 | 18 Jul 2015 |
| 375 | allensflowers.xyz | GoDaddy.com, LLC | 17 Jul 2014 | 15 Apr 2024 | 17 Jul 2024 |
| 376 | allenstein.voting | RegistryGate GmbH | 23 Jul 2014 | - | 23 Jul 2015 |
| 377 | allenswines.xyz | Network Solutions, LLC | 22 Jul 2014 | 23 Jul 2014 | 22 Jul 2015 |
| 378 | allenswebcomic.ninja | eNom, Inc. | 27 Jul 2014 | 28 Jul 2014 | 27 Jul 2015 |
| 379 | allensystemsgroup.xyz | Network Solutions, LLC | 26 Jul 2014 | 26 Jul 2014 | 26 Jul 2015 |
| 380 | allenstreetcapital.xyz | Network Solutions, LLC | 27 Jul 2014 | 27 Jul 2014 | 27 Jul 2015 |
| 381 | allensparkfire.xyz | Network Solutions, LLC | 26 Jul 2014 | 26 Jul 2014 | 26 Jul 2015 |
| 382 | allensautotrim.xyz | Network Solutions, LLC | 18 Sep 2016 | 4 Jun 2017 | 18 Sep 2017 |
| 383 | allensairandrepair.xyz | Network Solutions, LLC | 28 Jul 2014 | 29 Jul 2014 | 28 Jul 2015 |
| 384 | allensworthproductions.xyz | Network Solutions, LLC | 2 Aug 2014 | 2 Aug 2014 | 2 Aug 2015 |
| 385 | allenstanfield.xyz | Network Solutions, LLC | 1 Aug 2014 | 1 Aug 2014 | 1 Aug 2015 |
| 386 | allensjewelers.xyz | Network Solutions, LLC | 30 Jul 2014 | 30 Jul 2014 | 30 Jul 2015 |
| 387 | allensbach.webcam | 1&1 Internet AG | 10 Jun 2014 | 25 Jul 2017 | 9 Jun 2018 |
| 388 | allenspetresort.training | Network Solutions, LLC | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 389 | allensolomon.nyc | GoDaddy.com, LLC | 18 Nov 2014 | 1 Mar 2020 | 17 Nov 2020 |
| 390 | allensmith.realtor | Name Share, Inc. | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 391 | allensearch.business | Blue Razor Domains, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 392 | allensflower.market | GoDaddy.com, LLC | 9 Jan 2015 | 10 Jun 2023 | 9 Jan 2026 |
| 393 | allensecurity.bike | Tucows Domains Inc. | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 394 | allensmithgroup.com | Google, Inc. | 15 Mar 2022 | 18 Apr 2024 | 15 Mar 2025 |
| 395 | allensville.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 396 | allenstown.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 397 | allenspark.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 398 | allenstevenson.nyc | Network Solutions, LLC | 18 Feb 2015 | 21 May 2024 | 17 Feb 2025 |
| 399 | allensaffiliatecash.website | Global Domains International, Inc. DBA DomainCostC… | 29 Mar 2015 | 29 Mar 2015 | 29 Mar 2016 |
| 400 | allenstanton.realtor | Name Share, Inc. | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 401 | allensbarbershop.com | DropCatch.com 448 LLC | 22 Mar 2016 | 23 Mar 2017 | 22 Mar 2018 |
| 402 | allenst.com | TurnCommerce, Inc. DBA NameBright.com | 25 Feb 2018 | 19 Feb 2021 | 25 Feb 2024 |
| 403 | allenstuxedo.com | Wild West Domains, LLC | 7 Jan 2015 | 8 Jan 2015 | 7 Jan 2016 |
| 404 | allensmufflershop.com | Realtime Register B.V. | 9 Jun 2022 | 20 Aug 2023 | 9 Jun 2023 |
| 405 | allensgatheringplace.com | Tucows Domains Inc. | 4 Jan 2012 | 8 Jan 2015 | 4 Jan 2016 |
| 406 | allenspettaxi.com | Tucows Domains Inc. | 5 Jan 2014 | 9 Jan 2015 | 5 Jan 2016 |
| 407 | allenschenk.com | FastDomain Inc. | 8 Jan 2015 | 8 Jan 2017 | 8 Jan 2018 |
| 408 | allensinuscenter.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2018 |
| 409 | allenselectricrnotors.com | - | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2017 |
| 410 | allensfriendlyautos.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 411 | allensecurity.org | Tucows Domains Inc. | 9 Jan 2015 | 13 Jan 2017 | 9 Jan 2018 |
| 412 | allensecurity.net | Tucows Domains Inc. | 9 Jan 2015 | 25 Dec 2023 | 9 Jan 2025 |
| 413 | allensecurity.info | Tucows Domains Inc. | 9 Jan 2015 | 13 Jan 2017 | 9 Jan 2018 |
| 414 | allenscomputer.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 415 | allensbonsai.com | Google, Inc. | 8 Sep 2021 | 8 Sep 2021 | 8 Sep 2022 |
| 416 | allenstaining.com | GoDaddy.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 417 | allensvehicleunlock.com | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 418 | allensatticinsulation.com | Tucows Domains Inc. | 15 Jan 2015 | 19 Jan 2017 | 15 Jan 2017 |
| 419 | allensofdixie.com | GoDaddy.com, LLC | 2 Dec 2005 | 3 Dec 2023 | 2 Dec 2024 |
| 420 | allensburger.com | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 421 | allensvehicleunlock.org | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 422 | allensvehicleunlock.net | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 423 | allensvehicleunlock.info | GoDaddy.com, LLC | 15 Jan 2015 | - | 15 Jan 2016 |
| 424 | allensmasonry.com | GoDaddy.com, LLC | 13 Jan 2008 | 17 Jan 2023 | 13 Jan 2028 |
| 425 | allensbach.tips | united-domains AG | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 426 | allensamantha.uno | Domainia Inc. | 7 Jul 2015 | 7 Jul 2015 | 6 Jul 2016 |
| 427 | allensquad.works | GoDaddy.com, LLC | 21 Jul 2015 | 21 Jul 2015 | 21 Jul 2016 |
| 428 | allensmithdesign.com | 1&1 Internet AG | 6 Jan 2017 | 11 Jan 2018 | 6 Jan 2025 |
| 429 | allensurgicalweightloss.com | eNom, Inc. | 17 Aug 2015 | 18 Aug 2015 | 17 Aug 2016 |
| 430 | allensup.com | Tucows Domains Inc. | 17 Aug 2015 | 21 Aug 2018 | 17 Aug 2018 |
| 431 | allensanimalsanctuary.org | GoDaddy.com, LLC | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 432 | allenstreetdogpark.info | Crazy Domains FZ-LLC | 19 Jan 2015 | 20 Mar 2015 | 19 Jan 2025 |
| 433 | allenstdogpark.info | Crazy Domains FZ-LLC | 18 Jan 2015 | 20 Mar 2015 | 18 Jan 2025 |
| 434 | allensreunite.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2017 |
| 435 | allensrepair.com | Name.com, Inc. | 12 Apr 2021 | 26 May 2024 | 12 Apr 2025 |
| 436 | allenspropainting.com | Dynadot, LLC | 23 Jan 2015 | 24 Jan 2015 | 23 Jan 2016 |
| 437 | allensfinerugcleaning.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2017 |
| 438 | allenshayformayor.com | GoDaddy.com, LLC | 21 Dec 2023 | 21 Dec 2023 | 21 Dec 2024 |
| 439 | allenshow.com | TurnCommerce, Inc. DBA NameBright.com | 11 Apr 2016 | 5 Apr 2021 | 11 Apr 2024 |
| 440 | allensandbox.com | GoDaddy.com, LLC | 18 Aug 2015 | 19 Aug 2015 | 18 Aug 2016 |
| 441 | allenspetresortca.com | eNom, Inc. | 29 Jan 2015 | 31 Dec 2016 | 29 Jan 2018 |
| 442 | allensylvia.com | GoDaddy.com, LLC | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2017 |
| 443 | allenssecretsuccessclub.com | 1&1 Internet AG | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 444 | allens4x4accessories.net | Crazy Domains FZ-LLC | 23 Jul 2012 | 19 Aug 2015 | 23 Jul 2016 |
| 445 | allens4x4accessories.com | Crazy Domains FZ-LLC | 23 Jul 2012 | 25 Apr 2024 | 23 Jul 2024 |
| 446 | allensweetheart.com | eNom, Inc. | 3 Feb 2015 | 5 Jan 2017 | 3 Feb 2018 |
| 447 | allenssecretsuccessclub.biz | Launchpad, Inc. | 2 Feb 2015 | 2 Feb 2015 | 1 Feb 2016 |
| 448 | allensmedicalmassage.com | Tucows Domains Inc. | 3 Feb 2015 | 15 Mar 2024 | 3 Feb 2024 |
| 449 | allenstreetpoutine.com | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2024 | 4 Feb 2026 |
| 450 | allenstpoutine.com | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2024 | 4 Feb 2026 |
| 451 | allensexterminating.com | Tucows Domains Inc. | 31 Jan 2011 | 4 Feb 2015 | 31 Jan 2016 |
| 452 | allensrevenge.com | GoDaddy.com, LLC | 10 Dec 2016 | 10 Dec 2016 | 10 Dec 2017 |
| 453 | allenschevron.com | NameCheap, Inc. | 28 Apr 2015 | 30 Mar 2024 | 28 Apr 2025 |
| 454 | allens-socal-products.com | Name.com, Inc. | 8 Feb 2015 | 8 Feb 2015 | 8 Feb 2016 |
| 455 | allensonarmory.com | register.com, Inc. | 20 Aug 2015 | 18 Sep 2016 | 20 Aug 2018 |
| 456 | allens4dcc.com | GoDaddy.com, LLC | 20 Aug 2015 | 19 Sep 2022 | 12 Sep 2027 |
| 457 | allenscustomcardesigns.com | - | - | - | - |
| 458 | allensmithart.com | Eagle Eye Domains, LLC | 24 Jun 2022 | 7 Aug 2023 | 24 Jun 2023 |
| 459 | allenscustomcardesign.com | GoDaddy.com, LLC | 9 Feb 2015 | 29 Oct 2023 | 9 Feb 2025 |
| 460 | allensbioservices.com | register.com, Inc. | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2016 |
| 461 | allensworthpolytechnical.net | register.com, Inc. | 30 Dec 2021 | 30 Dec 2021 | 30 Dec 2022 |
| 462 | allenstea.com | HiChina Zhicheng Technology Limited | 12 Feb 2015 | 15 Feb 2024 | 12 Feb 2025 |
| 463 | allenskinner.com | eNom, Inc. | 12 Feb 2015 | 11 Feb 2024 | 12 Feb 2025 |
| 464 | allensjanitorial.net | Tucows Domains Inc. | 19 Nov 2017 | 23 Nov 2019 | 19 Nov 2019 |
| 465 | allenshields.com | 1&1 Internet AG | 28 Jul 2021 | 7 Aug 2023 | 28 Jul 2023 |
| 466 | allenstreeservicellc.com | NameKing.com Inc. | 13 Feb 2015 | 19 Feb 2024 | 13 Feb 2025 |
| 467 | allensnhaven.com | GoDaddy.com, LLC | 20 Dec 2009 | 13 Feb 2015 | 20 Dec 2019 |
| 468 | allenshvac.com | eNom, Inc. | 16 May 2024 | 16 May 2024 | 16 May 2025 |
| 469 | allenstreetcondos.com | GoDaddy.com, LLC | 15 Feb 2015 | 16 Feb 2024 | 15 Feb 2025 |
| 470 | allenstake.com | eNom, Inc. | 16 Feb 2015 | 18 Jan 2024 | 16 Feb 2025 |
| 471 | allensview.com | Automattic Inc. | 13 May 2018 | 13 May 2018 | 13 May 2019 |
| 472 | allensroadservice.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 473 | allenspainting25yrsexp.com | Tucows Domains Inc. | 14 Feb 2014 | 18 Feb 2015 | 14 Feb 2016 |
| 474 | allenspaint.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 475 | allensdocservice.com | Tucows Domains Inc. | 14 Feb 2013 | 18 Feb 2015 | 14 Feb 2016 |
| 476 | allensinsulation.com | GoDaddy.com, LLC | 26 Nov 2020 | 7 Jan 2024 | 26 Nov 2023 |
| 477 | allenschildvisitsupervisionservices.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2017 |
| 478 | allensamuelsfortworthnews.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 479 | allensamuelsapnews.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 480 | allensignsid.com | Moniker Online Services LLC | 19 Feb 2015 | 27 Mar 2024 | 19 Feb 2025 |
| 481 | allenskitchenbath.com | GoDaddy.com, LLC | 31 Oct 2019 | 31 Oct 2019 | 31 Oct 2020 |
| 482 | allenschildvisitsupervisionservices.net | Tucows Domains Inc. | 19 Feb 2015 | 23 Feb 2017 | 19 Feb 2017 |
| 483 | allenstitches.com | GoDaddy.com, LLC | 22 Feb 2015 | 22 Feb 2015 | 22 Feb 2016 |
| 484 | allensoberano.com | Google, Inc. | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 485 | allenswilltravel.com | GoDaddy.com, LLC | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 486 | allenspecialistparts.com | 1&1 Internet AG | 23 Feb 2015 | 18 Jun 2017 | 23 Feb 2018 |
| 487 | allensjanitorialservicestlouis.com | Tucows Domains Inc. | 20 Feb 2013 | 24 Feb 2015 | 20 Feb 2016 |
| 488 | allensoler.com | eNom, Inc. | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2016 |
| 489 | allensrestaurant.net | NameCheap, Inc. | 23 Feb 2015 | 24 Jan 2024 | 23 Feb 2025 |
| 490 | allenstudentmedia.com | Wild West Domains, LLC | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 491 | allensnursery.com | register.com, Inc. | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 492 | allensfordcaravanpark.com | Above.com Pty Ltd. | 2 Oct 2017 | 22 Sep 2020 | 2 Oct 2024 |
| 493 | allensecurityinc.com | - | 17 May 2023 | 18 May 2024 | 17 May 2025 |
| 494 | allenspecialtyproducts.com | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 495 | allensbakery.biz | Name.com, Inc. | 24 Nov 2018 | 28 Nov 2018 | 24 Nov 2019 |
| 496 | allenspotswear.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 497 | allensignco.com | GoDaddy.com, LLC | 24 Mar 2016 | 25 Mar 2024 | 24 Mar 2026 |
| 498 | allensafeandclean.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 499 | allensamuelshouseoftravel.com | - | - | - | - |
| 500 | allensfitnessandtraininginc.net | Tucows Domains Inc. | 26 Feb 2014 | 2 Mar 2015 | 26 Feb 2016 |
| 501 | allensfitnessandtraining.net | Tucows Domains Inc. | 26 Feb 2014 | 2 Mar 2015 | 26 Feb 2016 |
| 502 | allenstaley.com | GoDaddy.com, LLC | 23 Aug 2015 | 23 Aug 2015 | 23 Aug 2016 |
| 503 | allensatterswaite.com | - | 21 May 2022 | 22 May 2023 | 21 May 2024 |
| 504 | allenswcd.com | eNom, Inc. | 2 Mar 2010 | 16 Feb 2024 | 2 Mar 2025 |
| 505 | allenstarrellc.com | Tucows Domains Inc. | 3 Mar 2015 | 7 Mar 2019 | 3 Mar 2019 |
| 506 | allens-photography.com | 1&1 Internet AG | 16 Jun 2019 | 17 Jun 2019 | 16 Jun 2024 |
| 507 | allensmountainrentals.com | Fabulous.com Pty Ltd. | 24 Feb 2005 | 1 Mar 2017 | 24 Feb 2018 |
| 508 | allenslaneapartments.com | Wild West Domains, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 509 | allensavemetals.com | - | 28 Oct 2022 | 30 Dec 2023 | 28 Oct 2023 |
| 510 | allensyardservice.com | GoDaddy.com, LLC | 5 Mar 2015 | 27 Mar 2024 | 5 Mar 2026 |
| 511 | allenshenphotots.com | HiChina Zhicheng Technology Limited | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 512 | allenshenphotos.com | HiChina Zhicheng Technology Limited | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 513 | allensavemetals.us | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 3 Mar 2016 |
| 514 | allensavemetals.org | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 515 | allensavemetals.net | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 516 | allensundercare.net | eNom, Inc. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 517 | allensfloors.com | GoDaddy.com, LLC | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 518 | allensautoappearance.com | NameCheap, Inc. | 25 Jun 2023 | 16 Nov 2023 | 25 Jun 2024 |
| 519 | allensfencing.com | DropCatch.com 640 LLC | 7 Nov 2015 | 8 Nov 2016 | 7 Nov 2017 |
| 520 | allensrestaurant.com | Dynadot, LLC | 27 May 2024 | 27 May 2024 | 27 May 2025 |
| 521 | allenstonewarepottery.com | register.com, Inc. | 22 May 2020 | 24 May 2024 | 22 May 2025 |
| 522 | allensmedical.com | GKG.NET, INC. | 30 May 2016 | 1 Apr 2024 | 30 May 2026 |
| 523 | allenscontracting.com | DropCatch.com 389 LLC | 29 May 2019 | 29 May 2019 | 29 May 2020 |
| 524 | allenspowerequipment.net | GoDaddy.com, LLC | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2017 |
| 525 | allenspecialtypaving.com | GoDaddy.com, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 526 | allenspecialtyasphalt.com | GoDaddy.com, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 527 | allenspromos.com | GoDaddy.com, LLC | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 528 | allenslaurelhillsutlery.com | Tucows Domains Inc. | 25 Aug 2015 | 29 Aug 2022 | 25 Aug 2022 |
| 529 | allenshawgolf.com | GoDaddy.com, LLC | 7 Dec 2016 | 7 Dec 2016 | 7 Dec 2017 |
| 530 | allensonsair.com | Vitalwerks Internet Solutions, LLC DBA No-IP | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2020 |
| 531 | allensloaneetchings.com | 1&1 Internet AG | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 532 | allenskeller.com | DropCatch.com 674 LLC | 15 Mar 2015 | 16 Mar 2017 | 15 Mar 2018 |
| 533 | allensfitnessblog.com | eNom, Inc. | 30 Nov 2016 | 25 Nov 2017 | 30 Nov 2018 |
| 534 | allenseverafter.com | Name.com, Inc. | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 535 | allensranch.com | GMO Internet Inc. | 6 Jun 2021 | 7 Jun 2021 | 6 Jun 2022 |
| 536 | allensquickfix.com | eNom, Inc. | 20 Mar 2015 | 14 Mar 2017 | 20 Mar 2018 |
| 537 | allenstj.net | Namesilo, LLC | 19 Mar 2015 | 5 Apr 2015 | 19 Mar 2016 |
| 538 | allenssuperiorcleaning.net | Tucows Domains Inc. | 15 Mar 2014 | 19 Mar 2015 | 15 Mar 2016 |
| 539 | allenstoneware.com | Namesilo, LLC | 7 Jun 2023 | 7 Jun 2024 | 7 Jun 2024 |
| 540 | allenspcrepair.com | 1&1 Internet AG | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 541 | allenscommunitytheatre.com | GoDaddy.com, LLC | 20 Mar 2015 | 21 Mar 2023 | 20 Mar 2025 |
| 542 | allensayegh.com | GoDaddy.com, LLC | 20 Mar 2015 | 21 Mar 2024 | 20 Mar 2025 |
| 543 | allensautomotivecampbell.com | Tucows Domains Inc. | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 544 | allensremovals.com | Tucows Domains Inc. | 18 Mar 2014 | 22 Mar 2015 | 18 Mar 2016 |
| 545 | allenshamblinlaw.com | GoDaddy.com, LLC | 21 Mar 2015 | 21 Mar 2015 | 21 Mar 2017 |
| 546 | allenscommunitytheatre.org | GoDaddy.com, LLC | 20 Mar 2015 | 22 Jul 2023 | 20 Mar 2025 |
| 547 | allenstreefarm.com | Tucows Domains Inc. | 22 Mar 2009 | 7 Mar 2017 | 22 Mar 2018 |
| 548 | allenssuperiorcleaning.com | Tucows Domains Inc. | 22 Mar 2014 | 26 Mar 2015 | 22 Mar 2016 |
| 549 | allenshallmak.com | GoDaddy.com, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 550 | allenshomeandgarden.com | eNom, Inc. | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2016 |
| 551 | allenschicken.com | DropCatch.com 467 LLC | 14 Nov 2018 | 14 Nov 2018 | 14 Nov 2019 |
| 552 | allensbach.online | PSI-USA, Inc. dba Domain Robot | 27 Aug 2015 | 29 Nov 2023 | 27 Aug 2024 |
| 553 | allensurveying.com | TurnCommerce, Inc. DBA NameBright.com | 27 Mar 2015 | 29 Apr 2024 | 27 Mar 2024 |
| 554 | allenselectricmotorsgov.com | Tucows Domains Inc. | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2017 |
| 555 | allensforeverafter.com | eNom, Inc. | 30 Mar 2015 | 30 Mar 2015 | 30 Mar 2016 |
| 556 | allenstownmedicalcentre.com | eNom, Inc. | 1 Apr 2015 | 6 Mar 2017 | 1 Apr 2019 |
| 557 | allenshowerdoor.com | eNom, Inc. | 1 Apr 2015 | 29 Feb 2016 | 1 Apr 2018 |
| 558 | allenstaton.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 559 | allenshaffer.com | GoDaddy.com, LLC | 2 Apr 2015 | 6 Mar 2023 | 2 Apr 2025 |
| 560 | allensgrill.com | GoDaddy.com, LLC | 2 Apr 2015 | 13 Mar 2024 | 2 Apr 2025 |
| 561 | allensimms.net | Network Solutions, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 562 | allensplumbingnj.com | DropCatch.com 1150 LLC | 10 Jun 2021 | 10 Jun 2021 | 10 Jun 2022 |
| 563 | allens5.net | eNom, Inc. | 3 Apr 2015 | 3 Mar 2016 | 3 Apr 2018 |
| 564 | allensurveying.us | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 26 Mar 2017 |
| 565 | allensellsmetroatl.com | GoDaddy.com, LLC | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2016 |
| 566 | allensamuelsauto.com | - | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2017 |
| 567 | allenstevewendi.org | GoDaddy.com, LLC | 2 Sep 2015 | 2 Nov 2015 | 2 Sep 2017 |
| 568 | allenstevewendi.net | GoDaddy.com, LLC | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2017 |
| 569 | allenstevewendi.info | GoDaddy.com, LLC | 2 Sep 2015 | 2 Nov 2015 | 2 Sep 2017 |
| 570 | allenstevewendi.com | DropCatch.com 1424 LLC | 20 Nov 2017 | 20 Nov 2017 | 20 Nov 2018 |
| 571 | allenstreeservicestx.com | GoDaddy.com, LLC | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 572 | allenscrew.com | Crazy Domains FZ-LLC | 23 May 2023 | 30 May 2024 | 23 May 2024 |
| 573 | allensmore-performance.net | 1&1 Internet AG | 7 Apr 2015 | 8 Apr 2017 | 7 Apr 2018 |
| 574 | allenstenberg.com | Tucows Domains Inc. | 4 Dec 2019 | 8 Dec 2022 | 4 Dec 2023 |
| 575 | allenscreekofficepark.com | GoDaddy.com, LLC | 3 Sep 2015 | 19 Sep 2022 | 3 Sep 2024 |
| 576 | allensatticonline.com | GoDaddy.com, LLC | 3 Sep 2015 | 3 Sep 2015 | 3 Sep 2017 |
| 577 | allenself.net | FastDomain Inc. | 9 Apr 2015 | 29 Mar 2024 | 9 Apr 2025 |
| 578 | allensautobody.net | GoDaddy.com, LLC | 18 Feb 2020 | 27 Jan 2024 | 18 Feb 2025 |
| 579 | allensnwc.com | Launchpad, Inc. | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 580 | allenshipman.com | GoDaddy.com, LLC | 31 Aug 2017 | 3 Sep 2023 | 31 Aug 2025 |
| 581 | allensautoglass.com | FastDomain Inc. | 11 Sep 2023 | 11 Sep 2023 | 11 Sep 2024 |
| 582 | allensrobinson.com | GoDaddy.com, LLC | 18 Apr 2015 | 18 Apr 2015 | 18 Apr 2016 |
| 583 | allenshomeloanswestcovina.us | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 5 Sep 2016 |
| 584 | allenshomeloanswestcovina.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 585 | allenshomeloanssandimas.us | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 5 Sep 2016 |
| 586 | allenshomeloanssandimas.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 587 | allenshomeloansmontclair.us | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 5 Sep 2016 |
| 588 | allenshomeloansmontclair.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 589 | allenshomeloanslaverne.us | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 5 Sep 2016 |
| 590 | allenshomeloanslaverne.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 591 | allenshomeloansglendora.us | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 5 Sep 2016 |
| 592 | allenshomeloansglendora.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 593 | allenshomeloansdiamondbar.us | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 5 Sep 2016 |
| 594 | allenshomeloansdiamondbar.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 595 | allenshomeloanscovina.us | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 5 Sep 2016 |
| 596 | allenshomeloanscovina.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 597 | allenshomeloansclaremont.us | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 5 Sep 2016 |
| 598 | allenshomeloansclaremont.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 599 | allenshomeloans.us | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 5 Sep 2016 |
| 600 | allenshomeloans.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2016 |
| 601 | allenssignsandlighting.com | GoDaddy.com, LLC | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2016 |
| 602 | allensignswichita.com | GoDaddy.com, LLC | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2016 |
| 603 | allenscp.com | Chengdu West Dimension Digital Technology Co., Ltd… | 8 Jul 2019 | 8 Jul 2019 | 8 Jul 2020 |
| 604 | allensconstructionpainting.com | Wild West Domains, LLC | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 605 | allensconstrucitonpainting.com | - | - | - | - |
| 606 | allensassignment.com | GoDaddy.com, LLC | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2017 |
| 607 | allensworthfestival.com | FastDomain Inc. | 29 Jun 2021 | 18 May 2023 | 29 Jun 2024 |
| 608 | allenstjohn.com | - | 20 Sep 2023 | 20 Sep 2023 | 20 Sep 2024 |
| 609 | allensentgroup.com | GoDaddy.com, LLC | 22 Apr 2015 | 22 Apr 2015 | 22 Apr 2016 |
| 610 | allensandblastingllc.com | GoDaddy.com, LLC | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 611 | allensweb.site | GoDaddy.com, LLC | 7 Sep 2015 | 24 Sep 2016 | 7 Sep 2017 |
| 612 | allenstevenlim.com | FastDomain Inc. | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2016 |
| 613 | allenshariiff.com | - | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2017 |
| 614 | allenssite.com | DropCatch.com 1493 LLC | 27 Jun 2018 | 28 Jun 2020 | 27 Jun 2021 |
| 615 | allensearchgroup.com | Vodien Internet Solutions Pte Ltd | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2016 |
| 616 | allensaber.com | Tucows Domains Inc. | 29 Apr 2021 | 3 May 2023 | 29 Apr 2024 |
| 617 | allens-som.com | Tucows Domains Inc. | 23 Apr 2013 | 27 Apr 2015 | 23 Apr 2016 |
| 618 | allensunitedpaeroa.com | Tucows Domains Inc. | 24 Apr 2014 | 28 Apr 2015 | 24 Apr 2016 |
| 619 | allenstreetinn.com | GoDaddy.com, LLC | 22 Jul 2019 | 14 Jun 2023 | 22 Jul 2024 |
| 620 | allensoffice.com | Tucows Domains Inc. | 24 Apr 2014 | 28 Apr 2015 | 24 Apr 2016 |
| 621 | allenstreetresidences.com | Google, Inc. | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 622 | allensofclonmel.com | Register.it SPA | 29 Apr 2015 | 29 Apr 2024 | 29 Apr 2027 |
| 623 | allensameulsalliance.com | GoDaddy.com, LLC | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2016 |
| 624 | allensutton.net | GoDaddy.com, LLC | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 625 | allensportsexchange.com | Tucows Domains Inc. | 30 Apr 2014 | 4 May 2015 | 30 Apr 2016 |
| 626 | allensolomons.com | Tucows Domains Inc. | 30 Apr 2007 | 4 May 2015 | 30 Apr 2016 |
| 627 | allenss.us | Tucows Domains Inc. | 9 Sep 2015 | 9 Sep 2015 | 8 Sep 2016 |
| 628 | allenss.net | - | 10 Sep 2015 | 10 Sep 2015 | 10 Sep 2017 |
| 629 | allenspolishedconcrete.com | GoDaddy.com, LLC | 9 Sep 2015 | 21 Sep 2023 | 9 Sep 2024 |
| 630 | allenstennett.com | GoDaddy.com, LLC | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 631 | allenspecialcleaningservices.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 632 | allensportsexchange.net | Tucows Domains Inc. | 30 Apr 2014 | 4 May 2015 | 30 Apr 2016 |
| 633 | allensoutdoorgear.com | GoDaddy.com, LLC | 5 May 2015 | 6 May 2024 | 5 May 2025 |
| 634 | allensvanlinescorp.com | GoDaddy.com, LLC | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 635 | allensinger.com | MAFF Inc. | 29 Jul 2022 | 7 Oct 2023 | 29 Jul 2023 |
| 636 | allensaccelerate.com | Amazon Registrar, Inc. | 7 May 2015 | 2 Apr 2024 | 7 May 2025 |
| 637 | allenswork.com | GoDaddy.com, LLC | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 638 | allensfencingatx.com | Tucows Domains Inc. | 7 May 2015 | 7 May 2015 | 7 May 2017 |
| 639 | allenscurtainpalace.com | - | - | - | - |
| 640 | allensoriginalcarpetcleaningqc.com | Tucows Domains Inc. | 6 May 2011 | 10 May 2015 | 6 May 2016 |
| 641 | allensformula.com | - | - | - | - |
| 642 | allensgiftgngmd.org | Tucows Domains Inc. | 9 May 2015 | 29 Apr 2024 | 9 May 2025 |
| 643 | allensuite.com | Dynadot, LLC | 11 May 2015 | 12 May 2017 | 11 May 2018 |
| 644 | allenstowingin.com | register.com, Inc. | 12 May 2015 | 12 May 2015 | 12 May 2016 |
| 645 | allenstn.com | GoDaddy.com, LLC | 12 May 2015 | 12 May 2015 | 12 May 2017 |
| 646 | allensuite.net | Dynadot, LLC | 11 May 2015 | 12 May 2017 | 11 May 2018 |
| 647 | allensconcretenc.com | Dynadot, LLC | 6 Mar 2022 | 15 Apr 2023 | 6 Mar 2023 |
| 648 | allensautoservicesaz.com | - | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2017 |
| 649 | allenspowerequipment.com | Epik Inc. | 13 May 2015 | 17 Apr 2024 | 13 May 2025 |
| 650 | allenscottproductions.com | Launchpad, Inc. | 13 May 2015 | 13 May 2015 | 13 May 2016 |
| 651 | allens-towing.net | register.com, Inc. | 12 May 2015 | 12 May 2015 | 12 May 2016 |
| 652 | allenslaterinsurance.com | register.com, Inc. | 23 Mar 2017 | 24 Mar 2024 | 23 Mar 2025 |
| 653 | allensinsulationandroofing.com | GoDaddy.com, LLC | 14 May 2015 | 14 May 2015 | 14 May 2016 |
| 654 | allensaltzman.com | GoDaddy.com, LLC | 14 May 2015 | 15 May 2024 | 14 May 2025 |
| 655 | allensconstructionremodeling.com | Wild West Domains, LLC | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 656 | allensroofcoatings.com | Tucows Domains Inc. | 13 May 2013 | 17 May 2015 | 13 May 2016 |
| 657 | allensloans.com | GoDaddy.com, LLC | 12 Sep 2015 | 12 Sep 2015 | 12 Sep 2017 |
| 658 | allensgrill729.com | DomainPeople, Inc. | 12 Sep 2015 | 7 Sep 2023 | 12 Sep 2024 |
| 659 | allensmith.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Mar 2021 | 13 Mar 2024 | 24 Mar 2025 |
| 660 | allensharliff.com | Tucows Domains Inc. | 19 May 2015 | 19 May 2015 | 19 May 2017 |
| 661 | allensamuelscdjratalliancesales.com | GoDaddy.com, LLC | 19 May 2015 | 19 May 2015 | 19 May 2016 |
| 662 | allenstowingandrecovery.net | NameCheap, Inc. | 18 May 2015 | 18 Apr 2024 | 18 May 2025 |
| 663 | allensalesusa.com | GoDaddy.com, LLC | 20 May 2015 | 20 May 2015 | 20 May 2018 |
| 664 | allensollymadurafashions.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Dec 2016 | 16 Dec 2017 | 5 Dec 2018 |
| 665 | allensairandrepair.com | Network Solutions, LLC | 12 Feb 2005 | 5 Mar 2017 | 12 Feb 2020 |
| 666 | allensatterfieldconst.com | Tucows Domains Inc. | 20 May 2012 | 24 May 2015 | 20 May 2016 |
| 667 | allenspark.com | Epik Inc. | 14 Apr 1998 | 6 Dec 2023 | 13 Apr 2028 |
| 668 | allensworldwide.com | eNom, Inc. | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 669 | allensofnantucketcashmere.com | GoDaddy.com, LLC | 23 Apr 2021 | 5 May 2023 | 23 Apr 2024 |
| 670 | allensmithiam.com | GoDaddy.com, LLC | 27 May 2015 | 28 May 2024 | 27 May 2025 |
| 671 | allensmithiam.biz | GoDaddy.com, LLC | 27 May 2015 | 11 May 2017 | 26 May 2018 |
| 672 | allensantoslaw.com | Network Solutions, LLC | 14 Jun 2017 | 22 Aug 2017 | 14 Jun 2019 |
| 673 | allensamuelsautoplexupgrade.com | eNom, Inc. | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 674 | allensmithiam.info | GoDaddy.com, LLC | 27 May 2015 | 11 May 2017 | 27 May 2018 |
| 675 | allensharlff.com | Google, Inc. | 11 Dec 2017 | 11 Dec 2017 | 11 Dec 2018 |
| 676 | allensgrilljordanstreet.com | DomainPeople, Inc. | 15 Sep 2015 | 9 Sep 2023 | 15 Sep 2024 |
| 677 | allensmithiam.us | GoDaddy.com, LLC | 27 May 2015 | 11 May 2017 | 26 May 2018 |
| 678 | allensmithiam.org | GoDaddy.com, LLC | 27 May 2015 | 11 May 2017 | 27 May 2018 |
| 679 | allensmithiam.net | GoDaddy.com, LLC | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 680 | allensnote.com | GoDaddy.com, LLC | 30 May 2015 | 30 May 2015 | 30 May 2018 |
| 681 | allenseyephotography.com | register.com, Inc. | 16 Apr 2023 | 17 Apr 2024 | 16 Apr 2025 |
| 682 | allensfencing.net | register.com, Inc. | 9 Nov 2022 | 22 Dec 2023 | 9 Nov 2023 |
| 683 | allensweddingsandevents.com | GoDaddy.com, LLC | 15 Sep 2015 | 16 Sep 2023 | 15 Sep 2025 |
| 684 | allensmitzvahflowers.com | GoDaddy.com, LLC | 15 Sep 2015 | 16 Sep 2023 | 15 Sep 2025 |
| 685 | allensamuelshyundaiupgrade.com | eNom, Inc. | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 686 | allensamuelshyundaireward.com | eNom, Inc. | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 687 | allensamuelshyundaiprize.com | eNom, Inc. | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 688 | allensamuelshyundaioffer.com | eNom, Inc. | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 689 | allensamuelshyundaigift.com | eNom, Inc. | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 690 | allensamuelshyundaicard.com | eNom, Inc. | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 691 | allensamuelshyundaibonus.com | eNom, Inc. | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 692 | allensshariff.com | Tucows Domains Inc. | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2017 |
| 693 | allensseafood.com | GoDaddy.com, LLC | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2016 |
| 694 | allensbestdeals.info | GoDaddy.com, LLC | 31 May 2015 | 1 Jun 2015 | 31 May 2016 |
| 695 | allenspencer.com | GoDaddy.com, LLC | 3 Jun 2015 | 3 Jun 2023 | 3 Jun 2024 |
| 696 | allensmenswear.com | GoDaddy.com, LLC | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 697 | allenslawns.com | Tucows Domains Inc. | 26 Jul 2017 | 5 Jul 2023 | 26 Jul 2024 |
| 698 | allenschleinmd.com | GoDaddy.com, LLC | 19 Mar 2018 | 20 Mar 2024 | 19 Mar 2025 |
| 699 | allenscycles.com | Gransy s.r.o. d/b/a subreg.cz | 23 Aug 2017 | 23 Aug 2017 | 23 Aug 2018 |
| 700 | allensteins.com | Key-Systems GmbH | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 701 | allensh.com | HiChina Zhicheng Technology Limited | 5 Jun 2015 | 12 Aug 2020 | 5 Jun 2029 |
| 702 | allenservicescorneliaga.com | eNom, Inc. | 5 Jun 2015 | 29 May 2017 | 5 Jun 2018 |
| 703 | allenscomedy.com | GoDaddy.com, LLC | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 704 | allensbach-university.com | EPAG Domainservices GmbH | 5 Jun 2015 | 6 Jun 2024 | 5 Jun 2025 |
| 705 | allensy.top | eName Technology Co., Ltd. | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 706 | allenslawnandsnowremovalmi.com | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 16 Sep 2015 | 16 Sep 2016 | 16 Sep 2017 |
| 707 | allenslawnandhandyservices.com | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 16 Sep 2015 | 16 Sep 2016 | 16 Sep 2017 |
| 708 | allensmithsales.com | Tucows Domains Inc. | 15 Sep 2005 | 31 Aug 2023 | 15 Sep 2024 |
| 709 | allenshamanicmandala.com | FastDomain Inc. | 6 Jun 2015 | 9 Jul 2017 | 6 Jun 2017 |
| 710 | allenstravels.com | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 711 | allensfamilyhvac.com | register.com, Inc. | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 712 | allensaffordableauto.com | GoDaddy.com, LLC | 8 Jun 2015 | 18 Sep 2022 | 8 Jun 2025 |
| 713 | allenstravels.us | GoDaddy.com, LLC | 8 Jun 2015 | 19 Jul 2017 | 7 Jun 2017 |
| 714 | allensgermanshepherds.com | GoDaddy.com, LLC | 24 Apr 2019 | 25 Apr 2024 | 24 Apr 2025 |
| 715 | allenselectronics.com | Wild West Domains, LLC | 22 May 2019 | 22 May 2019 | 22 May 2020 |
| 716 | allensbronx.com | GoDaddy.com, LLC | 10 Jun 2015 | 10 Jun 2015 | 10 Jun 2016 |
| 717 | allensmuelsap.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 718 | allensellsnaples.com | GoDaddy.com, LLC | 15 Jun 2015 | 15 Jun 2015 | 15 Jun 2016 |
| 719 | allensellsmarco.com | GoDaddy.com, LLC | 15 Jun 2015 | 15 Jun 2015 | 15 Jun 2016 |
| 720 | allenstaffinginc.biz | Tucows Domains Inc. | 15 Jun 2015 | 15 Jun 2015 | 14 Jun 2016 |
| 721 | allenspiegel.com | Tucows Domains Inc. | 2 Apr 2020 | 1 Apr 2024 | 2 Apr 2025 |
| 722 | allenspersonalsafety.com | GoDaddy.com, LLC | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 723 | allensdoors.com | GoDaddy.com, LLC | 15 Jun 2015 | 18 Sep 2022 | 15 Jun 2025 |
| 724 | allenshauling.com | NameCheap, Inc. | 16 Jun 2015 | 17 May 2024 | 16 Jun 2025 |
| 725 | allenstreeterforsheriff.com | GoDaddy.com, LLC | 19 Sep 2015 | 19 Sep 2015 | 19 Sep 2017 |
| 726 | allenstreetproductions.com | GoDaddy.com, LLC | 14 Apr 2020 | 26 Apr 2024 | 14 Apr 2025 |
| 727 | allenstafford.org | GoDaddy.com, LLC | 16 Jun 2015 | 31 Jul 2023 | 16 Jun 2025 |
| 728 | allenswatersmeet.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 8 May 2023 | 8 May 2024 | 8 May 2024 |
| 729 | allensridge.com | eNom, Inc. | 20 Sep 2015 | 20 Sep 2015 | 20 Sep 2016 |
| 730 | allenseale.com | register.com, Inc. | 21 Jun 2015 | 21 Jun 2015 | 21 Jun 2016 |
| 731 | allensailracerprofiles.com | GoDaddy.com, LLC | 21 Jun 2015 | 21 Jun 2015 | 21 Jun 2016 |
| 732 | allensherrill.com | Google, Inc. | 21 Sep 2015 | 23 Apr 2024 | 21 Sep 2028 |
| 733 | allensvans.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2016 |
| 734 | allenscarsale.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2016 |
| 735 | allenstireandbrake.com | Wild West Domains, LLC | 23 Jun 2015 | 26 Feb 2023 | 23 Jun 2024 |
| 736 | allenshaun.com | GoDaddy.com, LLC | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2017 |
| 737 | allensoardphotography.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 738 | allenslhariff.com | Tucows Domains Inc. | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 739 | allensfriedchickenonline.com | CloudFlare, Inc. | 25 Jun 2015 | 27 Mar 2024 | 25 Jun 2025 |
| 740 | allenslists.com | GoDaddy.com, LLC | 22 Sep 2015 | 22 Sep 2015 | 22 Sep 2016 |
| 741 | allensbackyard.com | Dynadot, LLC | 28 Jan 2024 | 29 Jan 2024 | 28 Jan 2025 |
| 742 | allenspcb.com | GoDaddy.com, LLC | 26 Jun 2015 | 27 Jun 2023 | 26 Jun 2024 |
| 743 | allenschimneysweepservicellc.com | GoDaddy.com, LLC | 26 Jun 2015 | 26 Jun 2023 | 26 Jun 2024 |
| 744 | allenstern.net | CommuniGal Communication Ltd. | 18 Sep 2023 | 27 Sep 2023 | 18 Sep 2024 |
| 745 | allensautosalesdevilslake.com | GoDaddy.com, LLC | 16 Jul 2017 | 17 Jul 2023 | 16 Jul 2024 |
| 746 | allenswilson.com | GoDaddy.com, LLC | 1 Jul 2015 | 11 Oct 2022 | 1 Jul 2025 |
| 747 | allensbigblog.com | GoDaddy.com, LLC | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2017 |
| 748 | allensrestaurantbronx.com | Tucows Domains Inc. | 23 Sep 2015 | 30 Aug 2016 | 23 Sep 2017 |
| 749 | allenseremakphoto.com | GMO Internet Inc. | 24 Sep 2015 | 29 Sep 2016 | 23 Sep 2017 |
| 750 | allenscustomclubs.com | GMO Internet Inc. | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 751 | allenscai.com | - | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2017 |
| 752 | allenswilson.org | Domain.com, LLC | 1 Jul 2015 | 11 Jun 2022 | 1 Jul 2025 |
| 753 | allensarlo.net | Wild West Domains, LLC | 3 Jul 2015 | 3 Jul 2015 | 3 Jul 2016 |
| 754 | allensarlo.org | Wild West Domains, LLC | 3 Jul 2015 | 3 Jul 2015 | 3 Jul 2016 |
| 755 | allensfriedchicken-macclesfield.com | Tucows Domains Inc. | 3 Jul 2014 | 7 Jul 2015 | 3 Jul 2016 |
| 756 | allensaquaticadventures.com | Internet Domain Services BS Corp | 6 Jul 2015 | 12 Jun 2017 | 6 Jul 2018 |
| 757 | allenstars.com | GoDaddy.com, LLC | 9 Jul 2015 | 18 Sep 2022 | 9 Jul 2025 |
| 758 | allensbar.com | DropCatch.com 1070 LLC | 1 Dec 2017 | 1 Dec 2017 | 1 Dec 2018 |
| 759 | allensamuelsforthworthupgrade.com | eNom, Inc. | 9 Jul 2015 | 9 Jul 2015 | 9 Jul 2016 |
| 760 | allensong.org | HiChina Zhicheng Technology Limited | 6 Jul 2015 | 7 Jul 2017 | 6 Jul 2018 |
| 761 | allensamuelsfwreward.com | eNom, Inc. | 10 Jul 2015 | 10 Jul 2015 | 10 Jul 2016 |
| 762 | allensamuelsfwprize.com | eNom, Inc. | 10 Jul 2015 | 10 Jul 2015 | 10 Jul 2016 |
| 763 | allensamuelsfwoffer.com | eNom, Inc. | 10 Jul 2015 | 10 Jul 2015 | 10 Jul 2016 |
| 764 | allensamuelsfwgift.com | eNom, Inc. | 10 Jul 2015 | 10 Jul 2015 | 10 Jul 2016 |
| 765 | allensamuelsfwcard.com | eNom, Inc. | 10 Jul 2015 | 10 Jul 2015 | 10 Jul 2016 |
| 766 | allensamuelsfwbonus.com | eNom, Inc. | 10 Jul 2015 | 10 Jul 2015 | 10 Jul 2016 |
| 767 | allensriteway.com | Beijing Lanhai Jiye Technology Co., Ltd | 25 Mar 2022 | 28 Feb 2024 | 25 Mar 2025 |
| 768 | allensautorepairsales.com | GoDaddy.com, LLC | 13 Jul 2015 | 13 Jul 2015 | 13 Jul 2016 |
| 769 | allens-treasure-house.com | OnlineNIC, Inc. | 26 May 2014 | 26 Apr 2024 | 26 May 2025 |
| 770 | allensarlo.info | Wild West Domains, LLC | 16 Jul 2015 | - | 16 Jul 2016 |
| 771 | allensplumbingif.com | GoDaddy.com, LLC | 17 Jul 2015 | 17 Jul 2015 | 17 Jul 2016 |
| 772 | allensjung.com | eNom, Inc. | 17 Jul 2015 | 20 Jul 2017 | 17 Jul 2017 |
| 773 | allenscleanandtidy.com | GoDaddy.com, LLC | 24 Apr 2023 | 25 Apr 2024 | 24 Apr 2025 |
| 774 | allensphotographyvideo.com | Network Solutions, LLC | 1 Mar 2018 | 5 Apr 2024 | 1 Mar 2027 |
| 775 | allensnutrition.com | GoDaddy.com, LLC | 20 Jul 2015 | 20 Jul 2015 | 20 Jul 2016 |
| 776 | allensedmonds.com | - | 20 Jul 2015 | 20 Jul 2015 | 20 Jul 2017 |
| 777 | allenscoresit.com | GoDaddy.com, LLC | 20 Jul 2015 | 20 Jul 2015 | 20 Jul 2016 |
| 778 | allensretirement.com | TPP Wholesale Pty Ltd. | 29 Sep 2015 | 29 Sep 2015 | 29 Sep 2017 |
| 779 | allensmhrvsupplies.com | eNom, Inc. | 21 Jul 2015 | 20 Jul 2023 | 21 Jul 2024 |
| 780 | allensmhrv.com | eNom, Inc. | 21 Jul 2015 | 20 Jul 2023 | 21 Jul 2024 |
| 781 | allenscakeshop.com | eNom, Inc. | 21 Jul 2015 | 21 Jul 2015 | 21 Jul 2016 |
| 782 | allensheriff.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Jul 2015 | 22 Jul 2015 | 21 Jul 2016 |
| 783 | allensarlo.biz | Wild West Domains, LLC | 23 Jul 2015 | 23 Jul 2015 | 22 Jul 2016 |
| 784 | allenstreetgrillpsu.com | eNom, Inc. | 29 Sep 2015 | 31 Aug 2016 | 29 Sep 2017 |
| 785 | allenscondo1.com | - | - | - | - |
| 786 | allensanchez.com | - | 14 Dec 2022 | 15 Feb 2024 | 14 Dec 2023 |
| 787 | allens-well.com | Tucows Domains Inc. | 24 Jul 2013 | 28 Jul 2015 | 24 Jul 2016 |
| 788 | allensplace.org | FastDomain Inc. | 21 Jun 2011 | 12 Jun 2023 | 21 Jun 2024 |
| 789 | allensamueltyler.com | GoDaddy.com, LLC | 30 Sep 2015 | 30 Sep 2015 | 30 Sep 2016 |
| 790 | allensusedcarsnc.com | eNom, Inc. | 22 Oct 2018 | 2 Sep 2023 | 22 Oct 2024 |
| 791 | allensrecyclingtx.com | Tucows Domains Inc. | 26 Jul 2012 | 30 Jul 2015 | 26 Jul 2016 |
| 792 | allensolarequipment.com | eNom, Inc. | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 793 | allenslab.com | NameCheap, Inc. | 2 Oct 2015 | 7 Sep 2021 | 2 Oct 2030 |
| 794 | allensheriff.com | - | 1 Oct 2015 | 1 Oct 2015 | 1 Oct 2017 |
| 795 | allensdepot.com | GoDaddy.com, LLC | 12 Jan 2020 | 12 Jan 2020 | 12 Jan 2021 |
| 796 | allensolarcontractor.com | eNom, Inc. | 30 Jul 2015 | 30 Jul 2015 | 30 Jul 2016 |
| 797 | allensfoundationsaustin.com | Tucows Domains Inc. | 30 Jul 2015 | 3 Aug 2017 | 30 Jul 2017 |
| 798 | allensp201423.com | Melbourne IT, Ltd | 1 Aug 2015 | 1 Aug 2015 | 1 Aug 2016 |
| 799 | allenscustompainting.com | GoDaddy.com, LLC | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2016 |
| 800 | allensfamilypractice.com | Network Solutions, LLC | 31 Jul 2007 | 13 May 2024 | 31 Jul 2024 |
| 801 | allensadventures.net | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Aug 2015 | 2 Aug 2015 | 2 Aug 2016 |
| 802 | allensharif.com | - | 4 Aug 2015 | 4 Aug 2015 | 4 Aug 2017 |
| 803 | allenscarpetcleaning.com | eNom, Inc. | 5 Aug 2015 | 28 Jul 2022 | 5 Aug 2024 |
| 804 | allenstelephone.com | GMO Internet Inc. | 13 Aug 2021 | 13 Aug 2021 | 13 Aug 2022 |
| 805 | allenswholesalecompany.com | - | - | - | - |
| 806 | allensieautomation.com | GoDaddy.com, LLC | 6 Aug 2015 | 6 Aug 2015 | 6 Aug 2016 |
| 807 | allenspurgeon.com | Google, Inc. | 7 Aug 2015 | 7 Aug 2016 | 7 Aug 2017 |
| 808 | allensodfarm.com | GoDaddy.com, LLC | 8 Aug 2015 | 19 Sep 2022 | 8 Aug 2025 |
| 809 | allensestateagents.com | eNom, Inc. | 17 Jun 2019 | 17 Jun 2019 | 17 Jun 2020 |
| 810 | allensellsraleigh.com | GoDaddy.com, LLC | 12 Feb 2020 | 12 Feb 2020 | 12 Feb 2022 |
| 811 | allensuniform.com | Above.com Pty Ltd. | 10 Aug 2015 | 17 Jan 2020 | 10 Aug 2024 |
| 812 | allensexcavating.com | - | 22 Aug 2023 | 23 Aug 2023 | 22 Aug 2024 |
| 813 | allensboots.rodeo | Uniregistrar Corp | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 814 | allenschott.org | GoDaddy.com, LLC | 4 Oct 2015 | 18 Nov 2023 | 4 Oct 2024 |
| 815 | allenschott.info | GoDaddy.com, LLC | 4 Oct 2015 | 18 Nov 2023 | 4 Oct 2024 |
| 816 | allenschott.com | GoDaddy.com, LLC | 4 Oct 2015 | 5 Oct 2023 | 4 Oct 2024 |
| 817 | allenschott.biz | GoDaddy.com, LLC | 4 Oct 2015 | 9 Oct 2023 | 3 Oct 2024 |
| 818 | allensonsapp.com | GoDaddy.com, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 819 | allensfasters.com | GoDaddy.com, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 820 | allensindy.com | Launchpad, Inc. | 11 Oct 2015 | 26 Sep 2023 | 11 Oct 2024 |
| 821 | allensaid.review | Chengdu West Dimension Digital Technology Co., Ltd… | 12 Oct 2015 | - | 11 Oct 2016 |
| 822 | allenscreaturecomforts.net | GoDaddy.com, LLC | 13 Oct 2015 | 13 Oct 2015 | 13 Oct 2017 |
| 823 | allensautomotiveandtowing1.com | Network Solutions, LLC | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2016 |
| 824 | allenstowncarpetcleaning.com | eNom, Inc. | 15 Oct 2015 | 30 Sep 2016 | 15 Oct 2017 |
| 825 | allenstechsupport.com | Google, Inc. | 6 Apr 2016 | 6 Apr 2024 | 6 Apr 2025 |
| 826 | allensddc.com | eNom, Inc. | 18 Oct 2015 | 18 Oct 2015 | 18 Oct 2016 |
| 827 | allensqualitycarpetcleaning.com | Tucows Domains Inc. | 20 Oct 2015 | 24 Oct 2017 | 20 Oct 2017 |
| 828 | allenswelldrillinginc.net | register.com, Inc. | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 829 | allensbeachhidaway.com | GoDaddy.com, LLC | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 830 | allensafetysigns.com | - | 29 Sep 2011 | 29 Sep 2011 | 29 Sep 2017 |
| 831 | allenstewart.org | GoDaddy.com, LLC | 23 Oct 2015 | 17 Sep 2016 | 23 Oct 2017 |
| 832 | allenstewart.info | TLDs LLC dba SRSplus | 1 Nov 2021 | 3 Nov 2023 | 1 Nov 2024 |
| 833 | allenscoldbrew.com | eNom, Inc. | 24 Oct 2015 | 24 Oct 2015 | 24 Oct 2016 |
| 834 | allensprinting.com | GoDaddy.com, LLC | 7 Jun 2019 | 8 Jun 2023 | 7 Jun 2024 |
| 835 | allensamuelstx.com | GoDaddy.com, LLC | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2020 |
| 836 | allensamuelstexas.com | GoDaddy.com, LLC | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2020 |
| 837 | allensamuelsenterprises.com | GoDaddy.com, LLC | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2020 |
| 838 | allensamuelsautos.com | GoDaddy.com, LLC | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2020 |
| 839 | allensamuelsautogroup.com | GoDaddy.com, LLC | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2020 |
| 840 | allensamuels.org | GoDaddy.com, LLC | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2016 |
| 841 | allensamuels.net | Domain.com, LLC | 26 Oct 2015 | 11 Oct 2023 | 26 Oct 2024 |
| 842 | allensamuels.info | GoDaddy.com, LLC | 26 Oct 2015 | - | 26 Oct 2016 |
| 843 | allensamuels.biz | GoDaddy.com, LLC | 26 Oct 2015 | 26 Oct 2015 | 25 Oct 2016 |
| 844 | allensystemsgroup.net | DomainPeople, Inc. | 27 Oct 2015 | 12 Oct 2023 | 27 Oct 2024 |
| 845 | allenspetresort.info | Network Solutions, LLC | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 846 | allenshauntedhayride.com | Key-Systems GmbH | 29 Oct 2015 | 29 Oct 2015 | 29 Oct 2016 |
| 847 | allensrestaurantandlounge.com | register.com, Inc. | 30 Oct 2015 | 30 Oct 2015 | 30 Oct 2016 |
| 848 | allensbacherzentrum.com | GoDaddy.com, LLC | 30 Oct 2015 | 30 Oct 2015 | 30 Oct 2016 |
| 849 | allensarlo1.com | Wild West Domains, LLC | 1 Nov 2015 | 1 Nov 2015 | 1 Nov 2016 |
| 850 | allenstudio6.com | eNom, Inc. | 2 Nov 2015 | 1 Oct 2016 | 2 Nov 2017 |
| 851 | allensullivan.photo | eNom, Inc. | 25 Oct 2015 | 13 Mar 2017 | 25 Oct 2017 |
| 852 | allensalleycafe.info | Network Solutions, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 853 | allenstonerlawal.com | Tucows Domains Inc. | 5 Nov 2015 | 9 Nov 2018 | 5 Nov 2018 |
| 854 | allensparkexcavation.com | GoDaddy.com, LLC | 7 Nov 2015 | 7 Nov 2015 | 7 Nov 2017 |
| 855 | allenschroedermusic.com | Tucows Domains Inc. | 27 Mar 2018 | 31 Mar 2020 | 27 Mar 2020 |
| 856 | allenscleanup.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 857 | allensawyer.com | GoDaddy.com, LLC | 7 Nov 2015 | 20 Sep 2022 | 7 Nov 2025 |
| 858 | allensun.net | HiChina Zhicheng Technology Limited | 9 Nov 2015 | 9 Nov 2015 | 9 Nov 2016 |
| 859 | allensun.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Nov 2015 | - | 9 Nov 2016 |
| 860 | allenstreeserviceusmc.com | Tucows Domains Inc. | 9 Nov 2015 | 11 Oct 2023 | 9 Nov 2024 |
| 861 | allenstowingky.com | GoDaddy.com, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 862 | allenstaxidermystudio.com | GMO Internet Inc. | 17 Jan 2017 | 17 Nov 2017 | 16 Jan 2019 |
| 863 | allensignsinc.com | - | 29 Jan 2024 | 1 Feb 2024 | 29 Jan 2025 |
| 864 | allensnaps.com | GoDaddy.com, LLC | 1 Oct 2021 | 13 Dec 2023 | 1 Oct 2023 |
| 865 | allensautogroup.com | GoDaddy.com, LLC | 6 Sep 2021 | 17 Sep 2023 | 6 Sep 2024 |
| 866 | allensagatro.com | GoDaddy.com, LLC | 13 Nov 2015 | 13 Nov 2015 | 13 Nov 2016 |
| 867 | allensphotographyvideo.net | Tucows Domains Inc. | 14 Nov 2015 | 18 Nov 2018 | 14 Nov 2018 |
| 868 | allensweetandcarter.com | Tucows Domains Inc. | 16 Nov 2015 | 20 Nov 2017 | 16 Nov 2017 |
| 869 | allenssafeandlocksmith.com | GoDaddy.com, LLC | 16 Nov 2015 | 17 Nov 2023 | 16 Nov 2024 |
| 870 | allensgiftshoppe.com | register.com, Inc. | 16 Nov 2015 | 4 Nov 2016 | 16 Nov 2017 |
| 871 | allensas.trade | OVH sas | 16 Nov 2015 | 16 Nov 2015 | 15 Nov 2016 |
| 872 | allensseamlessgutters.net | GoDaddy.com, LLC | 18 Nov 2015 | 18 Nov 2015 | 18 Nov 2016 |
| 873 | allensoillawsuit.com | GoDaddy.com, LLC | 18 Nov 2015 | 18 Nov 2015 | 18 Nov 2017 |
| 874 | allensrealestategroup.com | GoDaddy.com, LLC | 19 Nov 2015 | 19 Nov 2015 | 19 Nov 2017 |
| 875 | allensruiz.com | GoDaddy.com, LLC | 21 Nov 2015 | 21 Nov 2015 | 21 Nov 2016 |
| 876 | allensupport.com | Dynamic Network Services, Inc. | 21 Nov 2015 | 21 Nov 2015 | 21 Nov 2016 |
| 877 | allenstire.com | Wild West Domains, LLC | 21 Nov 2015 | 4 Nov 2023 | 21 Nov 2024 |
| 878 | allensmalley.com | One.com A/S | 14 May 2024 | 16 May 2024 | 14 May 2025 |
| 879 | allenstrategiesllc.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Nov 2015 | 20 Nov 2023 | 24 Nov 2024 |
| 880 | allenservicesllc.biz | NameCheap, Inc. | 25 Nov 2015 | 25 Nov 2015 | 24 Nov 2016 |
| 881 | allensasphalt.info | Network Solutions, LLC | 25 Nov 2015 | 25 Nov 2015 | 25 Nov 2016 |
| 882 | allensflorist.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Nov 2015 | 19 Jan 2024 | 25 Nov 2024 |
| 883 | allenstults.info | Network Solutions, LLC | 29 Nov 2015 | 29 Nov 2015 | 29 Nov 2016 |
| 884 | allenses.com | HiChina Zhicheng Technology Limited | 29 Nov 2015 | 8 Nov 2023 | 29 Nov 2024 |
| 885 | allensrcplanes.com | eNom, Inc. | 1 Dec 2015 | 1 Dec 2015 | 1 Dec 2016 |
| 886 | allensfirstaid.com | Crazy Domains FZ-LLC | 2 Dec 2015 | 13 Dec 2018 | 2 Dec 2018 |
| 887 | allenselectronicsplaza.com | Wild West Domains, LLC | 27 Nov 2015 | 27 Nov 2015 | 27 Nov 2016 |
| 888 | allensportugal.com | Tucows Domains Inc. | 4 Dec 2015 | 8 Dec 2022 | 4 Dec 2023 |
| 889 | allensworthrealty.com | GoDaddy.com, LLC | 7 Dec 2015 | 8 Dec 2022 | 7 Dec 2024 |
| 890 | allenswealth.com | Tucows Domains Inc. | 6 Dec 2012 | 6 Nov 2023 | 6 Dec 2024 |
| 891 | allenstuart.com | GoDaddy.com, LLC | 26 Jul 2021 | 26 Jul 2021 | 26 Jul 2022 |
| 892 | allens4seasonslawncare.com | register.com, Inc. | 7 Dec 2015 | 7 Dec 2015 | 7 Dec 2016 |
| 893 | allensrecruitmentsolutions.com | eNom, Inc. | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2017 |
| 894 | allenselectricalservices.net | GoDaddy.com, LLC | 12 Dec 2015 | 12 Dec 2015 | 12 Dec 2016 |
| 895 | allenselectricalservices.com | GoDaddy.com, LLC | 12 Dec 2015 | 12 Dec 2015 | 12 Dec 2017 |
| 896 | allensacks.bid | Chengdu West Dimension Digital Technology Co., Ltd… | 13 Dec 2015 | - | 12 Dec 2016 |
| 897 | allenscrackertownoflithia.com | GoDaddy.com, LLC | 14 Dec 2015 | 14 Dec 2015 | 14 Dec 2016 |
| 898 | allensteardesigns.com | Network Solutions, LLC | 31 Dec 2023 | 13 Jan 2024 | 31 Dec 2024 |
| 899 | allensnell.com | Squarespace Domains LLC | 7 May 2024 | 7 May 2024 | 7 May 2025 |
| 900 | allenside.com | register.com, Inc. | 19 Dec 2015 | 19 Dec 2015 | 19 Dec 2017 |
| 901 | allensmutzer.com | GoDaddy.com, LLC | 20 Dec 2015 | 20 Dec 2015 | 20 Dec 2017 |
| 902 | allensfinejewelry.biz | Domain.com, LLC | 20 Dec 2015 | 11 Jan 2023 | 19 Dec 2026 |
| 903 | allens-fine-jewelry.net | Domain.com, LLC | 20 Dec 2015 | 2 May 2016 | 20 Dec 2017 |
| 904 | allens-fine-jewelry.com | GoDaddy.com, LLC | 17 Apr 2019 | 17 Apr 2019 | 17 Apr 2020 |
| 905 | allensmathacademy.com | Network Solutions, LLC | 22 Dec 2015 | 22 Dec 2015 | 22 Dec 2016 |
| 906 | allenshousing.com | Webfusion Ltd. | 22 Dec 2015 | 15 Dec 2023 | 22 Dec 2025 |
| 907 | allensgreatdeals.com | GoDaddy.com, LLC | 24 Dec 2015 | 9 Dec 2016 | 24 Dec 2017 |
| 908 | allenstrafficandleads.com | eNom, Inc. | 27 Dec 2015 | 27 Dec 2015 | 27 Dec 2016 |
| 909 | allensusspodcast.com | Wild West Domains, LLC | 29 Dec 2015 | 29 Dec 2015 | 29 Dec 2016 |
| 910 | allenschneiderdds.com | GoDaddy.com, LLC | 28 Dec 2018 | 28 Dec 2018 | 28 Dec 2019 |
| 911 | allenscabinetry.com | GoDaddy.com, LLC | 29 Dec 2015 | 29 Dec 2015 | 29 Dec 2016 |
| 912 | allensbuyhouses.com | GoDaddy.com, LLC | 30 Dec 2015 | 30 Dec 2015 | 30 Dec 2017 |
| 913 | allensbuiltins.com | GoDaddy.com, LLC | 29 Dec 2015 | 29 Dec 2015 | 29 Dec 2016 |
| 914 | allensvarietystore.com | Tucows Domains Inc. | 30 Dec 2015 | 3 Jan 2017 | 30 Dec 2016 |
| 915 | allenshao.com | HiChina Zhicheng Technology Limited | 30 Dec 2015 | 30 Dec 2015 | 30 Dec 2016 |
| 916 | allensautotow.com | eNom, Inc. | 31 Dec 2015 | 2 Dec 2023 | 31 Dec 2024 |
| 917 | allenstrong.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Apr 2024 | 2 Jun 2024 | 2 Apr 2025 |
| 918 | allenstudioincorporated.com | GoDaddy.com, LLC | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2017 |
| 919 | allensgoodies.com | GoDaddy.com, LLC | 3 Jan 2016 | 4 Jan 2024 | 3 Jan 2026 |
| 920 | allens-tree-service.com | GoDaddy.com, LLC | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2017 |
| 921 | allenstyles.com | Upperlink Limited | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 922 | allensnaturally.com | GoDaddy.com, LLC | 12 Apr 1999 | 13 Sep 2022 | 12 Apr 2026 |
| 923 | allensflowermarketonline.com | Nameemperor.com LLC | 13 Sep 2023 | 22 Apr 2024 | 13 Sep 2024 |
| 924 | allenscapecod.com | - | 24 May 2023 | 15 Apr 2024 | 24 May 2025 |
| 925 | allenscamera.net | Network Solutions, LLC | 3 Oct 2002 | 7 Feb 2024 | 3 Oct 2030 |
| 926 | allens-rw-photography.com | Tucows Domains Inc. | 4 Jan 2007 | 3 Jan 2023 | 4 Jan 2026 |
| 927 | allens-eyes.com | Network Solutions, LLC | 6 Jan 2016 | 4 Jan 2017 | 6 Jan 2018 |
| 928 | allensigmon.com | FastDomain Inc. | 22 Aug 2011 | 5 Apr 2024 | 22 Aug 2025 |
| 929 | allenspecter.com | Network Solutions, LLC | 7 Jan 2016 | 5 Mar 2017 | 7 Jan 2017 |
| 930 | allensamuelstrade.com | GoDaddy.com, LLC | 7 Jan 2016 | 7 Jan 2016 | 7 Jan 2017 |
| 931 | allensprobateservices.com | Webfusion Ltd. | 8 Jan 2016 | 1 Jan 2017 | 8 Jan 2018 |
| 932 | allenship.com | FastDomain Inc. | 17 Sep 2020 | 3 Sep 2023 | 17 Sep 2024 |
| 933 | allenserwer.com | Domain.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 934 | allensadventuretravelagency.com | GoDaddy.com, LLC | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2018 |
| 935 | allensystemsservice.com | GoDaddy.com, LLC | 11 Jan 2016 | 11 Jan 2016 | 11 Jan 2017 |
| 936 | allensparrow.com | Google, Inc. | 26 Apr 2020 | 27 Apr 2024 | 26 Apr 2025 |
| 937 | allenstopsales.info | 1&1 Internet AG | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 938 | allenslifebookspublishingco.com | eNom, Inc. | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 939 | allenscottconstruction.com | NameKing.com Inc. | 3 Apr 2023 | 1 May 2024 | 3 Apr 2025 |
| 940 | allensautoelectric.com | GoDaddy.com, LLC | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 941 | allenswts.com | GoDaddy.com, LLC | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 942 | allensworthpolytechnicalinstitute.com | eNom, Inc. | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 943 | allensparkdrive.com | DNC Holdings, Inc. | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 944 | allenscience.com | DropCatch.com 1417 LLC | 5 Apr 2018 | 5 Apr 2018 | 5 Apr 2019 |
| 945 | allenstoutteam.com | Tucows Domains Inc. | 14 Jan 2014 | 18 Jan 2016 | 14 Jan 2017 |
| 946 | allensplumbingrepairs.com | Tucows Domains Inc. | 15 Jan 2014 | 19 Jan 2016 | 15 Jan 2017 |
| 947 | allensaerial.com | 1&1 Internet AG | 18 Jan 2016 | 23 Jun 2017 | 18 Jan 2020 |
| 948 | allenscottsch.com | Google, Inc. | 19 Jan 2016 | 19 Jan 2016 | 19 Jan 2017 |
| 949 | allenstopsales.com | 1&1 Internet AG | 21 Jan 2016 | 22 Jan 2016 | 21 Jan 2017 |
| 950 | allensgallery.com | Hosting Concepts B.V. dba Openprovider | 20 Mar 2024 | 28 Mar 2024 | 20 Mar 2025 |
| 951 | allensarchitecture.com | 1API GmbH | 21 Jan 2016 | 21 Jan 2016 | 21 Jan 2017 |
| 952 | allensker.com | InsaneNames LLC | 9 Apr 2017 | 9 Apr 2017 | 9 Apr 2018 |
| 953 | allenshvac.net | DomainPeople, Inc. | 3 May 2024 | 3 May 2024 | 3 May 2025 |
| 954 | allenstonecontest.com | register.com, Inc. | 22 Jan 2016 | 7 Jan 2017 | 22 Jan 2018 |
| 955 | allensindiankitchen.com | Tucows Domains Inc. | 22 Jan 2016 | 26 Jan 2018 | 22 Jan 2018 |
| 956 | allensmhp.com | PSI-USA, Inc. dba Domain Robot | 23 Jan 2016 | 14 Mar 2017 | 23 Jan 2018 |
| 957 | allensouthernproperties.com | Tucows Domains Inc. | 26 Jan 2016 | 11 Jan 2024 | 26 Jan 2025 |
| 958 | allensmobileautowash.com | GoDaddy.com, LLC | 19 May 2022 | 20 May 2024 | 19 May 2025 |
| 959 | allenslandinghouston.com | eNom, Inc. | 27 Jan 2016 | 26 Jan 2016 | 27 Jan 2018 |
| 960 | allenscleaningservicemo.com | GoDaddy.com, LLC | 26 Jan 2016 | 26 Jan 2016 | 26 Jan 2017 |
| 961 | allensafeandcleancompany.com | - | 2 Jun 2022 | 4 Jul 2023 | 2 Jun 2023 |
| 962 | allenstrashhauling.com | GoDaddy.com, LLC | 2 Feb 2022 | 3 Feb 2024 | 2 Feb 2025 |
| 963 | allensallaroundautorepairstarke.com | CSC Corporate Domains, Inc. | 27 Jan 2016 | 23 Jan 2017 | 27 Jan 2018 |
| 964 | allenslandscapes.com | GoDaddy.com, LLC | 20 Aug 2010 | 21 Aug 2023 | 20 Aug 2024 |
| 965 | allenstjohn.org | eNom, Inc. | 29 Jan 2016 | 13 Mar 2017 | 29 Jan 2018 |
| 966 | allenstjohn.net | eNom, Inc. | 29 Jan 2016 | 3 Jan 2017 | 29 Jan 2018 |
| 967 | allensshoes.com | DROPCATCH.COM 810 LLC | 29 Jan 2016 | 30 Jan 2017 | 29 Jan 2018 |
| 968 | allenshomeimprovement.com | GoDaddy.com, LLC | 31 May 2021 | 3 Jun 2024 | 31 May 2027 |
| 969 | allenswisher-overworldproductions.com | Network Solutions, LLC | 31 Jan 2016 | 31 Jan 2016 | 31 Jan 2018 |
| 970 | allensserviceco.com | eNom, Inc. | 31 Jan 2016 | 24 Jan 2019 | 31 Jan 2020 |
| 971 | allensvideogameroom.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Feb 2016 | 1 Feb 2016 | 1 Feb 2017 |
| 972 | allensinglelifefinale.xyz | NameCheap, Inc. | 3 Feb 2016 | 3 Feb 2016 | 3 Feb 2017 |
| 973 | allenseto.com | FastDomain Inc. | 3 Feb 2016 | 19 Jan 2024 | 3 Feb 2025 |
| 974 | allenscustomhomes.com | GoDaddy.com, LLC | 4 Feb 2016 | 20 Sep 2022 | 4 Feb 2026 |
| 975 | allenslocksmithing.com | GoDaddy.com, LLC | 5 Feb 2016 | 6 Feb 2024 | 5 Feb 2025 |
| 976 | allensexcavation.com | Tucows Domains Inc. | 3 Feb 2012 | 7 Feb 2016 | 3 Feb 2017 |
| 977 | allensafefood.com | GoDaddy.com, LLC | 8 Feb 2016 | 8 Feb 2016 | 8 Feb 2017 |
| 978 | allensstoneworkz.com | Tucows Domains Inc. | 8 Feb 2011 | 12 Feb 2016 | 8 Feb 2017 |
| 979 | allensllc.com | GoDaddy.com, LLC | 16 Oct 2019 | 16 Oct 2019 | 16 Oct 2020 |
| 980 | allensindiancuisine.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 11 Feb 2016 | 11 Feb 2016 | 11 Feb 2017 |
| 981 | allensaffordableappliance.com | Tucows Domains Inc. | 7 Feb 2012 | 11 Feb 2016 | 7 Feb 2017 |
| 982 | allensweb.net | Google, Inc. | 13 Dec 2019 | 13 Dec 2019 | 13 Dec 2020 |
| 983 | allensofbattersea.com | BB Online Ltd | 12 Feb 2016 | 12 Feb 2016 | 12 Feb 2018 |
| 984 | allensnortheastwaterdamage.com | GMO Internet Inc. | 13 Feb 2016 | 28 Feb 2017 | 12 Feb 2018 |
| 985 | allenslawncare.org | eNom, Inc. | 13 Feb 2016 | 13 Feb 2016 | 13 Feb 2017 |
| 986 | allensgymbunnies.com | Tucows Domains Inc. | 14 Feb 2016 | 18 Feb 2021 | 14 Feb 2021 |
| 987 | allensjourney.com | TurnCommerce, Inc. DBA NameBright.com | 12 Jan 2022 | 23 Aug 2022 | 12 Jan 2024 |
| 988 | allenspirits.com | GoDaddy.com, LLC | 15 Feb 2016 | 15 Feb 2016 | 15 Feb 2018 |
| 989 | allens-auctions.com | register.com, Inc. | 16 Feb 2016 | 18 Feb 2024 | 16 Feb 2025 |
| 990 | allenstoneshop.com | Internet Domain Services BS Corp | 16 Feb 2016 | 17 Feb 2016 | 16 Feb 2017 |
| 991 | allenstonegiveaway.com | FastDomain Inc. | 18 Feb 2016 | 18 Feb 2017 | 18 Feb 2018 |
| 992 | allensoriano.com | Google, Inc. | 18 Feb 2016 | 20 Mar 2024 | 18 Feb 2025 |
| 993 | allensozialennetzwerken.com | 1&1 Internet AG | 19 Feb 2016 | 11 Jan 2018 | 19 Feb 2025 |
| 994 | allensnape.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Feb 2016 | - | 20 Feb 2017 |
| 995 | allensconeyisland.com | NameCheap, Inc. | 16 Feb 2013 | 17 Jan 2024 | 16 Feb 2025 |
| 996 | allenspointbaptist.com | Tucows Domains Inc. | 12 Jul 2021 | 13 Jun 2023 | 12 Jul 2024 |
| 997 | allensd.info | Network Solutions, LLC | 23 Feb 2016 | 25 Dec 2019 | 23 Feb 2021 |
| 998 | allenstech.net | CloudFlare, Inc. | 30 Jan 2022 | 10 Mar 2024 | 30 Jan 2024 |
| 999 | allension.com | register.com, Inc. | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 1000 | allenstransfer.info | Network Solutions, LLC | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
Displaying 1,000 out of 5,638 domains starting with the keyword "ALLENS". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=allens
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |