Our database now contains whois records of 622 Million (622,659,771) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1589 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [622 Million Domains] $10,000 Details

Keyword: AIRFRYER

Reverse Whois » KEYWORD [airfryer ]  { 1,719 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1airfryer.orgDynadot, LLC24 Dec 201925 Jan 202524 Dec 2025
2airfryer.sucksCSC Corporate Domains, Inc.21 Jun 201518 May 202521 Jun 2026
3airfryer.infoKey-Systems GmbH14 Mar 202314 Jan 202514 Mar 2026
4airfryer.reviewsGoogle, Inc.23 Apr 20193 Jun 202523 Apr 2026
5airfryer.asiaGMO Internet Inc.30 May 202231 May 202330 May 2024
6airfryer.bizGoDaddy.com, LLC25 Sep 202311 Feb 202525 Sep 2025
7airfryer.philipsCSC Corporate Domains, Inc.15 Mar 201616 Mar 202515 Mar 2026
8airfryer.clubNameCheap, Inc.28 Jan 20192 Feb 201928 Jan 2020
9airfryer.top-9 Jul 202425 Sep 20249 Jul 2025
10airfryer.recipesCSC Corporate Domains, Inc.1 Apr 201425 Mar 20251 Apr 2026
11airfryer.comCSC Corporate Domains, Inc.31 Aug 201027 Aug 202431 Aug 2025
12airfryer.netGoDaddy.com, LLC16 Feb 201723 Jan 202416 Feb 2026
13airfryer.xyz-3 Mar 20224 Mar 20253 Mar 2026
14airfryer.world-1 Feb 202416 Mar 20251 Feb 2025
15airfryer.siteCommuniGal Communication Ltd.4 Jul 20242 Aug 20244 Jul 2025
16airfryer.storeTucows Domains Inc.17 Jun 202517 Jun 202517 Jun 2026
17airfryer.co.ukAcens Technologies, S.L.U.31 Aug 201014 Jul 201731 Aug 2018
18airfryer.todayGoDaddy.com, LLC15 Dec 202326 Jan 202515 Dec 2024
19airfryer.techWest263 International Limited23 Jan 202519 Feb 202523 Jan 2026
20airfryer.guideNameCheap, Inc.30 Dec 202121 Mar 202530 Dec 2025
21airfryer.pro-27 Dec 20241 Feb 202527 Dec 2025
22airfryer.guruPorkbun, LLC1 Jul 202213 Jul 20231 Jul 2024
23airfryer.menuRealtime Register B.V.8 Mar 201822 Apr 20258 Mar 2026
24airfryer.websitePDR Ltd. d/b/a PublicDomainRegistry.com9 Jan 202230 Jan 20259 Jan 2026
25airfryer.cloudHostinger, UAB29 Nov 20244 Dec 202429 Nov 2025
26airfryer.onlineRegistryGate GmbH1 Jun 20232 Jun 20251 Jun 2026
27airfryer.tipsHosting Concepts B.V. dba Openprovider8 Jun 20238 Jun 20258 Jun 2026
28airfryer.dealsPorkbun, LLC21 Aug 202430 Aug 202421 Aug 2025
29airfryer.spaceHosting Ukraine LLC12 Feb 202427 Mar 202512 Feb 2025
30airfryer.cityTucows Domains Inc.18 Jul 202122 Jul 202218 Jul 2023
31airfryer.solutionsNameCheap, Inc.24 Sep 202124 Sep 202224 Sep 2023
32airfryer.questNameCheap, Inc.27 Feb 20221 Jul 202227 Feb 2024
33airfryer.pizzaNameCheap, Inc.22 Jul 20225 Sep 202422 Jul 2025
34airfryer.ltdDNSPod, Inc.6 Sep 202230 Oct 20246 Sep 2030
35airfryer.icuHostinger, UAB16 Sep 202421 Sep 202416 Sep 2025
36airfryer.catSoluciones Corporativas IP, SLU25 Jun 2024-25 Jun 2025
37airfryer.au--23 Jan 2025-
38airfryer.oneHosting Concepts B.V. dba Openprovider20 Feb 20247 Feb 202520 Feb 2026
39airfryer.bargainsGoogle, Inc.20 Oct 202220 Oct 202320 Oct 2024
40airfryer.bestNameCheap, Inc.12 Jul 202422 Jul 202412 Jul 2025
41airfryer.appKey-Systems GmbH29 Mar 202028 Mar 202529 Mar 2026
42airfryer.com.se-21 Sep 202215 Nov 202421 Sep 2025
43airfryer.boutiqueNameCheap, Inc.14 Jul 202225 Aug 202314 Jul 2023
44airfryer.pt----
45airfryer.funHostinger, UAB7 Oct 202312 Oct 20237 Oct 2025
46airfryer.cl-15 Oct 2022-15 Oct 2023
47airfryer.ninjaPDR Ltd. d/b/a PublicDomainRegistry.com19 Feb 202330 Apr 202419 Feb 2024
48airfryer.rocksName.com, Inc.28 Feb 202312 May 202528 Feb 2025
49airfryer.plNamware.com, Inc.31 Aug 201022 Aug 202431 Aug 2025
50airfryer.cookingTucows Domains Inc.29 Aug 201730 Jun 202429 Aug 2025
51airfryer.coGoDaddy.com, LLC16 Apr 202430 May 202516 Apr 2026
52airfryer.inDynadot, LLC28 Jul 202027 Jan 202528 Jul 2026
53airfryer.com.au--13 Sep 2024-
54airfryer.ae----
55airfryer.usCSC Corporate Domains, Inc.31 Aug 201026 Aug 202430 Aug 2025
56airfryer.co.inCSC Corporate Domains, Inc.31 Aug 20101 Sep 202431 Aug 2025
57airfryer.itCSC Corporate Domains, Inc.22 Oct 201029 Jan 202513 Jan 2026
58airfryer.liveGoDaddy.com, LLC13 Jan 202518 Jan 202513 Jan 2026
59airfryer.nlCSC Corporate Domains, Inc.31 Aug 201012 Nov 2019-
60airfryer.ro-21 Apr 2021-20 Apr 2026
61airfryer.blogCommuniGal Communication Ltd.12 Jul 20242 Aug 202412 Jul 2025
62airfryer.devGoogle, Inc.6 Jun 20236 Jun 20246 Jun 2025
63airfryer.com.plNamware.com, Inc.28 Mar 20234 Mar 202528 Mar 2026
64airfryer.homesDynadot, LLC23 Jun 20232 Sep 202423 Jun 2024
65airfryer.emailNameCheap, Inc.14 Jul 202314 Jul 202414 Jul 2024
66airfryer.wikiGoDaddy.com, LLC10 Mar 202515 Mar 202510 Mar 2026
67airfryer.cfdNamesilo, LLC27 Oct 202328 Oct 202427 Oct 2025
68airfryer.monsterPorkbun, LLC4 Jan 202419 Mar 20254 Jan 2025
69airfryer.plusNameCheap, Inc.4 Jan 202417 Mar 20254 Jan 2025
70airfryer.chatGoDaddy.com, LLC5 Jan 202418 Mar 20255 Jan 2025
71airfryer.bandMesh Digital Limited10 Jan 202423 Mar 202510 Jan 2025
72airfryer.bondKey-Systems, LLC11 Feb 202422 Mar 202411 Feb 2025
73airfryer.coachCronon AG28 Feb 202414 Apr 202528 Feb 2026
74airfryer.fitnessCronon AG28 Feb 202414 Apr 202528 Feb 2026
75airfryer.lifeCronon AG28 Feb 202414 Apr 202528 Feb 2026
76airfryer.zipGoDaddy.com, LLC20 Mar 20244 May 202520 Mar 2026
77airfryer.tvCSC Corporate Domains, Inc.31 Aug 20104 Aug 202431 Aug 2025
78airfryer.beCSC Corporate Domains, Inc.3 Sep 2010--
79airfryer.com.br-1 Sep 201025 Jul 20241 Sep 2025
80airfryer.com.pt-9 Jun 2010-11 Feb 2025
81airfryer.uk-19 Dec 201813 Dec 202419 Dec 2025
82airfryer.vipAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…26 May 2021-26 May 2026
83airfryer.ru-1 Sep 2010-1 Sep 2025
84airfryer.de--21 Apr 2021-
85airfryer.fr-6 Sep 201015 Apr 202514 Apr 2026
86airfryer.cz-6 Sep 201026 Apr 20216 Sep 2025
87airfryer.atCSC Corporate Domains, Inc.-18 Apr 2019-
88airfryer.lolNameCheap, Inc.5 Aug 202414 Aug 20245 Aug 2025
89airfryer.hu-10 Jan 2022--
90airfryer.kitchenGoDaddy.com, LLC3 Nov 20248 Nov 20243 Nov 2025
91airfryer.se-1 Sep 201023 Aug 20241 Sep 2025
92airfryer.net.cn-16 Mar 2021-16 Mar 2026
93airfryer.now-7 Jan 20257 Jan 20257 Jan 2026
94airfryers.orgDynadot, LLC30 Aug 202225 Jan 202530 Aug 2025
95airfryercooking.comNameCheap, Inc.16 Dec 201616 Nov 202416 Dec 2025
96airfryerreviews.comNamesilo, LLC9 Dec 20148 Apr 20259 Dec 2025
97airfryerunited.comeNom650, Inc.21 Oct 201721 Oct 201721 Oct 2018
98airfryershop.comTurnCommerce, Inc. DBA NameBright.com13 Feb 202026 Apr 202413 Feb 2026
99airfryers.netTurnCommerce, Inc. DBA NameBright.com20 Jan 201514 Jan 202420 Jan 2026
100airfryerdepot.comNamesilo, LLC24 Oct 20217 Mar 202524 Oct 2025
101airfryeronline.comGoDaddy.com, LLC29 May 202012 Jun 202529 May 2026
102airfryerreview.netDropCatch.com 1127 LLC12 Jun 202318 Feb 202412 Jun 2026
103airfryercenter.comNameCheap, Inc.29 Jul 202210 Oct 202429 Jul 2024
104airfryerhq.com-29 Mar 20259 Apr 202529 Mar 2026
105airfryerphilips.com-17 Jul 201517 Jul 201517 Jul 2017
106airfryers.infoNameCheap, Inc.1 Dec 20246 Dec 20241 Dec 2025
107airfryerstore.comTurnCommerce, Inc. DBA NameBright.com24 Apr 202018 Apr 202124 Apr 2026
108airfryersfanatic.comGoDaddy.com, LLC16 Oct 201516 Oct 201516 Oct 2016
109airfryerviews.com-6 Dec 202410 Dec 20246 Dec 2025
110airfryerrecipes.comGoDaddy.com, LLC25 Oct 201525 Oct 202425 Oct 2025
111airfryerpro.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Apr 201715 Jun 20253 Apr 2025
112airfryerguide.comName.com, Inc.26 Jul 20189 Apr 202426 Jul 2025
113airfryerexpert.comNordreg AB18 Nov 202416 Feb 202518 Nov 2025
114airfryerjudge.comNameemperor.com LLC23 Apr 201824 Apr 202523 Apr 2026
115airfryerfood.comNameCheap, Inc.31 May 202531 May 202531 May 2026
116airfryer-recepten.comMetaregistrar BV Applications3 Dec 20243 Dec 20243 Dec 2025
117airfryersnacks.comTucows Domains Inc.22 Nov 202422 Nov 202422 Nov 2025
118airfryersnob.com1&1 Internet AG31 Dec 201531 May 201731 Dec 2017
119airfryerguide.netArsys Internet, S.L. dba NICLINE.COM22 May 202522 May 202522 May 2026
120airfryerrecepten.comKey-Systems GmbH28 Jan 202028 Jan 202528 Jan 2026
121airfryerguru.comNETIM SARL1 Jul 20241 Jul 20241 Jul 2025
122airfryerguide.clubNameCheap, Inc.12 Jan 201612 Jan 201611 Jan 2017
123airfryersdirect.comWix.com Ltd.23 Aug 202423 Aug 202423 Aug 2025
124airfryerreviewed.comNameCheap, Inc.11 Feb 201612 Jan 202511 Feb 2026
125airfryerselect.comInternet Domain Services BS Corp24 Feb 202124 Feb 202124 Feb 2022
126airfryerkings.comeNom, Inc.16 Mar 201613 Feb 201716 Mar 2018
127airfryerking.comGoDaddy.com, LLC2 Nov 202110 Oct 20222 Nov 2031
128airfryeraanbieding.comRealtime Register B.V.17 Mar 201628 Apr 202517 Mar 2025
129airfryer2.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Dec 20249 Feb 202510 Dec 2025
130airfryergleiter.comunited-domains AG8 Apr 20169 Apr 20178 Apr 2018
131airfryerhealth.comNameCheap, Inc.18 Mar 202230 May 202318 Mar 2023
132airfryerworld.comTucows Domains Inc.9 Dec 20194 Jan 20239 Dec 2026
133airfryermentor.comeNom, Inc.12 May 201612 May 201612 May 2017
134airfryerxl.comPDR Ltd. d/b/a PublicDomainRegistry.com16 May 201628 Jul 202416 May 2024
135airfryerz.comNameCheap, Inc.18 Dec 201926 Jan 202518 Dec 2025
136airfryerhub.comRegistryGate GmbH23 Nov 20235 Mar 202523 Nov 2026
137airfryers.xyzALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED18 May 202519 May 202518 May 2026
138airfryerindia.comGoDaddy.com, LLC19 Feb 202519 Feb 202519 Feb 2026
139airfryerresource.comUniregistrar Corp---
140airfryerchips.com-14 Feb 202317 Mar 202414 Feb 2024
141airfryercookbook.comGoDaddy.com, LLC8 Jun 202313 Jun 20258 Jun 2026
142airfryerreview.comTurnCommerce, Inc. DBA NameBright.com31 Jul 20139 Jul 202231 Jul 2025
143airfryers.comGoDaddy.com, LLC10 Sep 201010 Jan 202510 Sep 2027
144airfryer-reviews.comeNom, Inc.16 Jul 202116 Jul 202116 Jul 2022
145airfryermondial.com.br-29 Aug 201230 Aug 202429 Aug 2026
146airfryerexperts.comGoDaddy.com, LLC11 Feb 202125 Mar 202511 Feb 2025
147airfryerdeals.com-9 Apr 20259 Apr 20259 Apr 2026
148airfryerprice.comHostinger, UAB10 May 202510 May 202510 May 2026
149airfryerkitchen.comNameCheap, Inc.20 May 202520 May 202520 May 2026
150airfryerproducts.comGoDaddy.com, LLC10 Nov 202010 Nov 202410 Nov 2025
151airfryerdiet.comLaunchpad, Inc.20 Sep 201621 Sep 202420 Sep 2025
152airfryerreviews.co.ukeNom, Inc.10 Mar 20169 Feb 201710 Mar 2018
153airfryerguides.comPorkbun, LLC29 Sep 202217 Mar 202529 Sep 2026
154airfryerloveaffair.com-9 Oct 20169 Oct 20169 Oct 2019
155airfryersonline.comKey-Systems GmbH8 Nov 201621 Jan 20258 Nov 2025
156airfryer-frittura-sana.com1API GmbH9 Nov 201615 Dec 20179 Nov 2017
157airfryerinfo.comCronon AG14 Nov 20163 Jan 202514 Nov 2025
158airfryermasterchef.comNameCheap, Inc.14 Nov 20163 Nov 202414 Nov 2028
159airfryercooker.comGoDaddy.com, LLC6 Feb 202425 Apr 20256 Feb 2026
160airfryer-xl.comRealtime Register B.V.27 Nov 201627 Nov 201727 Nov 2017
161airfryer-shop.comBeijing Lanhai Jiye Technology Co., Ltd13 Apr 202513 Apr 202513 Apr 2026
162airfryerpopcornmaker.comGoDaddy.com, LLC3 Dec 20163 Dec 20163 Dec 2017
163airfryersforhomeuse.comeNom, Inc.4 Dec 20164 Nov 20244 Dec 2025
164airfryerblog.com-10 May 202510 May 202510 May 2026
165airfryerrecipebook.comNamesilo, LLC24 May 201825 May 202524 May 2026
166airfryer-recept.comMijn InternetOplossing B.V.21 Dec 201621 Dec 201721 Dec 2017
167airfryerzone.comNameCheap, Inc.26 Nov 202426 Nov 202426 Nov 2025
168airfryertopten.comGoDaddy.com, LLC14 Jan 201714 Jan 201714 Jan 2018
169airfryersguide.com1&1 Internet AG2 Apr 20252 Apr 20252 Apr 2026
170airfryersshop.comTucows Domains Inc.18 Nov 202229 Jan 202418 Nov 2023
171airfryers.onlineCommuniGal Communication Ltd.30 Nov 202312 Jan 202530 Nov 2024
172airfryerchef.comDropCatch.com 1512 LLC13 Apr 202414 Apr 202413 Apr 2026
173airfryeregg.comGoDaddy.com, LLC26 Jan 201726 Jan 201726 Jan 2019
174airfryergourmet.comFastDomain Inc.2 Apr 202318 Mar 20252 Apr 2026
175airfryerrecepten.netKey-Systems GmbH3 Feb 20174 Feb 20173 Feb 2018
176airfryerrecipe.comGoDaddy.com, LLC25 Jan 202023 Jan 202525 Jan 2026
177airfryerlab.comNameCheap, Inc.30 Nov 202030 Nov 202430 Nov 2025
178airfryernl.comNameCheap, Inc.13 Feb 201713 Feb 201713 Feb 2018
179airfryerbuys.comInterNetworX Ltd. & Co. KG17 Jun 20232 Jul 202417 Jun 2025
180airfryer4u.comGoDaddy.com, LLC17 Jan 202428 Feb 202517 Jan 2025
181airfryerreviews.netNameCheap, Inc.27 Aug 202427 Aug 202427 Aug 2025
182airfryerblogger.comGoDaddy.com, LLC31 Dec 202031 Dec 202031 Dec 2021
183airfryereats.comGoDaddy.com, LLC18 Oct 201823 May 202518 Oct 2025
184airfryerrecipeblog.comGoDaddy.com, LLC10 Mar 201710 Mar 201710 Mar 2018
185airfryercook.comPDR Ltd. d/b/a PublicDomainRegistry.com10 May 202114 Apr 202510 May 2026
186airfryerxlreviews.comGoDaddy.com, LLC23 Mar 201723 Mar 201723 Mar 2019
187airfryerreviews.orgNameKing.com Inc.27 Aug 202016 Apr 202527 Aug 2025
188airfryerrotisserieoven.comGoDaddy.com, LLC5 Apr 20175 Apr 20175 Apr 2018
189airfryerrotisserie.comGoDaddy.com, LLC5 Apr 20175 Apr 20175 Apr 2018
190airfryernews.comNameCheap, Inc.9 Mar 20227 Feb 20239 Mar 2024
191airfryerfire.comGoDaddy.com, LLC11 Apr 201712 Apr 202511 Apr 2026
192airfryerreviews.in-2 Jan 20163 Jan 20182 Jan 2019
193airfryers.de--23 Dec 2016-
194airfryerfoods.comGoDaddy.com, LLC10 Nov 202010 Nov 202410 Nov 2025
195airfryerschool.orgGoogle, Inc.18 Apr 20179 Apr 202518 Apr 2026
196airfryerschool.comGoogle, Inc.18 Apr 20174 Apr 202518 Apr 2026
197airfryerarea.comNameCheap, Inc.19 Apr 201719 Apr 201719 Apr 2018
198airfryercentral.comHostinger, UAB24 Jul 202423 Sep 202424 Jul 2025
199airfryerbox.comNamesilo, LLC25 May 201729 May 202525 May 2026
200airfryerbacon.comKey-Systems GmbH5 Jun 20174 Jun 20255 Jun 2026
201airfryer-bacon.comKey-Systems GmbH5 Jun 20174 Jun 20255 Jun 2026
202airfryercookbooks.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…22 Apr 202223 Apr 202422 Apr 2025
203airfryerkitchn.comNameCheap, Inc.15 Jun 201717 Jun 201715 Jun 2018
204airfryers.reviewGoDaddy.com, LLC17 Aug 202117 Aug 202117 Aug 2022
205airfryer101.comNameCheap, Inc.7 May 202029 Apr 20247 May 2026
206airfryercalculator.comNameCheap, Inc.2 Jul 201712 Apr 20222 Jul 2027
207airfryerparts.comCloud Yuqu LLC10 Apr 202410 Apr 202410 Apr 2026
208airfryerguru.netKey-Systems GmbH1 Oct 202214 Dec 20231 Oct 2023
209airfryerreviews2017.com1&1 Internet AG8 Oct 201720 Nov 20248 Oct 2024
210airfryeroven.comGoDaddy.com, LLC10 Oct 201716 Jan 202310 Oct 2026
211airfryercookingtimes.comNameCheap, Inc.14 Jan 202015 Dec 202414 Jan 2026
212airfryerforums.comNameCheap, Inc.19 Oct 201719 Oct 201719 Oct 2018
213airfryerforum.comNameCheap, Inc.20 Oct 20221 Dec 202320 Oct 2023
214airfryer-digilabs.comAmazon Registrar, Inc.21 Oct 201721 Oct 201721 Oct 2018
215airfryer-review.comWeb Commerce Communications Limited dba WebNic.cc17 Feb 202417 Feb 202417 Feb 2025
216airfryersunite.comNameCheap, Inc.22 Feb 202522 Feb 202522 Feb 2026
217airfryersreviews.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Jul 202331 Aug 202420 Jul 2024
218airfryer-tester.reviewNameCheap, Inc.8 Dec 20178 Dec 20178 Dec 2018
219airfryer-tester.downloadNameCheap, Inc.8 Dec 20178 Dec 20178 Dec 2018
220airfryer-tester.partyNameCheap, Inc.8 Dec 20178 Dec 20178 Dec 2018
221airfryer-tester.dateNameCheap, Inc.8 Dec 20178 Dec 20178 Dec 2018
222airfryer-tester.winNameCheap, Inc.8 Dec 20178 Dec 20178 Dec 2018
223airfryerrecipes.info1&1 Internet AG29 Nov 20228 Dec 202329 Nov 2024
224airfryersuk.co.ukeNom, Inc.15 Dec 20168 Dec 201715 Dec 2018
225airfryerrecipes.co.uk-14 Mar 201714 Oct 201714 Mar 2018
226airfryers.co.uk-20 Oct 201720 Oct 201720 Oct 2019
227airfryergram.comNameCheap, Inc.10 Jan 201810 Jan 201810 Jan 2019
228airfryerfood.netName.com, Inc.13 Jan 201813 Jan 201813 Jan 2019
229airfryerguy.comCrazy Domains FZ-LLC12 Jan 202016 Feb 202512 Jan 2026
230airfryerchickenrecipes.comTucows Domains Inc.31 Aug 20232 Aug 202431 Aug 2025
231airfryerguru2018.comCrazy Domains FZ-LLC3 Feb 201814 Feb 20193 Feb 2019
232airfryerguru.co.ukCrazy Domains FZ-LLC5 Feb 20185 Feb 20185 Feb 2019
233airfryer24.comPSI-USA, Inc. dba Domain Robot17 Feb 20218 Mar 202517 Feb 2025
234airfryer24.storeCronon AG7 Mar 2018-7 Mar 2019
235airfryerfanatic.comNameCheap, Inc.30 Nov 202311 Jan 202530 Nov 2024
236airfryerlifestyle.comTucows Domains Inc.12 May 202329 Apr 202512 May 2026
237airfryershop.co.uk-20 Mar 202420 Mar 202420 Mar 2025
238airfryerspecialist.comBeijing Lanhai Jiye Technology Co., Ltd21 Mar 202423 May 202521 Mar 2025
239airfryerwinkel.comKey-Systems GmbH7 May 20187 May 20187 May 2019
240airfryers.siteNameCheap, Inc.14 Oct 202428 Oct 202414 Oct 2025
241airfryerfoodie.comTucows Domains Inc.26 Aug 20234 Dec 202426 Aug 2025
242airfryerexpert.reviewNamesilo, LLC28 May 201830 Jun 202428 May 2024
243airfryers.recipesDynadot, LLC2 Jun 20182 Jun 20182 Jun 2019
244airfryerbestsellers.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Jun 20183 Jun 20183 Jun 2019
245airfryer-fritadeira-eletrica-especial.comTucows Domains Inc.2 Jun 20186 Jun 20202 Jun 2020
246airfryertoasteroven.comNameCheap, Inc.25 Jul 201825 Jun 202425 Jul 2025
247airfryerratings.comWild West Domains, LLC1 Aug 20182 Aug 20241 Aug 2026
248airfryerplanet.comNamesilo, LLC17 May 202318 May 202517 May 2026
249airfryertochoose.comFastDomain Inc.20 Aug 201820 Aug 201820 Aug 2019
250airfryertips.comGoDaddy.com, LLC2 Jul 20223 Jul 20242 Jul 2026
251airfryerlife.comGoDaddy.com, LLC29 Aug 202329 Aug 202329 Aug 2025
252airfryerweightwatchersrecipes.comGoDaddy.com, LLC7 Sep 20187 Sep 20187 Sep 2019
253airfryerrecipestipsandtalk.comNameCheap, Inc.10 Jul 202410 Jul 202410 Jul 2025
254airfryerpan.comGoDaddy.com, LLC24 Sep 201824 Sep 201824 Sep 2019
255airfryers.guideNamesilo, LLC9 Oct 20189 Oct 20189 Oct 2019
256airfryerus.com1&1 Internet AG14 Sep 202417 Feb 202514 Sep 2025
257airfryerfriday.comRealtime Register B.V.25 Oct 201825 Oct 201825 Oct 2019
258airfryer-friday.comRealtime Register B.V.25 Oct 201825 Oct 201825 Oct 2019
259airfryerredeem.comGoDaddy.com, LLC25 Oct 201825 Oct 201825 Oct 2019
260airfryeroffer.comGoDaddy.com, LLC4 Oct 20224 Oct 20224 Oct 2023
261airfryersupply.comNameCheap, Inc.29 Oct 201817 Oct 202429 Oct 2025
262airfryermeals.comTucows Domains Inc.4 Nov 20183 Nov 20244 Nov 2025
263airfryerfriendly.comGoDaddy.com, LLC8 Oct 20248 Oct 20248 Oct 2025
264airfryerchina.comHiChina Zhicheng Technology Limited13 Nov 201814 Nov 201813 Nov 2028
265airfryeraf.comGoDaddy.com, LLC14 Nov 201814 Mar 202514 Nov 2025
266airfryerdeal.comMoniker Online Services LLC14 Nov 201814 Nov 201814 Nov 2019
267airfryer-tipsweetjesrecepten-van-amrite.comNamesilo, LLC16 Nov 201816 Nov 201916 Nov 2019
268airfryeroils.comGoDaddy.com, LLC19 Nov 201820 Nov 202419 Nov 2025
269airfryeroil.comGoDaddy.com, LLC19 Nov 201820 Nov 202419 Nov 2025
270airfryerpicks.comNameCheap, Inc.25 Nov 201825 Nov 202425 Nov 2025
271airfryermayne.comGoDaddy.com, LLC26 Nov 201826 Nov 201826 Nov 2019
272airfryeradviser.comNameCheap, Inc.1 Dec 20181 Dec 20181 Dec 2019
273airfryerweb.comRealtime Register B.V.5 Dec 201825 Nov 20245 Dec 2025
274airfryerpower.comGoDaddy.com, LLC5 Dec 20185 Dec 20185 Dec 2019
275airfryerchicken.comGoDaddy.com, LLC6 Dec 20186 Dec 20246 Dec 2025
276airfryerpick.comNamesilo, LLC9 Dec 201811 Nov 20249 Dec 2025
277airfryercooking101.comeNom, Inc.17 Dec 201816 Dec 201817 Dec 2019
278airfryerxxlphilips.comNameCheap, Inc.21 Dec 201821 Dec 201821 Dec 2019
279airfryermarket.comGoDaddy.com, LLC24 Dec 201825 Dec 202424 Dec 2025
280airfryer-xxlphillips.comGoDaddy.com, LLC24 Dec 201824 Dec 201824 Dec 2019
281airfryer-xxl.comGoDaddy.com, LLC24 Dec 201824 Dec 201824 Dec 2019
282airfryer-xxlphilips.comGoDaddy.com, LLC4 Jan 20194 Jan 20194 Jan 2020
283airfryerbook.comGoogle, Inc.25 Jan 20198 Apr 202525 Jan 2025
284airfryercalcularor.comGoDaddy.com, LLC28 Jan 201928 Jan 201928 Jan 2020
285airfryerbuyers.comNameCheap, Inc.5 Feb 201910 Apr 20255 Feb 2026
286airfryercooktimes.comGoDaddy.com, LLC8 Feb 20198 Feb 20258 Feb 2026
287airfryerovenrecipes.comNameCheap, Inc.8 Feb 201931 Jan 20258 Feb 2026
288airfryer360.comMedia Elite Holdings Limited8 Feb 201911 Feb 20258 Feb 2025
289airfryerbro.comNamesilo, LLC16 Feb 201917 Feb 202516 Feb 2026
290airfryer-eligelamejorfreidorasinaceite.com1&1 Internet AG18 Feb 201918 Feb 201918 Feb 2020
291airfryerclub.comFastDomain Inc.28 Dec 202210 Mar 202528 Dec 2025
292airfryercommunity.comGoDaddy.com, LLC21 Feb 201921 Feb 201921 Feb 2021
293airfryervideos.comGoDaddy.com, LLC23 Feb 201923 Feb 201923 Feb 2020
294airfryervideo.comMetaregistrar BV Applications17 Sep 202324 Aug 202417 Sep 2025
295airfryersafe.comGoDaddy.com, LLC27 Feb 201927 Feb 201927 Feb 2020
296airfryerrecipesforturkeydrumsticks.comeNom, Inc.4 Mar 20193 Mar 20194 Mar 2020
297airfryerrecipesclub.comTucows Domains Inc.7 Mar 20196 Mar 20257 Mar 2026
298airfryersandmore.comGoDaddy.com, LLC10 Nov 202010 Nov 202010 Nov 2021
299airfryercafe.comWebfusion Ltd.30 Jan 202413 Mar 202530 Jan 2025
300airfryerovens.comNameCheap, Inc.10 Oct 202422 Apr 202510 Oct 2025
301airfryeroven360.comGoDaddy.com, LLC13 Mar 201913 Mar 201913 Mar 2020
302airfryeraccessoires.comRealtime Register B.V.19 Mar 201920 Mar 202519 Mar 2026
303airfryercalculater.comGoDaddy.com, LLC22 Mar 201922 Mar 201922 Mar 2020
304airfryertv.comInames Co. Ltd.27 Mar 201927 Mar 201927 Mar 2020
305airfryermax.comLimited Liability Company "Registrar of domain nam…21 Mar 202521 Mar 202521 Mar 2026
306airfryerplus.comTucows Domains Inc.20 Jan 202424 Jan 202520 Jan 2026
307airfryerfanatics.comGoDaddy.com, LLC3 Apr 20194 Apr 20253 Apr 2026
308airfryerchickenbreast.comNameCheap, Inc.4 Apr 202511 Apr 20254 Apr 2026
309airfryershq.comTop Level Domains LLC12 Aug 202412 May 202512 Aug 2025
310airfryergrill.comGoDaddy.com, LLC12 Apr 201912 Apr 201912 Apr 2020
311airfryersmokelessgrill.comGoDaddy.com, LLC12 Apr 201912 Apr 201912 Apr 2020
312airfryertime.comSynergy Wholesale Pty Ltd22 Nov 202122 Nov 202422 Nov 2025
313airfryerbooks.comTucows Domains Inc.19 Apr 201918 Apr 202519 Apr 2026
314airfryerebooks.comTucows Domains Inc.19 Apr 201918 Apr 202519 Apr 2026
315airfryermaster.comNameCheap, Inc.22 Nov 202223 Oct 202422 Nov 2025
316airfryerpub.comGoDaddy.com, LLC11 May 201912 May 202511 May 2027
317airfryersecrets.comNameCheap, Inc.25 May 202425 Apr 202525 May 2026
318airfryeraddict.comBlacknight Internet Solutions Ltd.19 May 20191 Aug 202419 May 2024
319airfryershop.clubNameCheap, Inc.6 Jun 20197 Jun 20196 Jun 2020
320airfryerhub.clubNameCheap, Inc.6 Jun 20197 Jun 20196 Jun 2020
321airfryerpro.clubNameCheap, Inc.6 Jun 20197 Jun 20196 Jun 2020
322airfryernow.clubChengdu West Dimension Digital Technology Co., Ltd…1 Nov 20211 Nov 20211 Nov 2022
323airfryerlabs.comHiChina Zhicheng Technology Limited27 Jun 20194 Aug 202027 Jun 2020
324airfryereviews.comNameCheap, Inc.27 Jun 20197 Jun 202527 Jun 2026
325airfryermart.comNamesilo, LLC17 Feb 202322 Mar 202417 Feb 2024
326airfryerandmore.comGoDaddy.com, LLC8 Jul 20198 Jul 20198 Jul 2020
327airfryersreviewed.comPDR Ltd. d/b/a PublicDomainRegistry.com20 May 202420 May 202520 May 2025
328airfryersi.comGoDaddy.com, LLC6 Aug 201919 Nov 20246 Aug 2025
329airfryerketorecipes.comDomain.com, LLC24 Jan 20239 Apr 202524 Jan 2025
330airfryerketo.comDynadot, LLC14 Aug 202224 Sep 202314 Aug 2023
331airfryers.clubKey-Systems, LLC26 Nov 202013 Jan 202526 Nov 2025
332airfryerbrothers.comHosting Concepts B.V. dba Openprovider15 Aug 201915 Aug 201915 Aug 2020
333airfryerblackfriday.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…25 Aug 201925 Aug 201925 Aug 2020
334airfryerfactory.comHiChina Zhicheng Technology Limited27 Aug 201920 Aug 202427 Aug 2029
335airfryertop.comHostinger, UAB17 Dec 202220 Nov 202417 Dec 2025
336airfryermayne.netGoDaddy.com, LLC11 Sep 201911 Sep 201911 Sep 2020
337airfryer1.comName.com, Inc.4 Sep 202218 Oct 20244 Sep 2024
338airfryervegan.comGoogle, Inc.10 Oct 202225 Sep 202410 Oct 2025
339airfryerdinners.comGoDaddy.com, LLC22 Sep 201923 Sep 202422 Sep 2025
340airfryernerd.comNameCheap, Inc.29 Sep 201930 Aug 202429 Sep 2025
341airfryerturkey.comTucows Domains Inc.29 Sep 201928 Sep 202429 Sep 2025
342airfryersale.comNameCheap, Inc.30 Sep 201931 Aug 202430 Sep 2025
343airfryers101.clubNameCheap, Inc.5 Jan 20215 Jan 20215 Jan 2022
344airfryertips.clubNameCheap, Inc.12 Oct 201912 Oct 201912 Oct 2020
345airfryershq.clubNameCheap, Inc.12 Oct 201912 Oct 201912 Oct 2020
346airfryeruniversal.comGoDaddy.com, LLC16 Oct 201916 Oct 201916 Oct 2020
347airfryersplus.comDropCatch.com 384 LLC9 Jul 202319 Sep 20249 Jul 2024
348airfryertipshq.clubNameCheap, Inc.19 Oct 201919 Oct 201919 Oct 2020
349airfryerblog.clubNameCheap, Inc.19 Oct 201919 Oct 201919 Oct 2020
350airfryerstips.clubNameCheap, Inc.19 Oct 201919 Oct 201919 Oct 2020
351airfryerlist.comNameCheap, Inc.26 Oct 20197 Dec 202426 Oct 2024
352airfryer-recipes.comNamesilo, LLC14 May 202115 May 202514 May 2026
353airfryercooky.com-26 Jan 202510 Feb 202526 Jan 2026
354airfryerhelp.comGoDaddy.com, LLC31 Jan 202414 Apr 202531 Jan 2025
355airfryersteam.comGoDaddy.com, LLC21 Nov 201921 Nov 201921 Nov 2020
356airfryertobuy.comFastDomain Inc.8 Dec 20198 Dec 20198 Dec 2020
357airfryersanon.comGoDaddy.com, LLC9 Dec 201910 Dec 20249 Dec 2025
358airfryeranon.comGoDaddy.com, LLC9 Dec 201910 Dec 20249 Dec 2025
359airfryerqna.comGoDaddy.com, LLC17 Dec 201917 Dec 201917 Dec 2021
360airfryerspro.comRealtime Register B.V.13 Feb 202414 Feb 202513 Feb 2026
361airfryerbest.comHostinger, UAB5 Apr 20239 Mar 20255 Apr 2026
362airfryerreports.comNameCheap, Inc.5 Jan 2020-5 Jan 2021
363airfryerreport.comGoDaddy.com, LLC16 Nov 202227 Jun 202316 Nov 2025
364airfryertuck.comGoDaddy.com, LLC7 Jan 20207 Jan 20207 Jan 2021
365airfryerconversion.comNamesilo, LLC10 Mar 202211 Mar 202510 Mar 2026
366airfryer365.comGoDaddy.com, LLC1 Feb 20201 Feb 20251 Feb 2026
367airfryerrecipestipsandtalknews.comNameCheap, Inc.8 Feb 2020-8 Feb 2021
368airfryertoday.comTucows Domains Inc.9 Feb 20208 Feb 20259 Feb 2026
369airfryertimes.comCloudFlare, Inc.28 Dec 20216 Feb 202528 Dec 2024
370airfryerdirect.comGoDaddy.com, LLC20 Feb 202011 Apr 202520 Feb 2028
371airfryersteamer.comGoDaddy.com, LLC24 Feb 20208 May 202324 Feb 2023
372airfryerliners.comTucows Domains Inc.1 Sep 202131 Aug 20241 Sep 2025
373airfryerliner.comTucows Domains Inc.1 Sep 202131 Aug 20241 Sep 2025
374airfryer-official.com1&1 Internet AG26 Feb 202013 Mar 202026 Feb 2021
375airfryerwire.comGoDaddy.com, LLC27 Feb 202010 Apr 202327 Feb 2023
376airfryeradventures.comGoDaddy.com, LLC1 Mar 20202 Mar 20251 Mar 2026
377airfryershome.comNameCheap, Inc.10 Sep 202322 Oct 202410 Sep 2024
378airfryersblog.comNameCheap, Inc.3 Mar 2020-3 Mar 2021
379airfryers.proNameCheap, Inc.13 Jul 202324 Aug 202413 Jul 2024
380airfryershowtime.comregister.com, Inc.17 Apr 202022 Mar 202317 Apr 2026
381airfryershow.comregister.com, Inc.17 Apr 202022 Mar 202317 Apr 2026
382airfryertotaal.comRealtime Register B.V.19 Apr 2020-19 Apr 2021
383airfryercocinillas.comAutomattic Inc.21 Apr 202021 Apr 202021 Apr 2021
384airfryerparchmentpaper.comGoDaddy.com, LLC30 Apr 202011 May 202330 Apr 2024
385airfryerbasket.comGoDaddy.com, LLC1 May 20201 May 20251 May 2026
386airfryerfeed.comGoogle, Inc.2 May 202017 Apr 20252 May 2026
387airfryerthai.comGoDaddy.com, LLC4 May 20205 May 20254 May 2026
388airfryertoasterovens.comGoDaddy.com, LLC21 Nov 202421 Nov 202421 Nov 2025
389airfryerideas.comGoDaddy.com, LLC16 May 202017 May 202516 May 2026
390airfryersusa.comNameCheap, Inc.6 Aug 202422 Aug 20246 Aug 2025
391airfryeronlinestore.infoNamesilo, LLC14 Oct 201914 Dec 201914 Oct 2020
392airfryersandgadgetsforsale.infoNamesilo, LLC23 Jan 202023 Mar 202023 Jan 2021
393airfryerchef.infoNameCheap, Inc.4 Jun 20193 Aug 20194 Jun 2020
394airfryer1.infoGoDaddy.com, LLC26 Apr 20198 May 202026 Apr 2021
395airfryermaster.infoNameCheap, Inc.29 Sep 201928 Nov 201929 Sep 2020
396airfryerreview.infoGoDaddy.com, LLC11 Jan 202325 Feb 202511 Jan 2026
397airfryer-fritadeira-sem-oleo.comTucows Domains Inc.27 May 202031 May 202127 May 2021
398airfryermadness.comGoDaddy.com, LLC29 May 20209 Aug 202329 May 2023
399airfryertrays.comGoogle, Inc.5 Jun 20205 Jun 20205 Jun 2021
400airfryerman.comNameCheap, Inc.29 Sep 202210 Nov 202329 Sep 2023
401airfryerhome.comNameCheap, Inc.24 Nov 202424 Nov 202424 Nov 2025
402airfryerrecipe.netHostinger, UAB24 Sep 202424 Nov 202424 Sep 2025
403airfryerxxl-philips-promo.comGoDaddy.com, LLC26 Jun 202026 Jun 202026 Jun 2021
404airfryerhouse.comGoDaddy.com, LLC1 Jul 202012 Sep 20241 Jul 2024
405airfryermicrowave.comGoDaddy.com, LLC30 Jan 202530 Jan 202530 Jan 2026
406airfryeraddicts.comFastDomain Inc.7 Jul 202022 Jun 20247 Jul 2025
407airfryergurus.comTucows Domains Inc.30 Jun 20204 Jul 202130 Jun 2021
408airfryerqueen.comBonam Fortunam Domains, LLC5 Oct 20248 Oct 20245 Oct 2025
409airfryerchickenwings.comDynadot, LLC28 Mar 202429 Mar 202528 Mar 2026
410airfryer-360.comGoDaddy.com, LLC25 Jul 202025 Jul 202025 Jul 2021
411airfryers360.comGoDaddy.com, LLC25 Jul 202026 Jul 202425 Jul 2025
412airfryerbuyingguide.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Jul 202028 Jul 202028 Jul 2021
413airfryersmagic.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Jul 202028 Jul 202028 Jul 2021
414airfryerdiva.comGoDaddy.com, LLC10 Aug 202020 Jul 202310 Aug 2025
415airfryerheaven.comNameCheap, Inc.21 Aug 202022 Jul 202421 Aug 2025
416airfryerstore.spacePDR Ltd. d/b/a PublicDomainRegistry.com14 Apr 202021 May 202114 Apr 2021
417airfryerlove.comNameCheap, Inc.27 Apr 202322 Apr 202527 Apr 2027
418airfryereasyrecipes.comDomain.com, LLC20 Sep 20205 Sep 202420 Sep 2025
419airfryermom.comGoDaddy.com, LLC18 Feb 20245 Feb 202518 Feb 2026
420airfryeraccessoires.onlineRealtime Register B.V.25 Sep 2020-25 Sep 2021
421airfryeruniversity.comGoogle, Inc.25 Sep 202025 Sep 202025 Sep 2021
422airfryersguide.siteDOTSERVE INC.28 Sep 20201 Sep 202428 Sep 2025
423airfryerkits.comGoDaddy.com, LLC29 Sep 202029 Sep 202029 Sep 2022
424airfryertoasterovenreview.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Oct 20209 Oct 20209 Oct 2021
425airfryercuisine.comGandi SAS23 Jan 20249 Apr 202523 Jan 2025
426airfryerhappy.comGoDaddy.com, LLC18 Oct 202025 Oct 202418 Oct 2025
427airfryerreceitas.comCloudFlare, Inc.17 Apr 202524 Apr 202517 Apr 2026
428airfryerz.infoNameCheap, Inc.26 Oct 202026 Oct 202026 Oct 2021
429airfryeru.comGoogle, Inc.30 Oct 202030 Oct 202030 Oct 2021
430airfryeraccessoriesmasher.infoName.com, Inc.9 Jan 20229 Jan 20229 Jan 2023
431airfryercookware.comGoDaddy.com, LLC9 Nov 20209 Nov 20249 Nov 2025
432airfryerexporter.comeName Technology Co., Ltd.9 Nov 20209 Nov 20209 Nov 2021
433airfryerlid.comGoDaddy.com, LLC9 Nov 202010 Nov 20249 Nov 2025
434airfryermaker.comeName Technology Co., Ltd.11 Nov 202011 Nov 202011 Nov 2021
435airfryerfoods.netGoDaddy.com, LLC10 Nov 202010 Nov 202410 Nov 2025
436airfryer2021.comNamesilo, LLC17 Nov 202018 Nov 202017 Nov 2021
437airfryermondial.comGoogle, Inc.22 Nov 202223 Nov 202322 Nov 2024
438airfryeroficial.comGoDaddy.com, LLC19 Nov 202019 Nov 202019 Nov 2021
439airfryernation.comGoDaddy.com, LLC18 Jul 202329 Aug 202418 Jul 2024
440airfryerhealthy.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Nov 202024 Sep 202424 Nov 2025
441airfryer-aanbieding.onlineRealtime Register B.V.25 Nov 2020-25 Nov 2021
442airfryerfrenzy.comDreamHost, LLC27 Jan 202311 Apr 202527 Jan 2025
443airfryersingapore.comHostinger, UAB30 Nov 202031 Oct 202430 Nov 2025
444airfryermagnifica.comGoDaddy.com, LLC1 Dec 20201 Dec 20201 Dec 2021
445airfryerovencooker.comTucows Domains Inc.3 Dec 20203 Dec 20203 Dec 2021
446airfryermundial.comMedia Elite Holdings Limited4 Dec 20204 Dec 20204 Dec 2021
447airfryerabs.comGoDaddy.com, LLC7 Dec 202018 Feb 20247 Dec 2023
448airfryeradvisor.comTurnCommerce, Inc. DBA NameBright.com9 Dec 202011 Dec 20209 Dec 2025
449airfryersreviews.xyzNameCheap, Inc.13 Dec 202013 Dec 202013 Dec 2021
450airfryer-webshop.onlineRealtime Register B.V.17 Dec 2020-17 Dec 2021
451airfryerkopenonline.onlineRealtime Register B.V.17 Dec 2020-17 Dec 2021
452airfryervergelijk.onlineRealtime Register B.V.17 Dec 2020-17 Dec 2021
453airfryer-aanbiedingen.onlineRealtime Register B.V.17 Dec 2020-17 Dec 2021
454airfryer-winkel.onlineRealtime Register B.V.17 Dec 2020-17 Dec 2021
455airfryertip.comeNom, Inc.22 Dec 202027 Nov 202422 Dec 2026
456airfryerbulk.comNamesilo, LLC23 Dec 202023 Dec 202023 Dec 2021
457airfryertrend.comNameCheap, Inc.9 Apr 202227 Mar 20259 Apr 2026
458airfryerchick.comGoDaddy.com, LLC29 Dec 202030 Dec 202329 Dec 2025
459airfryerland.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Dec 202029 Dec 202029 Dec 2021
460airfryersreviews.storeNameCheap, Inc.30 Dec 202030 Dec 202030 Dec 2021
461airfryershop.spacePDR Ltd. d/b/a PublicDomainRegistry.com24 Dec 201925 Dec 202024 Dec 2021
462airfryeracademy.comGoDaddy.com, LLC2 Jan 202112 Feb 20242 Jan 2024
463airfryerable.comGoogle, Inc.2 Jan 202119 Dec 20242 Jan 2026
464airfryerfails.comFastDomain Inc.2 Jan 20212 Jan 20212 Jan 2022
465airfryerofficial.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED17 Jan 202517 Jan 202517 Jan 2026
466airfryersuomi.comNameCheap, Inc.5 Jan 2021-5 Jan 2022
467airfryer-vergelijken.comGoDaddy.com, LLC12 Jan 202112 Jan 202112 Jan 2022
468airfryercookingtips.comNameCheap, Inc.12 Jan 202113 Dec 202412 Jan 2026
469airfryerturbo.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Dec 202415 Feb 202516 Dec 2025
470airfryersonline.siteGoDaddy.com, LLC12 Jan 202124 Mar 202412 Jan 2024
471airfryeradventuresbyben.comGoDaddy.com, LLC14 Jan 202114 Jan 202514 Jan 2026
472airfryerarchives.comGoogle, Inc.18 Jan 202118 Jan 202118 Jan 2022
473airfryereasycook.comGoDaddy.com, LLC22 Jan 202122 Jan 202122 Jan 2022
474airfryercanada.comGoDaddy.com, LLC24 Jan 202125 Jan 202524 Jan 2026
475airfryeraccessori.comTucows Domains Inc.26 Jan 202126 Jan 202126 Jan 2022
476airfryeroven.netHiChina Zhicheng Technology Limited27 Jan 202127 Jan 202127 Jan 2031
477airfryerisland.comGoDaddy.com, LLC29 Jan 202111 Mar 202429 Jan 2024
478airfryermenu.comGoDaddy.com, LLC27 Oct 202428 Oct 202427 Oct 2025
479airfryergenie.com1&1 Internet AG6 Feb 20216 Feb 20216 Feb 2022
480airfryerfried.comNameCheap, Inc.8 Feb 20219 Feb 20218 Feb 2031
481airfryerr.comSoluciones Corporativas IP, SLU10 Feb 202110 Feb 202110 Feb 2022
482airfryerrecipes.clubMesh Digital Limited8 Jan 202319 Feb 20258 Jan 2025
483airfryerbot.comHosting Concepts B.V. dba Openprovider15 Feb 202115 Feb 202115 Feb 2022
484airfryercalculatir.comInternet Domain Services BS Corp16 Feb 202116 Feb 202116 Feb 2022
485airfryeronabudget.comDreamHost, LLC18 Feb 20212 Apr 202318 Feb 2023
486airfryerdelicious.comDreamHost, LLC19 Feb 202119 Jan 202519 Feb 2026
487airfryerwy.onlineDynadot, LLC20 Feb 202120 Feb 202120 Feb 2022
488airfryeral.onlineDynadot, LLC20 Feb 202120 Feb 202120 Feb 2022
489airfryerwi.onlineDynadot, LLC22 Feb 202122 Feb 202122 Feb 2022
490airfryerak.onlineDynadot, LLC21 Feb 202121 Feb 202121 Feb 2022
491airfryeroven.storeHosting Concepts B.V. dba Openprovider23 Feb 202123 Feb 202123 Feb 2022
492airfryeroftheyear.comUniregistrar Corp---
493airfryercooking.clubGoDaddy.com, LLC28 Feb 202111 Apr 202528 Feb 2025
494airfryerbro.xyzNameCheap, Inc.28 Feb 202128 Feb 202128 Feb 2022
495airfryercooks.comGoDaddy.com, LLC28 Feb 20211 Mar 202528 Feb 2026
496airfryerhotdog.comGoDaddy.com, LLC1 Mar 202112 Apr 20251 Mar 2025
497airfryercomforno.comGoDaddy.com, LLC4 Mar 20214 Mar 20214 Mar 2022
498airfryercompleta.comGoDaddy.com, LLC4 Mar 20214 Mar 20214 Mar 2022
499airfryers.dealsNameCheap, Inc.6 Mar 20216 Mar 20216 Mar 2022
500airfryermoms.onlineDynadot, LLC10 Mar 202110 Mar 202110 Mar 2022
501airfryerorok.onlineDynadot, LLC9 Mar 20219 Mar 20219 Mar 2022
502airfryersolution.comGoDaddy.com, LLC10 Mar 202122 May 202410 Mar 2024
503airfryerworld.bizNamesilo, LLC12 Mar 202119 May 202112 Mar 2022
504airfryerstore.storeTucows Domains Inc.13 Mar 202117 Mar 202213 Mar 2023
505airfryerfoodrecipes.comGoDaddy.com, LLC14 Mar 202126 May 202414 Mar 2024
506airfryereverything.comGoDaddy.com, LLC14 Mar 202115 Mar 202514 Mar 2026
507airfryeril.storeDynadot, LLC15 Mar 202115 Mar 202115 Mar 2022
508airfryerus.onlineDynadot, LLC15 Mar 202115 Mar 202115 Mar 2022
509airfryerkitchen.xyzDynadot, LLC17 Mar 202117 Mar 202117 Mar 2022
510airfryervt.storeDynadot, LLC16 Mar 202116 Mar 202116 Mar 2022
511airfryeruk.comWebfusion Ltd.16 Mar 202117 Mar 202516 Mar 2026
512airfryerovens.onlineCrazy Domains FZ-LLC19 Mar 2021-19 Mar 2022
513airfryerrecipeshealthy.com1&1 Internet AG19 Mar 202119 Mar 202119 Mar 2022
514airfryercasas-bahia.comGoogle, Inc.25 Mar 202125 Mar 202125 Mar 2022
515airfryercleaner.comDreamHost, LLC31 Mar 202113 Jun 202431 Mar 2024
516airfryermagic.comNameCheap, Inc.11 Oct 202222 Dec 202411 Oct 2024
517airfryer-aanbieding.comHosting Concepts B.V. dba Openprovider6 Apr 202124 Mar 20256 Apr 2026
518airfryernellsmart.comGoogle, Inc.8 Apr 20218 Apr 20218 Apr 2022
519airfryerbrasil.comHostinger, UAB14 Apr 202315 Apr 202514 Apr 2026
520airfryermadeeasy.comGoogle, Inc.18 Apr 20213 Apr 202518 Apr 2026
521airfryersale.onlineDynadot, LLC20 Apr 202120 Apr 202120 Apr 2022
522airfryerchart.comDROPCATCH.COM 761 LLC12 Jul 202413 Jul 202412 Jul 2025
523airfryertemp.comGoDaddy.com, LLC2 May 202113 May 20232 May 2024
524airfryersupport.comHosting Concepts B.V. dba Openprovider3 May 20213 May 20213 May 2022
525airfryerninja.comSynergy Wholesale Pty Ltd13 Jan 202330 Dec 202313 Jan 2025
526airfryer-kitchen.comGoogle, Inc.20 Jun 202320 Jul 202420 Jun 2024
527airfryerbros.comNameCheap, Inc.16 May 2021-16 May 2022
528airfryer-queen.comeNom, Inc.18 May 202118 May 202118 May 2022
529airfryeroutlet.comTucows Domains Inc.9 Mar 202313 Mar 20249 Mar 2025
530airfryerepicure.comPDR Ltd. d/b/a PublicDomainRegistry.com21 May 202122 May 202521 May 2026
531airfryer-us.comDynadot, LLC26 May 20215 Jul 202326 May 2023
532airfryersmart.comNameCheap, Inc.3 Jun 2021-3 Jun 2022
533airfryer-sale.comDynadot, LLC11 Jun 202111 Jun 202111 Jun 2022
534airfryerparadise.comGoDaddy.com, LLC13 Jun 202114 Jun 202413 Jun 2025
535airfryertech.comNameCheap, Inc.3 Sep 202316 Oct 20243 Sep 2024
536airfryerfrozenfoods.comGoDaddy.com, LLC16 Jun 202128 Aug 202316 Jun 2023
537airfryerovenreviews.comTucows Domains Inc.17 Jun 202117 Jun 202117 Jun 2022
538airfryerliving.comeNom, Inc.20 Jun 202120 Jun 202120 Jun 2022
539airfryersegredos.onlineGoDaddy.com, LLC21 Jun 202121 Jun 202121 Jun 2022
540airfryer-usa.comDynadot, LLC23 Jun 202123 Jun 202123 Jun 2022
541airfryerforguys.comGoDaddy.com, LLC28 Jun 202128 Dec 202428 Jun 2025
542airfryerbee.comNameCheap, Inc.28 Jun 20216 Aug 202228 Jun 2023
543airfryerweb.netEstrategias WebSite S.L.28 Jun 202128 Jun 202128 Jun 2022
544airfryerintelligence.comDynadot, LLC2 Jul 20215 Jul 20212 Jul 2022
545airfryerbro.emailNameCheap, Inc.6 Jul 20216 Jul 20216 Jul 2022
546airfryerinstantpotketo.comNameCheap, Inc.7 Jul 20217 Jun 20247 Jul 2025
547airfryerketo.netNameCheap, Inc.7 Jul 20217 Jun 20247 Jul 2025
548airfryerketorecipes.netNameCheap, Inc.7 Jul 20217 Jun 20247 Jul 2025
549airfryer365.onlineGoDaddy.com, LLC11 Jul 202111 Jul 202111 Jul 2022
550airfryerweb.onlineDynadot, LLC12 Oct 202222 Dec 202312 Oct 2023
551airfryer-kichen.comDynadot, LLC15 Jul 202115 Jul 202115 Jul 2022
552airfryeremporium.comGoogle, Inc.15 Jul 20211 Jul 202415 Jul 2025
553airfryerproject.comInternet Domain Services BS Corp18 Jul 202118 Jul 202118 Jul 2022
554airfryeraffairs.comeNom, Inc.19 Jul 202130 Aug 202419 Jul 2024
555airfryercookbooks.netGoogle, Inc.20 Jul 202120 Jul 202120 Jul 2022
556airfryeranytime.comNameCheap, Inc.25 Jul 202125 Jun 202425 Jul 2025
557airfryerreviews.topDynadot, LLC29 Jun 202129 Jun 202129 Jun 2022
558airfryerproduct.clubDynadot, LLC27 Jul 202127 Jul 202127 Jul 2022
559airfryercrispx.comGoDaddy.com, LLC30 Jul 202111 Oct 202430 Jul 2024
560airfryerfamilymeals.comLaunchpad, Inc.2 Aug 202118 Jun 20242 Aug 2025
561airfryerobsessed.comDynadot12 LLC15 Oct 202115 Oct 202115 Oct 2022
562airfryer-store.comCloudFlare, Inc.16 Jun 202516 Jun 202516 Jun 2026
563airfryermarinade.comGoDaddy.com, LLC4 Aug 20214 Aug 20214 Aug 2022
564airfryersonsale.comGoDaddy.com, LLC4 Aug 20217 Mar 20254 Aug 2026
565airfryercookbook.netGoogle, Inc.8 Aug 20218 Aug 20218 Aug 2022
566airfryerinamazon.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…20 Aug 202121 Aug 202220 Aug 2022
567airfryerer.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…11 Aug 202121 Oct 202411 Aug 2024
568airfryerget.comHostinger, UAB4 Jan 20256 Mar 20254 Jan 2026
569airfryermama.comNameCheap, Inc.3 Jun 20243 Jun 20253 Jun 2026
570airfryersonline.storeHostinger, UAB12 Aug 202117 Aug 202112 Aug 2023
571airfryersandprices.comNameCheap, Inc.16 Aug 2021-16 Aug 2022
572airfryerpromomagazine.xyzNameCheap, Inc.24 Aug 202124 Aug 202124 Aug 2022
573airfryerpizza.comKey-Systems GmbH26 Aug 202121 Jan 202526 Aug 2025
574airfryers-outlet.comDynadot, LLC26 Aug 202126 Aug 202126 Aug 2022
575airfryer-fritadeira.comOVH sas28 Aug 202128 Aug 202128 Aug 2022
576airfryermat.comTucows Domains Inc.1 Sep 202131 Aug 20241 Sep 2025
577airfryersiliconeliner.comTucows Domains Inc.1 Sep 202131 Aug 20241 Sep 2025
578airfryersiliconeliners.comTucows Domains Inc.1 Sep 202131 Aug 20241 Sep 2025
579airfryersiliconemats.comTucows Domains Inc.1 Sep 202131 Aug 20241 Sep 2025
580airfryermats.comTucows Domains Inc.1 Sep 202131 Aug 20241 Sep 2025
581airfryersiliconemat.comTucows Domains Inc.1 Sep 202131 Aug 20241 Sep 2025
582airfryersusa-outlet.comDynadot, LLC3 Sep 20213 Sep 20213 Sep 2022
583airfryersupplies.comNordreg AB18 Nov 202416 Feb 202518 Nov 2025
584airfryers.cloudDynadot, LLC9 Sep 202111 Sep 20219 Sep 2022
585airfryernow.comNameCheap, Inc.10 Sep 202111 Aug 202410 Sep 2025
586airfryermealplan.comNameCheap, Inc.22 Sep 202123 Aug 202422 Sep 2025
587airfryerpuertorico.comGoogle, Inc.22 Sep 20217 Sep 202422 Sep 2025
588airfryerpr.comGoogle, Inc.22 Sep 20217 Sep 202422 Sep 2025
589airfryerpremium.comNamesilo, LLC22 Sep 202123 Sep 202122 Sep 2022
590airfryer-retete.comNameCheap, Inc.23 Sep 20215 Dec 202423 Sep 2024
591airfryerchile.comTucows Domains Inc.23 Sep 202127 Sep 202223 Sep 2022
592airfryerandinstantpotrecipes.comDreamHost, LLC23 Sep 202123 Sep 202123 Sep 2022
593airfryerinstantpotrecipes.comDreamHost, LLC23 Sep 202123 Sep 202123 Sep 2022
594airfryerparafamilia.comHosting Concepts B.V. dba Openprovider24 Sep 202124 Sep 202124 Sep 2022
595airfryerhacks.comTucows Domains Inc.3 Feb 20253 Feb 20253 Feb 2026
596airfryerstore.onlineGoDaddy.com, LLC28 Sep 202110 Oct 202328 Sep 2024
597airfryer-world.comDynadot, LLC29 Sep 202129 Sep 202129 Sep 2022
598airfryerforlife.comLaunchpad, Inc.1 Oct 202116 Sep 20241 Oct 2025
599airfryer-premium.onlineHostinger, UAB1 Oct 20211 Oct 20211 Oct 2022
600airfryersandsteamers.com1&1 Internet AG6 Oct 20216 Oct 20216 Oct 2022
601airfryerandovens.comeNom, Inc.7 Oct 20217 Oct 20217 Oct 2022
602airfryerdesire.comDreamHost, LLC7 Oct 20216 Sep 20247 Oct 2025
603airfryersreview.comCosmotown, Inc.9 Jan 20259 Jan 20259 Jan 2026
604airfryerx2000.spaceGMO Internet Inc.13 Oct 2021-13 Oct 2022
605airfryerx2000.siteGMO Internet Inc.13 Oct 2021-13 Oct 2022
606airfryerproclub.comNameCheap, Inc.18 Oct 202118 Sep 202418 Oct 2025
607airfryervibes.comNameCheap, Inc.26 Oct 202126 Sep 202426 Oct 2025
608airfryerfoodies.comGoDaddy.com, LLC22 May 202424 May 202522 May 2026
609airfryer-fritadeira.onlineHostinger, UAB3 Nov 20218 Nov 20213 Nov 2023
610airfryer-tilbud.dk-14 Mar 2023-13 Mar 2026
611airfryersblogg.comHosting Concepts B.V. dba Openprovider11 Nov 202111 Nov 202111 Nov 2022
612airfryernest.comNameCheap, Inc.24 May 202524 May 202524 May 2026
613airfryersblackfridaysale.comNamesilo, LLC12 Nov 202112 Nov 202112 Nov 2022
614airfryers-online-deals.cloudTucows Domains Inc.15 Nov 202119 Nov 202215 Nov 2022
615airfryer-ninja.comNameCheap, Inc.1 Dec 20241 Dec 20241 Dec 2025
616airfryershop01.comNameCheap, Inc.23 Nov 2021-23 Nov 2022
617airfryermegareceitas.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Nov 202123 Nov 202123 Nov 2022
618airfryeronline.clubDynadot, LLC23 Nov 202123 Nov 202123 Nov 2022
619airfryerusa.siteDynadot, LLC25 Nov 202125 Nov 202125 Nov 2022
620airfryer-pot.sbsDynadot, LLC25 Nov 202125 Nov 202125 Nov 2022
621airfryeroven.infoGoDaddy.com, LLC25 Nov 20211 Jan 202225 Nov 2022
622airfryersellusa.comKey-Systems GmbH24 Nov 202116 Sep 202324 Nov 2023
623airfryersale.siteDOTSERVE INC.26 Nov 20211 Dec 202426 Nov 2025
624airfryercartel.comGoDaddy.com, LLC27 Nov 202127 Nov 202127 Nov 2022
625airfryercraze.comeNom, Inc.27 Nov 20218 Feb 202427 Nov 2023
626airfryerassociation.comGoDaddy.com, LLC29 Nov 202129 Nov 202129 Nov 2022
627airfryermeatballs.comBeijing Lanhai Jiye Technology Co., Ltd22 Feb 202423 Feb 202522 Feb 2026
628airfryerfinder.comCloudFlare, Inc.4 Dec 20213 Dec 20244 Dec 2025
629airfryerkidsrecipes.comNameCheap, Inc.5 Dec 2021-5 Dec 2022
630airfryermaker.xyzNameCheap, Inc.7 Dec 20217 Dec 20217 Dec 2022
631airfryerdezember.comeNom, Inc.9 Dec 20219 Dec 20219 Dec 2022
632airfryerdenatal.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Dec 202111 Dec 202111 Dec 2022
633airfryermasters.comHostinger, UAB8 Jun 202326 Apr 20248 Jun 2026
634airfryerwholesale.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…16 Dec 202123 Jan 202416 Dec 2023
635airfryerrapidoymas.netDomain.com, LLC18 Dec 20212 Mar 202418 Dec 2023
636airfryerrapidoymas.comDomain.com, LLC18 Dec 20212 Mar 202418 Dec 2023
637airfryerovenoem.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 Dec 202119 Dec 202119 Dec 2022
638airfryerovenmanufacturer.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 Dec 202119 Dec 202119 Dec 2022
639airfryerovenmaker.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 Dec 202119 Dec 202119 Dec 2022
640airfryerovenfactory.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 Dec 202119 Dec 202119 Dec 2022
641airfryerbite.comNameCheap, Inc.21 Dec 20214 Mar 202521 Dec 2024
642airfryerfoodi.onlineDynadot, LLC24 Dec 202124 Dec 202124 Dec 2022
643airfryerfeatures.com-15 Mar 202416 Mar 202515 Mar 2026
644airfryer123.comTucows Domains Inc.28 Dec 202127 Dec 202428 Dec 2025
645airfryersales.onlineDynadot, LLC30 Dec 202130 Dec 202130 Dec 2022
646airfryer-directsale.siteDynadot, LLC31 Dec 202131 Dec 202131 Dec 2022
647airfryerdeanovo.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Dec 202131 Dec 202131 Dec 2022
648airfryerusa.storeDynadot, LLC6 Jan 20227 Jan 20226 Jan 2023
649airfryertoasteroven.netDynadot, LLC12 Jan 202212 Jan 202212 Jan 2023
650airfryerovens.netDynadot, LLC12 Jan 202212 Jan 202212 Jan 2023
651airfryer-clearancesales.onlineDynadot, LLC14 Jan 202214 Jan 202214 Jan 2023
652airfryer-family-35l.onlineTucows Domains Inc.14 Jan 202218 Jan 202314 Jan 2024
653airfryersaviour.comTucows Domains Inc.14 Jan 202218 Jan 202314 Jan 2024
654airfryer-family-supercash.onlineHostinger, UAB15 Jan 202216 Jan 202215 Jan 2023
655airfryer-ninja.storeDynadot, LLC17 Jan 202217 Jan 202217 Jan 2023
656airfryermania.comNameCheap, Inc.16 Jan 202229 Mar 202416 Jan 2024
657airfryeroutlet.onlineDynadot, LLC18 Jan 20229 Aug 202218 Jan 2023
658airfryerpizza.storeKey-Systems, LLC21 Jan 2022-21 Jan 2023
659airfryerdodia.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Jan 202221 Jan 202221 Jan 2023
660airfryerlunch.comGoDaddy.com, LLC20 Jan 20225 Oct 202220 Jan 2023
661airfryerbreakfast.comGoDaddy.com, LLC20 Jan 202220 Jan 202220 Jan 2023
662airfryerspros.comGoogle, Inc.24 Jan 202225 Mar 202424 Jan 2024
663airfryerpizzas.comDynadot, LLC26 Jan 20226 Apr 202426 Jan 2024
664airfryer-center.comDynadot, LLC27 Jan 202227 Jan 202227 Jan 2023
665airfryerladies.comGoDaddy.com, LLC1 Feb 20226 Feb 20251 Feb 2027
666airfryerlady.comGoDaddy.com, LLC1 Feb 20226 Feb 20251 Feb 2027
667airfryerpros.comCloudFlare, Inc.8 May 202328 Apr 20258 May 2026
668airfryerspice.comGoogle, Inc.3 Feb 20223 Feb 20223 Feb 2023
669airfryernuts.comNameCheap, Inc.4 Feb 20225 Feb 20254 Feb 2026
670airfryerspecialist.onlineKey-Systems, LLC6 Feb 202221 Mar 20246 Feb 2024
671airfryerliner.netNamesilo, LLC10 Feb 202216 Apr 202510 Feb 2025
672airfryerlinermanufacturer.comNamesilo, LLC10 Feb 202216 Apr 202510 Feb 2025
673airfryerlinersupplier.comNamesilo, LLC10 Feb 202216 Mar 202510 Feb 2025
674airfryereview.comHosting Concepts B.V. dba Openprovider12 Feb 202210 Sep 202412 Feb 2026
675airfryerbuyonline.comNameCheap, Inc.13 Feb 202227 Apr 202313 Feb 2023
676airfryermall.comPorkbun, LLC4 Jun 202315 Jun 20244 Jun 2025
677airfryertarifleri.xyzReg2C.com Inc.5 May 202413 May 20255 May 2025
678airfryertoaster.comGoDaddy.com, LLC30 Jan 202530 Jan 202530 Jan 2026
679airfryerfavorites.comName.com, Inc.20 Feb 20224 Apr 202420 Feb 2024
680airfryerfordummies.comGoDaddy.com, LLC21 Feb 20223 Apr 202421 Feb 2024
681airfryerhome.xyzNameCheap, Inc.27 Feb 202210 May 202327 Feb 2023
682airfryerhome.questNameCheap, Inc.27 Feb 202210 Apr 202327 Feb 2023
683airfryers.questNameCheap, Inc.27 Feb 202210 Apr 202327 Feb 2023
684airfryerliners.netDynadot, LLC6 May 20246 May 20256 May 2026
685airfryeradvisor.ca-5 Mar 20225 Mar 20235 Mar 2024
686airfryerabcsabahia.comGoogle, Inc.5 Mar 20226 Mar 20235 Mar 2024
687airfryerseasonings.comNameCheap, Inc.6 Mar 20224 Feb 20256 Mar 2026
688airfryer2k.comTucows Domains Inc.8 Mar 202218 Apr 20238 Mar 2023
689airfryeryummy.comNameCheap, Inc.7 Nov 202119 Jan 20257 Nov 2024
690airfryers.lifeNameCheap, Inc.13 Mar 202224 May 202313 Mar 2023
691airfryereasy.comeNom, Inc.11 Mar 202211 Mar 202511 Mar 2026
692airfryercompact.comTucows Domains Inc.16 Mar 202226 Apr 202316 Mar 2023
693airfryerdeals.storeNameCheap, Inc.25 Mar 20249 Apr 202525 Mar 2026
694airfryeraaproveite.comTucows Domains Inc.20 Mar 202230 Apr 202420 Mar 2024
695airfryerhacks.storeGoDaddy.com, LLC25 Mar 20226 May 202425 Mar 2024
696airfryercan.comKey-Systems GmbH28 Mar 202230 Mar 202428 Mar 2025
697airfryerturner.comNameCheap, Inc.5 Apr 2022-5 Apr 2023
698airfryerturn.comNameCheap, Inc.5 Apr 2022-5 Apr 2023
699airfryerflip.comNameCheap, Inc.5 Apr 2022-5 Apr 2023
700airfryercage.comNameCheap, Inc.5 Apr 2022-5 Apr 2023
701airfryerflipper.comNameCheap, Inc.18 Apr 202330 Jun 202418 Apr 2024
702airfryermanufacturers.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…7 Apr 20222 Mar 20247 Apr 2026
703airfryers-uk.siteDOTSERVE INC.11 Apr 20221 Apr 202511 Apr 2026
704airfryeroff.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Apr 202224 Jun 202312 Apr 2023
705airfryersupplykitchen.comInternet Domain Services BS Corp12 Apr 202223 Jun 202312 Apr 2023
706airfryerssi.comKey-Systems GmbH13 Apr 202226 Jul 202313 Apr 2024
707airfryerninjafoodi.comCloud Yuqu LLC14 Apr 202217 Jun 202314 Apr 2023
708airfryerbanqbahia.comGoogle, Inc.14 Apr 202215 Apr 202314 Apr 2024
709airfryertest.comGoogle, Inc.17 Apr 20222 Apr 202517 Apr 2026
710airfryerny.comNameCheap, Inc.17 Apr 202229 Jun 202317 Apr 2023
711airfryerovens.storeAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…22 Apr 202230 Jun 202422 Apr 2024
712airfryeraccessories-com.com1&1 Internet AG24 Apr 20224 May 202324 Apr 2024
713airfryerextras.comGoogle, Inc.20 Feb 20243 Apr 202520 Feb 2025
714airfryersakeau.comKey-Systems GmbH25 Apr 202230 Apr 202425 Apr 2024
715airfryer66.siteAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…28 Apr 20226 Jul 202328 Apr 2023
716airfryer5.siteAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…28 Apr 20226 Jun 202328 Apr 2023
717airfryer66.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…28 Apr 20226 Jul 202328 Apr 2023
718airfryer5.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…28 Apr 20226 Jul 202328 Apr 2023
719airfryer66.ltdAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…28 Apr 202229 Apr 202328 Apr 2024
720airfryer66.lifeAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…28 Apr 202229 Apr 202328 Apr 2024
721airfryer66.infoAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…28 Apr 202229 Apr 202328 Apr 2024
722airfryer66.onlineAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…28 Apr 20226 Jul 202328 Apr 2023
723airfryerscanada.comKey-Systems GmbH29 Apr 202228 Mar 202429 Apr 2024
724airfryerchia.comTucows Domains Inc.1 May 20225 May 20231 May 2024
725airfryerswiki.comNamesilo, LLC2 May 20222 May 20232 May 2024
726airfryerbaking.comNameCheap, Inc.3 May 202218 Mar 20253 May 2026
727airfryeron.netHosting Concepts B.V. dba Openprovider6 May 202216 Jul 20236 May 2023
728airfryerza.comKey-Systems GmbH10 May 202210 May 202210 May 2023
729airfryerzaf.comKey-Systems GmbH10 May 202215 Jun 202310 May 2024
730airfryer91.comPDR Ltd. d/b/a PublicDomainRegistry.com11 May 202223 Jul 202311 May 2023
731airfryerbestrecipe.comGoogle, Inc.13 May 20222 Jun 202513 May 2025
732airfryerexpress.comGoDaddy.com, LLC6 Jul 20246 Jul 20246 Jul 2025
733airfryerromania.comNameCheap, Inc.14 May 202226 Jul 202314 May 2023
734airfryersettlement.comGoogle, Inc.15 May 202214 Jun 202415 May 2024
735airfryerlawsuit.comGoogle, Inc.15 May 202214 Jun 202415 May 2024
736airfryersuit.comGoogle, Inc.15 May 202214 Jun 202415 May 2024
737airfryerclassaction.comGoogle, Inc.15 May 202214 Jun 202415 May 2024
738airfryerclassactionlawsuit.comGoogle, Inc.15 May 202214 Jun 202415 May 2024
739airfryerseller.comRegister.it SPA16 May 202218 Jun 202316 May 2023
740airfryerssaleus.comKey-Systems GmbH16 May 202231 Mar 202416 May 2024
741airfryersaleus.comKey-Systems GmbH16 May 202220 Jun 202316 May 2024
742airfryersus.comKey-Systems GmbH16 May 202231 Mar 202416 May 2024
743airfryerrecips.comeName Technology Co., Ltd.17 May 202228 Jun 202317 May 2023
744airfryersguide.netCloudFlare, Inc.18 May 202227 Jun 202318 May 2023
745airfryertarifler.com-19 Aug 202419 Aug 202419 Aug 2025
746airfryerbestrecipes.onlineNameCheap, Inc.25 May 20227 Jul 202325 May 2023
747airfryerchoice.com-14 Jan 202414 Jan 202414 Jan 2025
748airfryerduo.comIHS Telekom, Inc.14 Jun 202228 May 202514 Jun 2026
749airfryeruno.comIHS Telekom, Inc.14 Jun 202228 May 202514 Jun 2026
750airfryerworl.comeName Technology Co., Ltd.15 Jun 202228 Aug 202315 Jun 2023
751airfryeropskrifter.dk-20 Sep 2017-30 Sep 2025
752airfryercomparison.comXiamen ChinaSource Internet Service Co., Ltd.18 Mar 202223 May 202318 Mar 2023
753airfryermomma.comGoogle, Inc.4 Sep 20224 Oct 20244 Sep 2024
754airfryer-por-apenas-99-reais.comGoogle, Inc.5 Jul 20226 Jul 20235 Jul 2024
755airfryerdisposablepaper.comGoDaddy.com, LLC4 Jul 202214 Sep 20234 Jul 2023
756airfryer-por-apenas-99reais.comGoogle, Inc.5 Jul 20226 Jul 20235 Jul 2024
757airfryerplace.comAmazon Registrar, Inc.6 Jul 202219 Sep 20246 Jul 2024
758airfryerreview.inGoDaddy.com, LLC30 Aug 201611 Oct 202330 Aug 2023
759airfryerlucrativa.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Jul 202226 Aug 202414 Jul 2024
760airfryerbootcamp.comGoDaddy.com, LLC9 Jul 202210 Jul 20249 Jul 2026
761airfryerecipes.comNameCheap, Inc.16 Jul 202224 Jun 202416 Jul 2025
762airfryerisrael.comTucows Domains Inc.17 Jul 202227 Sep 202317 Jul 2023
763airfryergm.comArsys Internet, S.L. dba NICLINE.COM19 Jul 202217 Sep 202219 Jul 2025
764airfryerfreidoras.comArsys Internet, S.L. dba NICLINE.COM19 Jul 202218 Sep 202419 Jul 2024
765airfryerrecipevideos.comGoDaddy.com, LLC21 Jul 202231 Aug 202421 Jul 2024
766airfryereats.orgGoDaddy.com, LLC1 Aug 202223 May 20251 Aug 2025
767airfryerfrozenfoods.orgGoogle, Inc.2 Aug 20222 Aug 20232 Aug 2024
768airfryermama.orgGoogle, Inc.2 Aug 20222 Aug 20232 Aug 2024
769airfryerpaperliners.netDNSPod, Inc.1 Aug 20221 Aug 20221 Aug 2023
770airfryermama.infoGoogle, Inc.2 Aug 20222 Aug 20232 Aug 2024
771airfryersliner.comGoogle, Inc.1 Aug 20222 Aug 20231 Aug 2024
772airfryerpaperliners.comDNSPod, Inc.1 Aug 20221 Sep 20231 Aug 2023
773airfryerdisposablepaperliner.com35 Technology Co., Ltd.1 Aug 202210 Oct 20231 Aug 2023
774airfryerfrozenfoods.netGoogle, Inc.2 Aug 20222 Aug 20232 Aug 2024
775airfryermama.netGoogle, Inc.2 Aug 20223 Aug 20232 Aug 2024
776airfryermoma.comGoogle, Inc.2 Aug 20223 Aug 20232 Aug 2024
777airfryerspray.comGoDaddy.com, LLC3 Aug 20223 Aug 20243 Aug 2025
778airfryerdeaire.comArsys Internet, S.L. dba NICLINE.COM5 Aug 20224 Oct 20225 Aug 2025
779airfryermamma.orgGoogle, Inc.7 Aug 20227 Aug 20237 Aug 2024
780airfryermamma.infoGoogle, Inc.7 Aug 20227 Aug 20237 Aug 2024
781airfryermamma.netGoogle, Inc.7 Aug 20228 Aug 20237 Aug 2024
782airfryermamma.comGoogle, Inc.7 Aug 20228 Aug 20237 Aug 2024
783airfryer-philco.onlineHostinger, UAB10 Aug 202211 Aug 202310 Aug 2024
784airfryerwiki.comNameCheap, Inc.9 Aug 202213 Aug 20249 Aug 2025
785airfryerhoming.infoNamesilo, LLC11 Aug 202211 Aug 202311 Aug 2024
786airfryerfritadeira.comGoogle, Inc.10 Aug 202211 Aug 202310 Aug 2024
787airfryercheatsheet.comGoDaddy.com, LLC10 Aug 202211 Aug 202410 Aug 2025
788airfryerlezzetleri.netGoogle, Inc.12 Aug 202211 Sep 202412 Aug 2024
789airfryerkitchensupply.comInternet Domain Services BS Corp12 Aug 20227 Aug 202412 Aug 2025
790airfryerlezzetleri.comGoogle, Inc.12 Aug 202211 Sep 202412 Aug 2024
791airfryerstoasteroven.comNameCheap, Inc.15 Aug 202226 Sep 202315 Aug 2023
792airfryertoasterovens.netNameCheap, Inc.16 Aug 20223 Aug 202416 Aug 2025
793airfryerrecipes.siteDOTSERVE INC.23 Aug 20221 Sep 202223 Aug 2024
794airfryer-basket.comTucows Domains Inc.21 Aug 20221 Oct 202321 Aug 2023
795airfryerveggiekit.comDynadot, LLC25 Aug 20224 Nov 202325 Aug 2023
796airfryersetembroo22.comGoogle, Inc.26 Aug 202227 Aug 202326 Aug 2024
797airfryerfest.comNameCheap, Inc.29 Aug 202210 Nov 202429 Aug 2024
798airfryerporkchops.siteDOTSERVE INC.1 Sep 202231 Aug 20231 Sep 2024
799airfryertarifleri.netGoogle, Inc.31 Aug 202229 Jun 202331 Aug 2023
800airfryerja.com.br-13 May 202116 Apr 202513 May 2026
801airfryermanuals.comCosmotown, Inc.8 Sep 202219 Oct 20238 Sep 2023
802airfryerdio.comRealtime Register B.V.16 Sep 202227 Nov 202316 Sep 2023
803airfryerpaper.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…8 Jan 202424 Apr 20248 Jan 2027
804airfryerdinnerrecipes.siteDOTSERVE INC.22 Sep 202231 Aug 202322 Sep 2024
805airfryer-airfryer.infoNameCheap, Inc.22 Sep 20227 Oct 202322 Sep 2024
806airfryercalculator.co.uk-11 May 202511 May 202511 May 2026
807airfryerdaily.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Mar 202528 Mar 202528 Mar 2026
808airfryertarifim.comGoogle, Inc.29 Sep 202230 Sep 202329 Sep 2024
809airfryerbg.comeNom, Inc.29 Sep 20229 Sep 202429 Sep 2025
810airfryerask.comPorkbun, LLC30 Sep 202210 Nov 202330 Sep 2023
811airfryerinsider.comNameCheap, Inc.2 Apr 20252 Apr 20252 Apr 2026
812airfryerboss.comNameCheap, Inc.1 Oct 20221 Sep 20241 Oct 2025
813airfryerwonder.comNameCheap, Inc.1 Mar 20242 Mar 20251 Mar 2026
814airfryerliners.storeTucows Domains Inc.5 Oct 202215 Dec 20235 Oct 2023
815airfryerhacks.co.uk-4 Oct 20226 Oct 20224 Oct 2023
816airfryerdepresente.comGoogle, Inc.7 Oct 20228 Oct 20237 Oct 2024
817airfryerbuzz.comNameCheap, Inc.5 Oct 202216 Nov 20235 Oct 2023
818airfryertricks.co.uk-6 Oct 202216 Jul 20246 Oct 2024
819airfryerchampions.comDomain.com, LLC7 Oct 202220 Nov 20237 Oct 2023
820airfryervegetarian.comGoogle, Inc.10 Oct 202225 Sep 202410 Oct 2025
821airfryers.storePorkbun, LLC17 Nov 202314 Oct 202417 Nov 2025
822airfryermicrowavecombo.comGoDaddy.com, LLC30 Jan 202530 Jan 202530 Jan 2026
823airfryercompare.comAscio Technologies, Inc. Danmark - Filial af Ascio…4 May 20254 May 20254 May 2026
824airfryercompare.co.uk-13 Oct 202224 Jul 202413 Oct 2024
825airfryered.comNameCheap, Inc.14 Oct 202226 Dec 202314 Oct 2023
826airfryersguide.co.uk-14 Oct 202214 Oct 202214 Oct 2024
827airfryerbloomingonion.siteDOTSERVE INC.19 Oct 20221 Oct 202419 Oct 2025
828airfryerhandlecover.comGoDaddy.com, LLC19 Oct 202231 Dec 202319 Oct 2023
829airfryerhandlecovers.comGoDaddy.com, LLC19 Oct 202215 Jan 202419 Oct 2024
830airfryertown.comWeb Commerce Communications Limited dba WebNic.cc19 Oct 202229 Dec 202319 Oct 2023
831airfryer-recipes.siteDOTSERVE INC.21 Oct 20221 Oct 202421 Oct 2025
832airfryerpixi.comNameCheap, Inc.20 Oct 20221 Jan 202420 Oct 2023
833airfryerclick.comNameCheap, Inc.23 Oct 202212 Oct 202423 Oct 2025
834airfryerchickenwingrecipes.siteDOTSERVE INC.26 Oct 20221 Oct 202426 Oct 2025
835airfryeramerica.comNameCheap, Inc.20 May 202521 May 202520 May 2026
836airfryerasian.comGoogle, Inc.27 Oct 202212 Oct 202427 Oct 2025
837airfryercompany.comTucows Domains Inc.28 Oct 20228 Dec 202328 Oct 2023
838airfryerrecipes-guide.siteDOTSERVE INC.1 Nov 20221 Nov 20221 Nov 2023
839airfryersuk.siteDOTSERVE INC.2 Nov 20221 Nov 20242 Nov 2025
840airfryersweetrecipes.comTucows Domains Inc.31 Oct 202231 Oct 202231 Oct 2023
841airfryer-world24.comKey-Systems GmbH31 Oct 20225 Dec 202331 Oct 2024
842airfryerbestreviews.comNameCheap, Inc.31 Oct 20221 Oct 202431 Oct 2025
843airfryerbakerycafe.comNameCheap, Inc.5 Nov 202217 Jan 20245 Nov 2023
844airfryer1-us.lifeGoDaddy.com, LLC7 Nov 20227 Nov 20227 Nov 2023
845airfryerwarehouse.comAmazon Registrar, Inc.23 Dec 202423 Dec 202423 Dec 2025
846airfryerenthusiast.comNameCheap, Inc.6 Nov 20227 Oct 20246 Nov 2025
847airfryerenthusiasts.comNameCheap, Inc.6 Nov 202218 Dec 20236 Nov 2023
848airfryerdinner.comDomainplace LLC9 Apr 202312 Apr 20249 Apr 2025
849airfryerdesserts.comNameCheap, Inc.5 Jun 20255 Jun 20255 Jun 2026
850airfryerapps.comGoDaddy.com, LLC19 Jul 202320 Jul 202419 Jul 2025
851airfryerwarehouse.co.uk-6 Nov 20226 Nov 20226 Nov 2023
852airfryersdirect.co.uk-18 Nov 202418 Nov 202418 Nov 2025
853airfryerrecipes-info.siteDOTSERVE INC.8 Nov 20228 Nov 20228 Nov 2023
854airfryer-recipes.co.uk-19 Apr 202522 May 202519 Apr 2026
855airfryere.onlineDomeneshop AS dba domainnameshop.com9 Nov 2022-9 Nov 2023
856airfryersoul.comAutomattic Inc.9 Nov 202222 Jan 20259 Nov 2024
857airfryerlineraustralia.comGoDaddy.com, LLC11 Nov 202223 Jan 202411 Nov 2023
858airfryerscenter.comTucows Domains Inc.11 Nov 202222 Jan 202411 Nov 2023
859airfryerchampion.comeNom, Inc.11 Nov 202224 Dec 202411 Nov 2024
860airfryerspecialist.nl-8 Aug 20248 Aug 2024-
861airfryerliner.co.uk-30 Apr 202530 Apr 202530 Apr 2026
862airfryer-guide.siteDOTSERVE INC.17 Nov 20221 Nov 202417 Nov 2025
863airfryerwonders.comGoDaddy.com, LLC17 Nov 202219 Nov 202417 Nov 2025
864airfryerturkiye.comGoDaddy.com, LLC17 Nov 202229 Jan 202417 Nov 2023
865airfryer-maker.comKingdomains, Incorporated17 Nov 202231 Jan 202417 Nov 2023
866airfryerxxl.comKey-Systems GmbH20 Feb 202520 Feb 202520 Feb 2026
867airfryeryemektarifleri.comReg2C.com Inc.19 Nov 20222 Dec 202319 Nov 2023
868airfryerjustified.comNameCheap, Inc.20 Nov 202231 Jan 202520 Nov 2024
869airfryerjustify.comNameCheap, Inc.20 Nov 20221 Jan 202420 Nov 2023
870airfryerpricereview.comCosmotown, Inc.20 Nov 202230 Jan 202420 Nov 2023
871airfryers2go.comTucows Domains Inc.21 Nov 20221 Jan 202421 Nov 2023
872airfryermfr.comCloud Yuqu LLC22 Nov 202222 Nov 202222 Nov 2025
873airfryerandoven.comGoDaddy.com, LLC24 Nov 20227 Jan 202524 Nov 2025
874airfryeraccesorios.shopKey-Systems, LLC26 Nov 20229 Feb 202326 Nov 2023
875airfryerfaqs.comAmazon Registrar, Inc.10 Nov 202410 Nov 202410 Nov 2025
876airfryerreceipt.comGoogle, Inc.27 Nov 202222 Nov 202427 Nov 2025
877airfryersrecipe.comGoogle, Inc.27 Nov 202222 Nov 202427 Nov 2025
878airfryerrecipes.online1&1 Internet AG29 Nov 202210 Dec 202329 Nov 2024
879airfryernutsroast.comTucows Domains Inc.30 Nov 202210 Feb 202430 Nov 2023
880airfryer-factory.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…30 Nov 20227 Dec 202430 Nov 2025
881airfryerdirect.co.uk-1 Dec 20222 Dec 20221 Dec 2023
882airfryerchallenge.comGoDaddy.com, LLC26 Sep 202127 Sep 202326 Sep 2025
883airfryerss.comTucows Domains Inc.3 Dec 202213 Feb 20243 Dec 2023
884airfryeronline.topNamesilo, LLC7 Dec 202231 Mar 20237 Dec 2024
885airfryerglobal.comGoDaddy.com, LLC4 Dec 202215 Feb 20244 Dec 2023
886airfryernorge.netOne.com A/S5 Dec 20226 Dec 20235 Dec 2024
887airfryerkalibi.comNameCheap, Inc.6 Dec 202217 Jan 20246 Dec 2023
888airfryer-mondial-amercanas.comGoogle, Inc.7 Dec 20228 Dec 20237 Dec 2024
889airfryerkit.comNameCheap, Inc.8 Dec 202219 Jan 20248 Dec 2023
890airfryermealkit.comGoDaddy.com, LLC23 Apr 202424 Apr 202523 Apr 2026
891airfryermealkits.comGoDaddy.com, LLC23 Apr 202424 Apr 202523 Apr 2026
892airfryermeal.comHostinger, UAB25 Oct 202422 Jan 202525 Oct 2025
893airfryerhero.comGandi SAS9 Dec 202217 Nov 20249 Dec 2025
894airfryerline.comHostinger, UAB10 Dec 202220 Jan 202410 Dec 2023
895airfryerrecipesideas.siteDOTSERVE INC.12 Dec 202213 Dec 202312 Dec 2024
896airfryertarif.comAutomattic Inc.11 Dec 202221 Nov 202411 Dec 2025
897airfryer-silikon.onlineHostinger, UAB14 Dec 202227 Jan 202514 Dec 2024
898airfryerencontre.comGoDaddy.com, LLC22 Jul 20212 Sep 202422 Jul 2024
899airfryer-dk.lifeGoDaddy.com, LLC15 Dec 202220 Dec 202315 Dec 2024
900airfryer-nl.lifeGoDaddy.com, LLC15 Dec 202220 Dec 202315 Dec 2024
901airfryerliners.onlinePDR Ltd. d/b/a PublicDomainRegistry.com16 Dec 202217 Dec 202316 Dec 2024
902airfryersonsale.co.uk-15 Dec 202215 Nov 202415 Dec 2025
903airfryertalk.comPorkbun, LLC17 Dec 202227 Jan 202417 Dec 2023
904airfryerservisi.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.18 Dec 202212 Dec 202418 Dec 2025
905airfryercocina.comPorkbun, LLC20 Dec 202219 Dec 202420 Dec 2025
906airfryerquebec.comGoDaddy.com, LLC21 Dec 202221 Dec 202421 Dec 2025
907airfryergoodie.comCosmotown, Inc.23 Dec 20223 Mar 202423 Dec 2023
908airfryerconverter.comTucows Domains Inc.25 Mar 202525 Mar 202525 Mar 2026
909airfryersociety.co.uk-29 Dec 202229 Dec 202229 Dec 2023
910airfryerclub.co.uk-30 Dec 202213 Mar 202530 Dec 2026
911airfryergeeks.co.uk-30 Dec 202231 Dec 202430 Dec 2025
912airfryerecipe.sitePDR Ltd. d/b/a PublicDomainRegistry.com1 Jan 20238 Mar 20241 Jan 2024
913airfryertools.comGoDaddy.com, LLC10 Dec 202110 Dec 202410 Dec 2027
914airfryers.ltdGoDaddy.com, LLC10 Mar 202515 Mar 202510 Mar 2026
915airfryerbuddy.comNameCheap, Inc.20 May 202520 May 202520 May 2027
916airfryerit.com1API GmbH18 Dec 202418 Dec 202418 Dec 2025
917airfryerbaskets.comTucows Domains Inc.4 Jan 202316 Mar 20244 Jan 2024
918airfryerreheat.comGoDaddy.com, LLC5 Jan 202318 Mar 20245 Jan 2024
919airfryerx.comTucows Domains Inc.3 Jan 202313 Feb 20243 Jan 2024
920airfryerbuddies.comGoDaddy.com, LLC9 Jan 202321 Jan 20249 Jan 2025
921airfryerreview.orgGoDaddy.com, LLC11 Jan 202325 Feb 202511 Jan 2026
922airfryermondialafn.comHostinger, UAB10 Jan 202321 Mar 202410 Jan 2024
923airfryercontent.netFastDomain Inc.11 Jan 202312 Jan 202411 Jan 2025
924airfryerworld.netNameCheap, Inc.11 Jan 202322 Feb 202411 Jan 2024
925airfryergirl.uk-11 Jan 202318 Mar 202411 Jan 2024
926airfryerninja.onlineSynergy Wholesale Pty Ltd13 Jan 202324 Mar 202413 Jan 2024
927airfryer-recipe.comGoDaddy.com, LLC12 Jan 202326 Mar 202512 Jan 2025
928airfryerecipe.comGoogle, Inc.12 Jan 202328 Dec 202412 Jan 2026
929airfryerecipe.co.uk-12 Jan 202328 Dec 202412 Jan 2026
930airfryerpro.co.uk-12 Jan 202311 Jan 202512 Jan 2026
931airfryerdelight.comGoogle, Inc.13 Jan 202312 Feb 202513 Jan 2026
932airfryersmats.comGoogle, Inc.13 Jan 202314 Mar 202413 Jan 2024
933airfryertimings.infoGoDaddy.com, LLC15 Jan 202327 Mar 202415 Jan 2024
934airfryertimings.comGoDaddy.com, LLC15 Jan 202327 Jan 202415 Jan 2025
935airfryers.appAutomattic Inc.19 Jan 202114 Apr 202419 Jan 2026
936airfryergoat.comDomain.com, LLC17 Jan 20232 Jan 202517 Jan 2026
937airfryertrude.onlineDomeneshop AS dba domainnameshop.com19 Jan 202318 Mar 202519 Jan 2026
938airfryertrude.comDomeneshop AS dba domainnameshop.com19 Jan 20237 May 202519 Jan 2026
939airfryerindeed.com-24 Jan 202331 Mar 202424 Jan 2024
940airfryertest.beRealtime Register B.V.15 Mar 2018--
941airfryerforfamily.comCloudFlare, Inc.22 Jan 20232 Mar 202422 Jan 2024
942airfryerguys.comGoDaddy.com, LLC22 Jan 20234 Apr 202422 Jan 2024
943airfryerthings.comGoDaddy.com, LLC22 Jan 20234 Apr 202422 Jan 2024
944airfryers.beRealtime Register B.V.27 Jun 2020--
945airfryeroppskrifter.comCloudFlare, Inc.23 Jan 20234 Jan 202523 Jan 2026
946airfryersfinder.comAbove.com Pty Ltd.23 Jan 20236 Mar 202523 Jan 2025
947airfryerguys.co.uk-22 Jan 202310 Aug 202322 Jan 2024
948airfryersguru.comHostinger, UAB26 Jan 20237 Mar 202426 Jan 2024
949airfryerrecipesforbeginnersinfo.spaceDOTSERVE INC.27 Jan 20234 Mar 202427 Jan 2024
950airfryeraccessory.comNameCheap, Inc.27 Jan 20239 Apr 202427 Jan 2024
951airfryerdelices.comTucows Domains Inc.27 Jan 20238 Apr 202427 Jan 2024
952airfryerfella.comDreamHost, LLC27 Jan 202310 Apr 202427 Jan 2026
953airfryercalculator.appGoogle, Inc.27 Jan 202318 Jan 202527 Jan 2026
954airfryerfella.co.uk-27 Jan 202328 Jan 202527 Jan 2026
955airfryerfrenzy.co.uk-27 Jan 20239 Dec 202427 Jan 2025
956airfryerguy.co.uk-27 Jan 20239 Dec 202427 Jan 2025
957airfryertarifi.com-6 May 20246 Jun 20256 May 2025
958airfryergirl.co.uk-28 Jan 202313 Jan 202528 Jan 2026
959airfryerswrld.comGoDaddy.com, LLC30 Jan 202312 Mar 202430 Jan 2024
960airfryersatisnoktasi.comAtak Domain Hosting Internet d/b/a Atak Teknoloji3 Feb 202314 Feb 20233 Feb 2024
961airfryerdiscount.comWeb Commerce Communications Limited dba WebNic.cc31 Jan 202331 Jan 202331 Jan 2024
962airfryeres.comGoDaddy.com, LLC31 Jan 202313 Mar 202431 Jan 2024
963airfryernorway.comKey-Systems GmbH31 Jan 202314 Mar 202431 Jan 2024
964airfryery.comGoDaddy.com, LLC31 Jan 202331 Jan 202331 Jan 2024
965airfryerpisirmekagidi.comİsimtescil Bilişim A.Ş.1 Feb 202315 Mar 20241 Feb 2024
966airfryer-indirim.com-2 Feb 20234 Mar 20242 Feb 2024
967airfryercookingpaper.comİsimtescil Bilişim A.Ş.3 Feb 202317 Mar 20243 Feb 2024
968airfryertariflerim.com-3 Feb 20235 Mar 20243 Feb 2024
969airfryer-ge.clickPSI-USA, Inc. dba Domain Robot15 Apr 202215 Apr 202415 Apr 2025
970airfryerrecept.comAscio Technologies, Inc. Danmark - Filial af Ascio…6 Feb 202327 Mar 20246 Feb 2026
971airfryers.coDynadot, LLC24 Nov 201725 Jan 202524 Nov 2025
972airfryerpaper.topAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…10 Feb 202319 Mar 202410 Feb 2024
973airfryerchef.siteGoDaddy.com, LLC15 Feb 202317 Sep 202315 Feb 2024
974airfryereats.co.uk-14 Feb 202314 Feb 202314 Feb 2024
975airfryereats.uk-14 Feb 202314 Feb 202314 Feb 2024
976airfryersheet.comGoDaddy.com, LLC16 Feb 202328 Apr 202416 Feb 2024
977airfryerchickenwings.siteDOTSERVE INC.17 Feb 20231 Mar 202517 Feb 2026
978airfryeracc.comNamesilo, LLC17 Feb 202322 Mar 202417 Feb 2024
979airfryerkok.nl-13 Sep 202216 Apr 2025-
980airfryerketo.orgGoogle, Inc.18 Feb 202319 Mar 202418 Feb 2024
981airfryermeta.comNameCheap, Inc.20 Feb 202321 Feb 202420 Feb 2025
982airfryerpellets.comKey-Systems GmbH22 Feb 202329 Apr 202522 Feb 2025
983airfryermastery.comGoDaddy.com, LLC22 Feb 20235 Apr 202522 Feb 2025
984airfryerology.comPorkbun, LLC23 Feb 20234 Apr 202423 Feb 2024
985airfryerpellets.co.uk-22 Feb 202322 Feb 202422 Feb 2025
986airfryergeek.comNameCheap, Inc.24 Feb 20237 May 202424 Feb 2024
987airfryerpro.netHostinger, UAB25 Feb 202310 May 202525 Feb 2025
988airfryerpapi.comGoDaddy.com, LLC4 Dec 20215 Dec 20244 Dec 2025
989airfryerchickenwing-recipes.siteDOTSERVE INC.27 Feb 20231 Mar 202527 Feb 2026
990airfryerbasket.storeTucows Domains Inc.27 Feb 20238 May 202427 Feb 2024
991airfryeraksesuar.comİsimtescil Bilişim A.Ş.27 Feb 202312 May 202527 Feb 2025
992airfryerdunyasi.comİsimtescil Bilişim A.Ş.27 Feb 202312 May 202527 Feb 2025
993airfryeraksesuarlari.comİsimtescil Bilişim A.Ş.27 Feb 202312 May 202527 Feb 2025
994airfryertemperature.comCosmotown, Inc.14 Jan 202324 Feb 202414 Jan 2024
995airfryers.clickPSI-USA, Inc. dba Domain Robot1 Mar 20231 Mar 20251 Mar 2026
996airfryerstools.comAbove.com Pty Ltd.28 Feb 202311 May 202428 Feb 2024
997airfryeria.top-1 Mar 202317 Mar 20251 Mar 2026
998airfryerstop.comLexsynergy Limited1 Mar 20232 Mar 20241 Mar 2025
999airfryertop.uk-1 Mar 20231 Mar 20241 Mar 2024
1000airfryerdeluxe.comRealtime Register B.V.2 Mar 20237 Feb 20252 Mar 2026

Displaying 1,000 out of 1,719 domains starting with the keyword "AIRFRYER". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=airfryer

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now