With support for 
Keyword: AFFILIATEMARKETING
Reverse Whois » KEYWORD [affiliatemarketing ] { 4,603 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | affiliatemarketing.de | - | - | 13 May 2021 | - |
| 2 | affiliatemarketing.name | - | - | - | - |
| 3 | affiliatemarketing.pub | Name.com, Inc. | 9 Jul 2014 | 9 Jul 2014 | 9 Jul 2015 |
| 4 | affiliatemarketing.graphics | NameCheap, Inc. | 9 Jul 2014 | 15 Jun 2019 | 9 Jul 2020 |
| 5 | affiliatemarketing.tools | Tucows Domains Inc. | 16 Mar 2025 | 16 Mar 2025 | - |
| 6 | affiliatemarketing.investments | united-domains AG | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 7 | affiliatemarketing.rocks | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 8 | affiliatemarketing.cash | - | 29 May 2024 | 30 May 2025 | 29 May 2026 |
| 9 | affiliatemarketing.guide | NameCheap, Inc. | 5 Dec 2021 | 16 Jan 2025 | 5 Dec 2024 |
| 10 | affiliatemarketing.services | NameCheap, Inc. | 28 Oct 2022 | - | - |
| 11 | affiliatemarketing.nyc | GoDaddy.com, LLC | 8 Oct 2014 | 20 Oct 2025 | 7 Oct 2026 |
| 12 | affiliatemarketing.wiki | Cronon AG | 28 Oct 2014 | 20 Oct 2025 | 28 Oct 2026 |
| 13 | affiliatemarketing.click | Dynadot, LLC | 8 Aug 2024 | 27 Jul 2025 | 8 Aug 2026 |
| 14 | affiliatemarketing.associates | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2016 |
| 15 | affiliatemarketing.business | - | 19 Jun 2017 | 24 May 2025 | - |
| 16 | affiliatemarketing.world | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Apr 2017 | 9 Apr 2020 | 1 Apr 2026 |
| 17 | affiliatemarketing.global | NameCheap, Inc. | 10 Jan 2026 | - | - |
| 18 | affiliatemarketing.help | Porkbun, LLC | 13 Mar 2025 | 11 Apr 2025 | 13 Mar 2026 |
| 19 | affiliatemarketing.partners | - | 7 May 2025 | - | 7 May 2026 |
| 20 | affiliatemarketing.network | GoDaddy.com, LLC | 6 Feb 2015 | 23 Mar 2025 | 6 Feb 2026 |
| 21 | affiliatemarketing.how | Name.com, Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 22 | affiliatemarketing.enterprises | GoDaddy.com, LLC | 6 Feb 2015 | 19 Apr 2025 | 6 Feb 2025 |
| 23 | affiliatemarketing.top | - | 19 Mar 2025 | 5 Jul 2025 | 19 Mar 2026 |
| 24 | affiliatemarketing.space | Porkbun, LLC | 26 May 2019 | 12 May 2025 | 26 May 2026 |
| 25 | affiliatemarketing.work | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Mar 2015 | 16 Oct 2025 | 6 Mar 2026 |
| 26 | affiliatemarketing.rip | eNom, Inc. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 27 | affiliatemarketing.coach | Name.com, Inc. | 12 Jan 2025 | 17 Jan 2025 | 12 Jan 2027 |
| 28 | affiliatemarketing.money | GoDaddy.com, LLC | 8 Jul 2023 | 22 Aug 2025 | 8 Jul 2026 |
| 29 | affiliatemarketing.party | NameCheap, Inc. | 11 Nov 2020 | 11 Nov 2020 | 11 Nov 2021 |
| 30 | affiliatemarketing.casa | Minds + Machines Registrar Limited | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 31 | affiliatemarketing.school | NameKing.com Inc. | 14 Oct 2023 | 14 Dec 2024 | 14 Oct 2024 |
| 32 | affiliatemarketing.uno | Hosting Ukraine LLC | 21 Feb 2023 | 4 May 2024 | 21 Feb 2024 |
| 33 | affiliatemarketing.news | - | 27 Apr 2024 | 10 Jun 2025 | 27 Apr 2025 |
| 34 | affiliatemarketing.site | united-domains AG | 15 Jul 2015 | 12 Jul 2017 | 15 Jul 2018 |
| 35 | affiliatemarketing.social | GoDaddy.com, LLC | 5 May 2024 | 5 May 2025 | 5 May 2026 |
| 36 | affiliatemarketing.webcam | Alpnames Limited | 6 May 2015 | - | 5 May 2016 |
| 37 | affiliatemarketing.online | RegistryGate GmbH | 26 Aug 2015 | 25 Nov 2025 | 26 Aug 2026 |
| 38 | affiliatemarketing.university | Name.com, Inc. | 4 Sep 2015 | 7 Sep 2025 | 4 Sep 2026 |
| 39 | affiliatemarketing.place | eNom, Inc. | 24 Sep 2015 | 24 Sep 2015 | 24 Sep 2016 |
| 40 | affiliatemarketing.life | - | 20 Jun 2024 | 20 Jun 2025 | 20 Jun 2026 |
| 41 | affiliatemarketing.tips | NameKing.com Inc. | 21 Oct 2024 | 23 Nov 2025 | 21 Oct 2025 |
| 42 | affiliatemarketing.solutions | GoDaddy.com, LLC | 16 Oct 2024 | 27 Dec 2025 | 16 Oct 2025 |
| 43 | affiliatemarketing.review | Namesilo, LLC | 13 Nov 2024 | 17 Dec 2025 | 13 Nov 2025 |
| 44 | affiliatemarketing.fyi | Dynadot, LLC | 3 Dec 2024 | 3 Dec 2025 | 3 Dec 2026 |
| 45 | affiliatemarketing.community | CloudFlare, Inc. | 26 Nov 2023 | 27 Oct 2025 | 26 Nov 2026 |
| 46 | affiliatemarketing.center | OVH sas | 13 Mar 2023 | 6 Feb 2025 | 13 Mar 2026 |
| 47 | affiliatemarketing.koeln | EuroDNS S.A. | 1 Oct 2015 | - | 1 Oct 2016 |
| 48 | affiliatemarketing.support | NameCheap, Inc. | 28 Nov 2021 | 28 Nov 2021 | 28 Nov 2022 |
| 49 | affiliatemarketing.design | Google, Inc. | 25 Jun 2022 | 25 Feb 2024 | 25 Jun 2024 |
| 50 | affiliatemarketing.college | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 51 | affiliatemarketing.management | NameKing.com Inc. | 28 Jan 2024 | 28 Feb 2025 | 28 Jan 2026 |
| 52 | affiliatemarketing.trade | NameCheap, Inc. | 23 Oct 2024 | 7 Nov 2025 | 23 Oct 2025 |
| 53 | affiliatemarketing.buzz | - | 10 Aug 2024 | 15 Aug 2024 | 10 Aug 2025 |
| 54 | affiliatemarketing.gratis | Realtime Register B.V. | 31 Mar 2016 | 31 Mar 2016 | 31 Mar 2017 |
| 55 | affiliatemarketing.bid | NameCheap, Inc. | 31 Mar 2016 | 31 Mar 2016 | 30 Mar 2017 |
| 56 | affiliatemarketing.mobi | NameKing.com Inc. | 10 Aug 2024 | 10 Aug 2025 | 10 Aug 2025 |
| 57 | affiliatemarketing.win | NameCheap, Inc. | 21 Jan 2023 | 5 Feb 2024 | 21 Jan 2024 |
| 58 | affiliatemarketing.live | NameCheap, Inc. | 28 Jun 2025 | - | - |
| 59 | affiliatemarketing.rent | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 60 | affiliatemarketing.download | NameCheap, Inc. | 19 Dec 2017 | 19 Dec 2017 | 19 Dec 2022 |
| 61 | affiliatemarketing.ltd | GoDaddy.com, LLC | 25 Mar 2024 | 9 May 2025 | 25 Mar 2026 |
| 62 | affiliatemarketing.store | GoDaddy.com, LLC | 20 Apr 2025 | 15 Nov 2025 | 20 Apr 2026 |
| 63 | affiliatemarketing.science | NameCheap, Inc. | 8 Feb 2018 | 8 Feb 2018 | 8 Feb 2023 |
| 64 | affiliatemarketing.guru | eNom, Inc. | 2 Feb 2014 | 17 Mar 2025 | 2 Feb 2025 |
| 65 | affiliatemarketing.racing | NameCheap, Inc. | 2 Jun 2016 | 2 Jun 2016 | 1 Jun 2017 |
| 66 | affiliatemarketing.ninja | Key-Systems, LLC | 28 May 2014 | 12 Jul 2017 | 28 May 2018 |
| 67 | affiliatemarketing.academy | NameCheap, Inc. | 23 Nov 2024 | - | - |
| 68 | affiliatemarketing.training | GoDaddy.com, LLC | 26 Mar 2014 | 7 May 2024 | 26 Mar 2024 |
| 69 | affiliatemarketing.today | Porkbun, LLC | 3 Nov 2019 | 19 Sep 2025 | 3 Nov 2026 |
| 70 | affiliatemarketing.directory | GoDaddy.com, LLC | 23 Feb 2014 | 9 Apr 2025 | 23 Feb 2026 |
| 71 | affiliatemarketing.email | Porkbun, LLC | 11 Mar 2022 | 22 May 2024 | 11 Mar 2024 |
| 72 | affiliatemarketing.agency | Go Australia Domains, LLC | 30 Apr 2014 | 14 Jun 2025 | 30 Apr 2026 |
| 73 | affiliatemarketing.zone | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 74 | affiliatemarketing.expert | GoDaddy.com, LLC | 9 Dec 2021 | 15 Dec 2025 | 9 Dec 2026 |
| 75 | affiliatemarketing.link | Name.com, Inc. | 15 Apr 2014 | 16 Apr 2017 | 15 Apr 2018 |
| 76 | affiliatemarketing.biz | GoDaddy.com, LLC | 10 Aug 2003 | 23 Oct 2025 | 9 Aug 2029 |
| 77 | affiliatemarketing.com | GoDaddy.com, LLC | 31 Jan 2001 | 1 Jan 2026 | 31 Jan 2027 |
| 78 | affiliatemarketing.xyz | Dynadot, LLC | 11 Jan 2019 | 12 Jan 2026 | 11 Jan 2027 |
| 79 | affiliatemarketing.one | Dynadot, LLC | 20 Jan 2025 | 20 Jan 2026 | 20 Jan 2026 |
| 80 | affiliatemarketing.vlaanderen | Hosting Concepts B.V. dba Openprovider | 5 Sep 2016 | 5 Sep 2016 | 5 Sep 2017 |
| 81 | affiliatemarketing.info | united-domains AG | 21 Sep 2001 | 5 Nov 2025 | 21 Sep 2026 |
| 82 | affiliatemarketing.net | DNC Holdings, Inc. | 31 Jan 2001 | 17 Dec 2024 | 31 Jan 2026 |
| 83 | affiliatemarketing.org | GoDaddy.com, LLC | 1 Apr 2002 | 24 Jul 2024 | 1 Apr 2026 |
| 84 | affiliatemarketing.tech | West263 International Limited | 23 Aug 2025 | 16 Sep 2025 | 23 Aug 2026 |
| 85 | affiliatemarketing.quebec | eNom, Inc. | 19 Aug 2015 | 8 Aug 2016 | 19 Aug 2017 |
| 86 | affiliatemarketing.ca | Group NBT plc aka NetNames | 20 Feb 2004 | 7 Nov 2017 | 20 Feb 2019 |
| 87 | affiliatemarketing.ws | FastDomain Inc. | 13 Oct 2017 | 27 Sep 2025 | 13 Oct 2026 |
| 88 | affiliatemarketing.courses | Porkbun, LLC | 27 May 2020 | 8 Jul 2025 | 27 May 2025 |
| 89 | affiliatemarketing.website | NameCheap, Inc. | 25 Jul 2020 | 1 Aug 2025 | 25 Jul 2026 |
| 90 | affiliatemarketing.group | GoDaddy.com, LLC | 21 Jul 2022 | 4 Sep 2025 | 21 Jul 2026 |
| 91 | affiliatemarketing.club | Global Domains International, Inc. DBA DomainCostC… | 21 Mar 2019 | 13 Dec 2025 | 21 Mar 2026 |
| 92 | affiliatemarketing.men | NameCheap, Inc. | 21 Jan 2023 | 5 Feb 2024 | 21 Jan 2024 |
| 93 | affiliatemarketing.cloud | Hostinger, UAB | 11 Nov 2025 | 27 Nov 2025 | 11 Nov 2026 |
| 94 | affiliatemarketing.marketing | NameCheap, Inc. | 4 Dec 2025 | - | - |
| 95 | affiliatemarketing.direct | GoDaddy.com, LLC | 24 Jul 2020 | 24 Jul 2020 | 24 Jul 2021 |
| 96 | affiliatemarketing.works | CloudFlare, Inc. | 12 Oct 2024 | 6 Oct 2025 | 12 Oct 2026 |
| 97 | affiliatemarketing.events | NameCheap, Inc. | 12 Oct 2025 | - | - |
| 98 | affiliatemarketing.city | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 99 | affiliatemarketing.digital | 1&1 Internet AG | 9 Mar 2024 | 16 Sep 2025 | 9 Mar 2026 |
| 100 | affiliatemarketing.chat | - | 30 Nov 2024 | - | 30 Nov 2025 |
| 101 | affiliatemarketing.mba | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 102 | affiliatemarketing.team | Limited Liability Company "Registrar of domain nam… | 24 Jun 2022 | 1 Sep 2023 | 24 Jun 2023 |
| 103 | affiliatemarketing.delivery | Uniregistrar Corp | 17 Dec 2017 | 17 Dec 2017 | 17 Dec 2018 |
| 104 | affiliatemarketing.coupons | Uniregistrar Corp | 17 Dec 2017 | 17 Dec 2017 | 17 Dec 2018 |
| 105 | affiliatemarketing.clothing | Uniregistrar Corp | 17 Dec 2017 | 17 Dec 2017 | 17 Dec 2018 |
| 106 | affiliatemarketing.holiday | Uniregistrar Corp | 17 Dec 2017 | 17 Dec 2017 | 17 Dec 2018 |
| 107 | affiliatemarketing.date | NameCheap, Inc. | 19 Dec 2017 | 19 Dec 2017 | 19 Dec 2022 |
| 108 | affiliatemarketing.co.uk | - | 23 Jun 1999 | 26 Jun 2025 | 23 Jun 2027 |
| 109 | affiliatemarketing.me.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 9 Dec 2017 | 9 Dec 2017 | 9 Dec 2019 |
| 110 | affiliatemarketing.org.uk | - | 15 Oct 2003 | 14 Oct 2024 | 15 Oct 2026 |
| 111 | affiliatemarketing.mom | - | 7 Apr 2024 | 20 May 2025 | 7 Apr 2025 |
| 112 | affiliatemarketing.media | GoDaddy.com, LLC | 11 Feb 2025 | 16 Feb 2025 | 11 Feb 2026 |
| 113 | affiliatemarketing.consulting | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 114 | affiliatemarketing.recipes | Uniregistrar Corp | 28 Feb 2018 | 28 Feb 2018 | 28 Feb 2019 |
| 115 | affiliatemarketing.gift | Uniregistrar Corp | 28 Feb 2018 | 28 Feb 2018 | 28 Feb 2019 |
| 116 | affiliatemarketing.fund | Uniregistrar Corp | 28 Feb 2018 | 28 Feb 2018 | 28 Feb 2019 |
| 117 | affiliatemarketing.studio | NameCheap, Inc. | 23 Jun 2021 | 4 Aug 2024 | 23 Jun 2024 |
| 118 | affiliatemarketing.jewelry | Uniregistrar Corp | 28 Feb 2018 | 2 Mar 2018 | 28 Feb 2019 |
| 119 | affiliatemarketing.christmas | Uniregistrar Corp | 28 Feb 2018 | 2 Mar 2018 | 28 Feb 2019 |
| 120 | affiliatemarketing.town | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 121 | affiliatemarketing.fitness | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 122 | affiliatemarketing.realty | Uniregistrar Corp | 28 Feb 2018 | 2 Mar 2018 | 28 Feb 2019 |
| 123 | affiliatemarketing.exposed | Uniregistrar Corp | 1 Mar 2018 | 1 Mar 2018 | 1 Mar 2019 |
| 124 | affiliatemarketing.video | GoDaddy.com, LLC | 21 Jul 2022 | 1 Sep 2025 | 21 Jul 2025 |
| 125 | affiliatemarketing.run | OVH sas | 11 May 2018 | 26 May 2020 | 11 May 2021 |
| 126 | affiliatemarketing.company | Dynadot, LLC | 16 Dec 2022 | 17 Dec 2024 | 16 Dec 2025 |
| 127 | affiliatemarketing.pizza | Uniregistrar Corp | 27 May 2018 | 27 May 2018 | 27 May 2019 |
| 128 | affiliatemarketing.golf | Uniregistrar Corp | 27 May 2018 | 27 May 2018 | 27 May 2019 |
| 129 | affiliatemarketing.sexy | Uniregistrar Corp | - | - | - |
| 130 | affiliatemarketing.institute | NameCheap, Inc. | 21 Jan 2023 | 4 Mar 2025 | 21 Jan 2025 |
| 131 | affiliatemarketing.systems | NameCheap, Inc. | 12 Feb 2025 | - | - |
| 132 | affiliatemarketing.page | GoDaddy.com, LLC | 24 Jan 2025 | 24 Jan 2026 | 24 Jan 2027 |
| 133 | affiliatemarketing.deals | GoDaddy.com, LLC | 7 Dec 2022 | 17 Feb 2024 | 7 Dec 2023 |
| 134 | affiliatemarketing.dev | GoDaddy.com, LLC | 20 Jul 2022 | 10 Oct 2025 | 20 Jul 2026 |
| 135 | affiliatemarketing.equipment | united-domains AG | 18 May 2019 | 1 Jul 2025 | 18 May 2025 |
| 136 | affiliatemarketing.report | GoDaddy.com, LLC | 29 Dec 2022 | 11 Mar 2025 | 29 Dec 2024 |
| 137 | affiliatemarketing.education | NameCheap, Inc. | 13 Dec 2023 | 13 Nov 2024 | - |
| 138 | affiliatemarketing.gold | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 139 | affiliatemarketing.blue | NameCheap, Inc. | 21 Jan 2023 | 4 Mar 2025 | 21 Jan 2025 |
| 140 | affiliatemarketing.us | GoDaddy.com, LLC | 24 Apr 2002 | 10 Apr 2025 | 23 Apr 2026 |
| 141 | affiliatemarketing.pro | - | 28 Oct 2022 | 7 Nov 2024 | - |
| 142 | affiliatemarketing.plus | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Jun 2023 | 27 Jun 2024 | 26 Jun 2025 |
| 143 | affiliatemarketing.press | NameCheap, Inc. | 28 Aug 2022 | 1 Sep 2025 | 28 Aug 2026 |
| 144 | affiliatemarketing.onl | NameCheap, Inc. | 26 Feb 2017 | 12 Apr 2025 | 26 Feb 2026 |
| 145 | affiliatemarketing.asia | Mat Bao Trading & Service Company Limited d/b/a Ma… | 6 Nov 2022 | 17 Nov 2025 | 6 Nov 2026 |
| 146 | affiliatemarketing.icu | NameCheap, Inc. | 17 Mar 2023 | 2 Apr 2025 | 17 Mar 2026 |
| 147 | affiliatemarketing.ink | NameCheap, Inc. | 12 Jun 2025 | 20 Oct 2025 | 12 Jun 2026 |
| 148 | affiliatemarketing.contact | Porkbun, LLC | 19 Dec 2020 | 19 Dec 2020 | 19 Dec 2021 |
| 149 | affiliatemarketing.co | GoDaddy.com, LLC | 23 Apr 2010 | 21 May 2025 | 22 Apr 2026 |
| 150 | affiliatemarketing.land | NameCheap, Inc. | 11 Jun 2021 | 11 Jun 2021 | 11 Jun 2022 |
| 151 | affiliatemarketing.sbs | NameCheap, Inc. | 25 Aug 2024 | 26 Aug 2025 | 25 Aug 2026 |
| 152 | affiliatemarketing.promo | Google, Inc. | 6 Nov 2021 | 6 Nov 2023 | 6 Nov 2024 |
| 153 | affiliatemarketing.fr | OVH sas | 16 Jan 2020 | 29 Dec 2025 | 29 Dec 2026 |
| 154 | affiliatemarketing.host | Hostinger, UAB | 4 Feb 2024 | 19 Apr 2025 | 4 Feb 2025 |
| 155 | affiliatemarketing.doctor | Uniregistrar Corp | 28 Jan 2022 | 28 Jan 2022 | 28 Jan 2023 |
| 156 | affiliatemarketing.beauty | NameCheap, Inc. | 26 May 2022 | 20 Jun 2022 | 26 May 2024 |
| 157 | affiliatemarketing.quest | NameCheap, Inc. | 19 Aug 2022 | 31 Oct 2024 | 19 Aug 2024 |
| 158 | affiliatemarketing.co.in | - | 27 Jun 2017 | 11 Aug 2025 | 27 Jun 2026 |
| 159 | affiliatemarketing.ventures | GoDaddy.com, LLC | 11 Nov 2022 | 11 Nov 2022 | 11 Nov 2023 |
| 160 | affiliatemarketing.foundation | NameCheap, Inc. | 14 Dec 2022 | 24 Feb 2024 | 14 Dec 2023 |
| 161 | affiliatemarketing.app | 1API GmbH | 12 Jul 2019 | 14 Oct 2024 | 12 Jul 2025 |
| 162 | affiliatemarketing.africa | Hosting Concepts B.V. dba Openprovider | 1 Nov 2017 | 30 Oct 2025 | 1 Nov 2026 |
| 163 | affiliatemarketing.watch | NameCheap, Inc. | 21 Jan 2023 | 2 Apr 2024 | 21 Jan 2024 |
| 164 | affiliatemarketing.autos | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 165 | affiliatemarketing.baby | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 166 | affiliatemarketing.best | NameCheap, Inc. | 21 Jan 2023 | 5 Mar 2025 | 21 Jan 2025 |
| 167 | affiliatemarketing.black | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 168 | affiliatemarketing.boats | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 169 | affiliatemarketing.boutique | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 170 | affiliatemarketing.cheap | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 171 | affiliatemarketing.clinic | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 172 | affiliatemarketing.codes | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 173 | affiliatemarketing.cool | NameCheap, Inc. | 21 Jan 2023 | 4 Mar 2025 | 21 Jan 2025 |
| 174 | affiliatemarketing.faith | NameCheap, Inc. | 21 Jan 2023 | 5 Feb 2024 | 21 Jan 2024 |
| 175 | affiliatemarketing.farm | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 176 | affiliatemarketing.fashion | NameCheap, Inc. | 21 Jan 2023 | 5 Feb 2024 | 21 Jan 2024 |
| 177 | affiliatemarketing.hair | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 178 | affiliatemarketing.homes | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 179 | affiliatemarketing.hosting | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 180 | affiliatemarketing.kitchen | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 181 | affiliatemarketing.lgbt | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 182 | affiliatemarketing.love | NameCheap, Inc. | 20 Jul 2025 | 25 Jul 2025 | 20 Jul 2026 |
| 183 | affiliatemarketing.makeup | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 184 | affiliatemarketing.motorcycles | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 185 | affiliatemarketing.pics | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 186 | affiliatemarketing.pink | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 187 | affiliatemarketing.productions | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 188 | affiliatemarketing.properties | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 189 | affiliatemarketing.rentals | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 190 | affiliatemarketing.skin | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 191 | affiliatemarketing.stream | NameCheap, Inc. | 21 Jan 2023 | 5 Feb 2024 | 21 Jan 2024 |
| 192 | affiliatemarketing.style | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 193 | affiliatemarketing.technology | NameCheap, Inc. | 21 Jan 2023 | 4 Mar 2025 | 21 Jan 2025 |
| 194 | affiliatemarketing.tours | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 195 | affiliatemarketing.wtf | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 196 | affiliatemarketing.yachts | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 197 | affiliatemarketing.gay | NameCheap, Inc. | 21 Jan 2023 | 5 Feb 2024 | 21 Jan 2024 |
| 198 | affiliatemarketing.kids | NameCheap, Inc. | 21 Jan 2023 | 3 Mar 2024 | 21 Jan 2024 |
| 199 | affiliatemarketing.blog | GoDaddy.com, LLC | 5 Aug 2023 | 5 Sep 2025 | 5 Aug 2026 |
| 200 | affiliatemarketing.bond | NameCheap, Inc. | 29 Jan 2022 | 13 Feb 2022 | 29 Jan 2023 |
| 201 | affiliatemarketing.gives | NameCheap, Inc. | 27 Jan 2023 | 9 Mar 2024 | 27 Jan 2024 |
| 202 | affiliatemarketing.cam | NameCheap, Inc. | 10 Sep 2020 | 22 Nov 2025 | 10 Sep 2025 |
| 203 | affiliatemarketing.camp | united-domains AG | 18 May 2019 | 1 Jul 2023 | 18 May 2023 |
| 204 | affiliatemarketing.careers | GoDaddy.com, LLC | 10 Jun 2022 | 22 Jul 2024 | 10 Jun 2024 |
| 205 | affiliatemarketing.ceo | NameCheap, Inc. | 16 Mar 2024 | 1 May 2025 | 16 Mar 2026 |
| 206 | affiliatemarketing.com.cn | ???????????? | 12 Jul 2025 | - | 12 Jul 2026 |
| 207 | affiliatemarketing.com.ng | - | 17 Mar 2025 | 18 Mar 2025 | 17 Mar 2026 |
| 208 | affiliatemarketing.house | - | 15 May 2024 | 28 Jun 2025 | 15 May 2025 |
| 209 | affiliatemarketing.markets | OVH sas | 13 Mar 2023 | 10 May 2024 | 13 Mar 2024 |
| 210 | affiliatemarketing.llc | GoDaddy.com, LLC | 8 Jul 2024 | 8 Jul 2025 | 8 Jul 2026 |
| 211 | affiliatemarketing.lat | GoDaddy.com, LLC | 12 Apr 2023 | 24 Apr 2024 | 12 Apr 2025 |
| 212 | affiliatemarketing.fun | Hostinger, UAB | 27 Mar 2025 | 1 Apr 2025 | 27 Mar 2026 |
| 213 | affiliatemarketing.ie | - | 10 Mar 2025 | 24 Mar 2025 | 10 Mar 2026 |
| 214 | affiliatemarketing.it | - | 23 Mar 2007 | 6 Jul 2025 | 20 Jun 2026 |
| 215 | affiliatemarketing.lol | NameCheap, Inc. | 1 May 2023 | 12 Jun 2024 | 1 May 2024 |
| 216 | affiliatemarketing.reviews | Google, Inc. | 1 Jun 2023 | 3 Jun 2025 | 1 Jun 2026 |
| 217 | affiliatemarketing.bio | NameCheap, Inc. | 27 Jun 2023 | 8 Aug 2024 | 27 Jun 2024 |
| 218 | affiliatemarketing.london | GoDaddy.com, LLC | 24 Jul 2023 | 23 Oct 2025 | 24 Jul 2026 |
| 219 | affiliatemarketing.forum | Porkbun, LLC | 29 Nov 2025 | 29 Nov 2025 | 29 Nov 2026 |
| 220 | affiliatemarketing.domains | - | 18 Dec 2024 | - | 18 Dec 2025 |
| 221 | affiliatemarketing.monster | NameCheap, Inc. | 2 Sep 2023 | 17 Sep 2024 | 2 Sep 2025 |
| 222 | affiliatemarketing.rsvp | NameCheap, Inc. | 20 Oct 2023 | 31 Dec 2024 | 20 Oct 2024 |
| 223 | affiliatemarketing.art | GoDaddy.com, LLC | 21 Oct 2023 | 2 Dec 2024 | 21 Oct 2024 |
| 224 | affiliatemarketing.com.de | - | - | 14 Oct 2025 | - |
| 225 | affiliatemarketing.broker | NameCheap, Inc. | 28 Dec 2023 | 25 Jan 2025 | - |
| 226 | affiliatemarketing.surf | Automattic Inc. | 21 Feb 2024 | 21 Nov 2025 | 21 Feb 2026 |
| 227 | affiliatemarketing.games | GoDaddy.com, LLC | 28 Mar 2024 | 8 Jun 2025 | 28 Mar 2025 |
| 228 | affiliatemarketing.nl | - | 18 Apr 2000 | 11 Mar 2023 | - |
| 229 | affiliatemarketing.vip | NameCheap, Inc. | 15 Feb 2022 | 17 Oct 2025 | 15 Feb 2026 |
| 230 | affiliatemarketing.ru | - | 4 Apr 2019 | - | 4 Apr 2026 |
| 231 | affiliatemarketing.uk | Dynadot, LLC | 23 Jan 2020 | 21 Nov 2025 | 23 Jan 2026 |
| 232 | affiliatemarketing.se | - | 9 May 2015 | 28 Apr 2025 | 9 May 2026 |
| 233 | affiliatemarketing.dk | - | 11 Jun 2008 | - | 30 Apr 2026 |
| 234 | affiliatemarketing.hu | - | 18 Feb 2023 | - | - |
| 235 | affiliatemarketing.fit | NameCheap, Inc. | 15 Nov 2025 | 20 Nov 2025 | 15 Nov 2026 |
| 236 | affiliatemarketing.ae | - | - | - | - |
| 237 | affiliatemarketing.hiphop | 1API GmbH | 30 Sep 2024 | 1 Dec 2025 | 30 Sep 2025 |
| 238 | affiliatemarketing.com.au | - | - | 2 Oct 2025 | - |
| 239 | affiliatemarketing.lifestyle | Porkbun, LLC | 26 Oct 2024 | 7 Jan 2026 | 26 Oct 2025 |
| 240 | affiliatemarketing.au | - | - | 23 Oct 2025 | - |
| 241 | affiliatemarketing.tube | Porkbun, LLC | 6 Nov 2024 | 19 Dec 2025 | 6 Nov 2025 |
| 242 | affiliatemarketing.ac | Above.com Pty Ltd. | 2 Jun 2023 | 14 Jul 2025 | 2 Jun 2025 |
| 243 | affiliatemarketing.eu | 1API GmbH | - | - | - |
| 244 | affiliatemarketing.diy | InterNetworX Ltd. & Co. KG | 12 Dec 2024 | 12 Dec 2025 | 12 Dec 2026 |
| 245 | affiliatemarketing.vc | Dynadot, LLC | 26 Feb 2023 | 26 Feb 2025 | 26 Feb 2026 |
| 246 | affiliatemarketing.biz.id | Reserved | 7 Feb 2025 | 11 Feb 2025 | 7 Feb 2026 |
| 247 | affiliatemarketing.living | GoDaddy.com, LLC | 25 Feb 2025 | 2 Mar 2025 | 25 Feb 2026 |
| 248 | affiliatemarketing.cyou | NameCheap, Inc. | 6 Mar 2025 | 1 Apr 2025 | 6 Mar 2026 |
| 249 | affiliatemarketing.my.id | Reserved | 14 Apr 2025 | 29 Apr 2025 | 14 Apr 2026 |
| 250 | affiliatemarketing.at | - | - | 26 Jan 2024 | - |
| 251 | affiliatemarketing.co.ke | - | 21 Aug 2025 | 20 Sep 2025 | 21 Aug 2026 |
| 252 | affiliatemarketing.cm | - | 20 Aug 2025 | 23 Sep 2025 | 20 Aug 2026 |
| 253 | affiliatemarketing.cc | Dynadot, LLC | 1 Dec 2023 | 2 Dec 2025 | 1 Dec 2026 |
| 254 | affiliatemarketing.us.com | Porkbun, LLC | 1 Oct 2025 | 24 Nov 2025 | 1 Oct 2026 |
| 255 | affiliatemarketing.co.nz | - | 21 Dec 2025 | 26 Dec 2025 | - |
| 256 | affiliatemarketing.ma | - | 7 Jan 2025 | 6 Jan 2026 | 7 Jan 2026 |
| 257 | affiliatemarketingsecretsvault.com | NameCheap, Inc. | 7 Mar 2009 | 10 Mar 2025 | 7 Mar 2026 |
| 258 | affiliatemarketingphd.net | Dynadot, LLC | 10 Oct 2022 | 20 Nov 2023 | 10 Oct 2023 |
| 259 | affiliatemarketing4newbies.com | NameCheap, Inc. | 31 Dec 2010 | 1 Dec 2025 | 31 Dec 2026 |
| 260 | affiliatemarketingdiary.com | Beijing Lanhai Jiye Technology Co., Ltd | 7 Feb 2022 | 25 Nov 2025 | 7 Feb 2026 |
| 261 | affiliatemarketingmoneyguide.com | GoDaddy.com, LLC | 21 Jul 2011 | 25 Jul 2012 | 21 Jul 2013 |
| 262 | affiliatemarketingcenter.info | - | 19 Mar 2012 | 23 Jul 2012 | 19 Mar 2013 |
| 263 | affiliatemarketingplan.com | Tucows Domains Inc. | 11 Jul 1999 | 10 Jul 2025 | 11 Jul 2026 |
| 264 | affiliatemarketingsearchenginesupport.com | Key-Systems GmbH | 27 May 2016 | 27 Nov 2025 | 27 May 2028 |
| 265 | affiliatemarketingtrainingcenter.com | - | 2 Aug 2016 | 2 Aug 2016 | 2 Aug 2017 |
| 266 | affiliatemarketingcourse.biz | Wild West Domains, LLC | 4 Aug 2020 | 25 Oct 2025 | 4 Aug 2026 |
| 267 | affiliatemarketinginsights.com | GoDaddy.com, LLC | 12 Oct 2023 | 24 Oct 2025 | 12 Oct 2027 |
| 268 | affiliatemarketingsoftware.net | NameCheap, Inc. | 26 Apr 2010 | 27 Mar 2025 | 26 Apr 2026 |
| 269 | affiliatemarketingdude.com | DNC Holdings, Inc. | 8 Jan 2012 | 11 Jan 2024 | 8 Jan 2029 |
| 270 | affiliatemarketingoptions.com | eNom, Inc. | 26 Mar 2020 | 26 Mar 2020 | 26 Mar 2021 |
| 271 | affiliatemarketingtracker.com | GoDaddy.com, LLC | 16 Mar 2009 | 5 Sep 2022 | 16 Mar 2026 |
| 272 | affiliatemarketingguide.me | Wild West Domains, LLC | 30 May 2015 | 31 May 2017 | 30 May 2018 |
| 273 | affiliatemarketingsecret.com | Dynadot, LLC | 10 Jan 2026 | 10 Jan 2026 | 10 Jan 2027 |
| 274 | affiliatemarketingeasy.net | eNom, Inc. | 3 May 2020 | 3 May 2020 | 3 May 2021 |
| 275 | affiliatemarketingtipsnow.com | NameCheap, Inc. | 3 Jul 2021 | 2 Aug 2021 | 3 Jul 2026 |
| 276 | affiliatemarketingtruth.com | Key-Systems GmbH | 19 Apr 2023 | 3 Jul 2024 | 19 Apr 2024 |
| 277 | affiliatemarketingknowhow.com | Google, Inc. | 7 Sep 2018 | 23 Aug 2025 | 7 Sep 2026 |
| 278 | affiliatemarketingsimplified.info | eNom, Inc. | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 279 | affiliatemarketingmagic.com | Adriatic Domains LLC | 29 Apr 2025 | 2 May 2025 | 29 Apr 2026 |
| 280 | affiliatemarketingtrainingsoftware.com | GoDaddy.com, LLC | 3 Jun 2012 | 4 Jun 2015 | 3 Jun 2016 |
| 281 | affiliatemarketingtrainingsystem.com | GoDaddy.com, LLC | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2016 |
| 282 | affiliatemarketingventures.com | eNom, Inc. | 26 Dec 2022 | 9 Mar 2024 | 26 Dec 2023 |
| 283 | affiliatemarketingtipsforbeginners.net | GoDaddy.com, LLC | 5 Jun 2014 | 6 Jun 2015 | 5 Jun 2016 |
| 284 | affiliatemarketingcampaign.com | eNom, Inc. | 19 Nov 2011 | 21 Nov 2025 | 19 Nov 2026 |
| 285 | affiliatemarketingdeals.com | Hosting Concepts B.V. dba Openprovider | 20 Mar 2022 | 30 Mar 2023 | 20 Mar 2023 |
| 286 | affiliatemarketinginsight.com | Metaregistrar BV Applications | 13 Nov 2025 | 18 Nov 2025 | 13 Nov 2026 |
| 287 | affiliatemarketingsuccess.info | NameCheap, Inc. | 5 Oct 2022 | 16 Dec 2024 | 5 Oct 2024 |
| 288 | affiliatemarketinglead.com | Realtime Register B.V. | 30 Nov 2021 | - | 30 Nov 2022 |
| 289 | affiliatemarketingconsulting.biz | GoDaddy.com, LLC | 25 Feb 2014 | 8 Mar 2017 | 24 Feb 2017 |
| 290 | affiliatemarketingways.com | GoDaddy.com, LLC | 25 Oct 2022 | 25 Oct 2022 | 25 Oct 2023 |
| 291 | affiliatemarketingforbeginners.com | GoDaddy.com, LLC | 16 Sep 2005 | 4 Aug 2025 | 16 Sep 2026 |
| 292 | affiliatemarketingplatform.com | TurnCommerce, Inc. DBA NameBright.com | 18 Dec 2019 | 12 Dec 2020 | 18 Dec 2025 |
| 293 | affiliatemarketingplus.com | NameCheap, Inc. | 26 Jan 2022 | 15 Jan 2025 | 26 Jan 2026 |
| 294 | affiliatemarketingmadeeasy.com | Dynadot, LLC | 15 Oct 2005 | 3 Dec 2025 | 15 Oct 2026 |
| 295 | affiliatemarketingapp.com | NameCheap, Inc. | 7 Oct 2022 | 18 Nov 2023 | 7 Oct 2023 |
| 296 | affiliatemarketingtutorials.com | GoDaddy.com, LLC | 19 Mar 2006 | 20 Mar 2025 | 19 Mar 2026 |
| 297 | affiliatemarketingu.com | GoDaddy.com, LLC | 7 Feb 2012 | 12 Feb 2024 | 7 Feb 2026 |
| 298 | affiliatemarketingexperts.com | NameCheap, Inc. | 12 Apr 2004 | 14 Mar 2025 | 12 Apr 2026 |
| 299 | affiliatemarketingforidiots.com | FastDomain Inc. | 14 Feb 2015 | 14 Feb 2015 | 14 Feb 2016 |
| 300 | affiliatemarketingprofits.com | Metaregistrar BV Applications | 19 Nov 2025 | 22 Nov 2025 | 19 Nov 2026 |
| 301 | affiliatemarketingleads.com | GoDaddy.com, LLC | 2 Nov 2004 | 6 Nov 2025 | 1 Nov 2026 |
| 302 | affiliatemarketingblogs.com | GoDaddy.com, LLC | 11 Jul 2006 | 21 Jun 2025 | 11 Jul 2026 |
| 303 | affiliatemarketingims.com | eNom, Inc. | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 304 | affiliatemarketinghosting.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 305 | affiliatemarketingblackbelt.com | Domainshop LLC | 5 Apr 2016 | 6 Oct 2016 | 5 Apr 2017 |
| 306 | affiliatemarketingtool.com | GoDaddy.com, LLC | 10 Sep 2007 | 21 Aug 2025 | 10 Sep 2026 |
| 307 | affiliatemarketing365.com | GoDaddy.com, LLC | 25 Mar 2018 | 16 Oct 2025 | 25 Mar 2026 |
| 308 | affiliatemarketingoffers.com | GoDaddy.com, LLC | 10 Jun 2022 | 10 Jun 2024 | 10 Jun 2026 |
| 309 | affiliatemarketingwebdesign.com | eNom, Inc. | 14 Dec 2016 | 17 Dec 2017 | 14 Dec 2017 |
| 310 | affiliatemarketinghowto.com | Namesilo, LLC | 5 Apr 2020 | 26 Mar 2024 | 5 Apr 2026 |
| 311 | affiliatemarketingforums.com | Dynadot, LLC | 28 Dec 2022 | 29 Dec 2024 | 28 Dec 2025 |
| 312 | affiliatemarketingtrading.com | eNom, Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 313 | affiliatemarketing-app.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2016 | 21 Oct 2017 | 9 Sep 2017 |
| 314 | affiliatemarketingproduct.com | GoDaddy.com, LLC | 10 Jul 2012 | 2 Jul 2025 | 10 Jul 2026 |
| 315 | affiliatemarketingdata.com | GoDaddy.com, LLC | 5 Mar 2022 | 17 May 2024 | 5 Mar 2024 |
| 316 | affiliatemarketingecourse.com | Namesilo, LLC | 1 Nov 2014 | 13 Nov 2015 | 1 Nov 2016 |
| 317 | affiliatemarketingebook.com | Dynadot, LLC | 1 Jun 2025 | 16 Nov 2025 | 1 Jun 2026 |
| 318 | affiliatemarketingsites.com | - | 3 Mar 2021 | 18 Mar 2024 | 3 Mar 2026 |
| 319 | affiliatemarketingbusinesstraining.com | Namesilo, LLC | 1 Nov 2016 | 4 Dec 2017 | 1 Nov 2017 |
| 320 | affiliatemarketingprogram.org | GoDaddy.com, LLC | 30 Mar 2015 | 30 May 2015 | 30 Mar 2016 |
| 321 | affiliatemarketingbabies.com | FastDomain Inc. | 10 Jun 2013 | 13 Jul 2015 | 10 Jun 2016 |
| 322 | affiliatemarketingcash-online.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Jun 2013 | 10 Jun 2015 | 9 Jun 2016 |
| 323 | affiliatemarketingtraining.co | GoDaddy.com, LLC | 2 Oct 2014 | 20 May 2015 | 1 Oct 2015 |
| 324 | affiliatemarketingstudyguide.com | eNom, Inc. | 5 May 2015 | 5 May 2015 | 5 May 2016 |
| 325 | affiliatemarketingexposed.club | GMO Internet Inc. | 10 May 2017 | 22 May 2017 | 10 May 2018 |
| 326 | affiliatemarketingprocess.com | DROPCATCH.COM 814 LLC | 3 Nov 2021 | 5 Oct 2022 | 3 Nov 2026 |
| 327 | affiliatemarketingsuccessiseasy.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 328 | affiliatemarketingrevealed.net | 1API GmbH | 16 Jan 2022 | 23 Nov 2025 | 16 Jan 2026 |
| 329 | affiliatemarketingwithroycarter.com | West263 International Limited | 4 Jan 2022 | 4 Jan 2022 | 4 Jan 2023 |
| 330 | affiliatemarketingsecrets.co | NameCheap, Inc. | 20 Jul 2010 | 22 Jul 2025 | 19 Jul 2026 |
| 331 | affiliatemarketinghandbook.com | Dynadot4 LLC | 3 Dec 2020 | 4 Dec 2025 | 3 Dec 2026 |
| 332 | affiliatemarketingworkshop.com | NameCheap, Inc. | 23 Nov 2025 | 23 Nov 2025 | 23 Nov 2026 |
| 333 | affiliatemarketingvolcano.com | eNom, Inc. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 334 | affiliatemarketingprofits.info | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Nov 2019 | 13 Jan 2020 | 14 Nov 2020 |
| 335 | affiliatemarketingknowhow.co | Wild West Domains, LLC | 14 Jun 2013 | 19 Jun 2015 | 13 Jun 2015 |
| 336 | affiliatemarketinganyone.com | eNom, Inc. | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 337 | affiliatemarketingresellerwebsites.com | GoDaddy.com, LLC | 18 Aug 2014 | 30 Oct 2025 | 18 Aug 2025 |
| 338 | affiliatemarketingxl.com | GoDaddy.com, LLC | 15 Jun 2011 | 15 Jun 2015 | 15 Jun 2016 |
| 339 | affiliatemarketingvooriedereen.com | Key-Systems GmbH | 19 Aug 2014 | 23 Sep 2017 | 19 Aug 2018 |
| 340 | affiliatemarketingwatchdog.com | 1&1 Internet AG | 5 Nov 2014 | 5 Dec 2022 | 5 Nov 2023 |
| 341 | affiliatemarketingguy.com | NameKing.com Inc. | 23 Oct 2024 | 23 Nov 2025 | 23 Oct 2026 |
| 342 | affiliatemarketing-networkmarketing.com | Namesilo, LLC | 22 Mar 2020 | 23 Mar 2020 | 22 Mar 2021 |
| 343 | affiliatemarketingforbegginers.com | Namesilo, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 344 | affiliatemarketingtrainingtips.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 345 | affiliatemarketingwithpete.com | Namesilo, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2016 |
| 346 | affiliatemarketingservice.com | GoDaddy.com, LLC | 3 Oct 2005 | 5 Dec 2025 | 3 Oct 2026 |
| 347 | affiliatemarketingforwebdevs.com | eNom, Inc. | 22 Aug 2014 | 21 Jul 2015 | 22 Aug 2017 |
| 348 | affiliatemarketingme.com | NameCheap, Inc. | 10 Mar 2024 | 11 Feb 2025 | 10 Mar 2026 |
| 349 | affiliatemarketingnewsletter.com | - | 7 Jan 2024 | 9 Dec 2025 | 7 Jan 2027 |
| 350 | affiliatemarketingbonanza.com | GoDaddy.com, LLC | 12 Aug 2014 | 13 Aug 2014 | 12 Aug 2015 |
| 351 | affiliatemarketingexpert.com | TurnCommerce, Inc. DBA NameBright.com | 30 Oct 2017 | 24 Oct 2020 | 30 Oct 2026 |
| 352 | affiliatemarketingforfree.com | NameCheap, Inc. | 14 Mar 2022 | 26 May 2023 | 14 Mar 2023 |
| 353 | affiliatemarketingfundamentals.com | NameCheap, Inc. | 10 May 2025 | 11 May 2025 | 10 May 2026 |
| 354 | affiliatemarketingseo.com | GoDaddy.com, LLC | 16 Mar 2017 | 16 Mar 2025 | 16 Mar 2026 |
| 355 | affiliatemarketingwithshahbaz.com | GoDaddy.com, LLC | 24 Aug 2014 | 25 Aug 2016 | 24 Aug 2017 |
| 356 | affiliatemarketingworldaffiliation.com | Online SAS | 24 Aug 2014 | 28 Aug 2017 | 24 Aug 2018 |
| 357 | affiliatemarketingtricks.com | Web Commerce Communications Limited dba WebNic.cc | 11 Jul 2022 | 20 Sep 2023 | 11 Jul 2023 |
| 358 | affiliatemarketingpro.net | Amazon Registrar, Inc. | 17 Jan 2024 | 2 Mar 2025 | 17 Jan 2025 |
| 359 | affiliatemarketingsuccess101.com | 1&1 Internet AG | 14 Aug 2014 | 15 Aug 2014 | 14 Aug 2015 |
| 360 | affiliatemarketingadvices.com | GoDaddy.com, LLC | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2015 |
| 361 | affiliatemarketingcompaniesblog.com | Domain Central Australia Pty Ltd. | 25 Jul 2013 | 28 Aug 2014 | 25 Jul 2015 |
| 362 | affiliatemarketingtrainingprograms.com | eNom, Inc. | 27 Aug 2014 | 28 Aug 2014 | 27 Aug 2015 |
| 363 | affiliatemarketing101.biz | GoDaddy.com, LLC | 21 Sep 2016 | 8 Oct 2017 | 20 Sep 2018 |
| 364 | affiliatemarketingthailand.com | NameCheap, Inc. | 21 Aug 2018 | 21 Aug 2018 | 21 Aug 2020 |
| 365 | affiliatemarketingis.com | Dynadot, LLC | 12 Nov 2025 | 13 Nov 2025 | 12 Nov 2026 |
| 366 | affiliatemarketinginafrica.com | Domain.com, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 367 | affiliatemarketingsuccessacademy.com | GoDaddy.com, LLC | 13 Apr 2022 | 24 May 2024 | 13 Apr 2024 |
| 368 | affiliatemarketingtipslist.com | eNom, Inc. | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 369 | affiliatemarketingtipsportal.com | eNom, Inc. | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 370 | affiliatemarketingratings.com | GoDaddy.com, LLC | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 371 | affiliatemarketingcourses.com | GoDaddy.com, LLC | 17 Apr 2017 | 19 Feb 2025 | 17 Apr 2026 |
| 372 | affiliatemarketingtipsandprograms.com | eNom, Inc. | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 373 | affiliatemarketingworkflow.com | GoDaddy.com, LLC | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 374 | affiliatemarketing-101.com | Crazy Domains FZ-LLC | 14 Jan 2023 | 27 Mar 2024 | 14 Jan 2024 |
| 375 | affiliatemarketingblogspot.com | eNom, Inc. | 20 Nov 2016 | 23 Nov 2017 | 20 Nov 2017 |
| 376 | affiliatemarketingdevelopment.com | GoDaddy.com, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 377 | affiliatemarketingcd.info | Wild West Domains, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 378 | affiliatemarketingmanual.info | Wild West Domains, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 379 | affiliatemarketingmanuals.info | Wild West Domains, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 380 | affiliatemarketingedge.com | Tucows Domains Inc. | 21 May 2021 | 26 Nov 2024 | 21 May 2026 |
| 381 | affiliatemarketingmanuals.com | Instra Corporation Pty Ltd. | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 382 | affiliatemarketingtools.biz | eNom, Inc. | 16 Sep 2014 | 16 Sep 2014 | 15 Sep 2015 |
| 383 | affiliatemarketingincomeonline.com | eNom, Inc. | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 384 | affiliatemarketingtrainings.com | GoDaddy.com, LLC | 14 Feb 2020 | 14 Feb 2025 | 14 Feb 2026 |
| 385 | affiliatemarketingscam.com | NameCheap, Inc. | 19 Sep 2014 | 24 Jan 2018 | 19 Sep 2018 |
| 386 | affiliatemarketingfx.com | Wild West Domains, LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 387 | affiliatemarketinglovers.com | GoDaddy.com, LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 388 | affiliatemarketingschool.com | GoDaddy.com, LLC | 17 Sep 2014 | 27 Aug 2025 | 17 Sep 2026 |
| 389 | affiliatemarketingboston.com | Tucows Domains Inc. | 13 Nov 2012 | 17 Nov 2014 | 13 Nov 2015 |
| 390 | affiliatemarketingresource.info | GoDaddy.com, LLC | 30 Sep 2014 | 30 Sep 2014 | 30 Sep 2015 |
| 391 | affiliatemarketinghow.com | Beijing Lanhai Jiye Technology Co., Ltd | 24 Oct 2023 | 26 Dec 2024 | 24 Oct 2024 |
| 392 | affiliatemarketingwise.com | Wild West Domains, LLC | 3 Oct 2014 | 14 Nov 2025 | 3 Oct 2025 |
| 393 | affiliatemarketingmadness.com | Google, Inc. | 25 May 2022 | 26 May 2023 | 25 May 2024 |
| 394 | affiliatemarketingfix.com | NameCheap, Inc. | 6 Sep 2020 | 9 Sep 2022 | 6 Sep 2023 |
| 395 | affiliatemarketingcommando.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Jul 2023 | 19 Nov 2025 | 21 Jul 2026 |
| 396 | affiliatemarketingempire.com | NameCheap, Inc. | 19 Feb 2018 | 20 Jan 2025 | 19 Feb 2026 |
| 397 | affiliatemarketinginformation.com | NameForward LLC | 26 Jun 2013 | 27 Jun 2017 | 26 Jun 2018 |
| 398 | affiliatemarketingtipshub.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 399 | affiliatemarketinggains.com | eNom, Inc. | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 400 | affiliatemarketingenterprise.com | Network Solutions, LLC | 1 Sep 2023 | 3 Sep 2025 | 1 Sep 2026 |
| 401 | affiliatemarketingdeconstructed.com | GMO Internet Inc. | 25 Aug 2022 | 5 Oct 2023 | 25 Aug 2023 |
| 402 | affiliatemarketing-info.com | Cronon AG | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2017 |
| 403 | affiliatemarketing-info.net | Cronon AG | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2017 |
| 404 | affiliatemarketingshop.com | GoDaddy.com, LLC | 23 Nov 2023 | 24 Nov 2025 | 23 Nov 2027 |
| 405 | affiliatemarketingx.net | Tucows Domains Inc. | 16 Nov 2011 | 20 Nov 2014 | 16 Nov 2015 |
| 406 | affiliatemarketing411.net | eNom, Inc. | 19 Nov 2014 | 20 Nov 2014 | 19 Nov 2015 |
| 407 | affiliatemarketingtrainingprogram.com | GoDaddy.com, LLC | 22 Sep 2021 | 22 Sep 2021 | 22 Sep 2022 |
| 408 | affiliatemarketingprogramsguide.com | Beijing Lanhai Jiye Technology Co., Ltd | 26 Dec 2023 | 27 Jan 2025 | 26 Dec 2024 |
| 409 | affiliatemarketingsuccess.net | NameCheap, Inc. | 9 Aug 2017 | 28 Jul 2024 | 9 Aug 2025 |
| 410 | affiliatemarketingrepublic.com | NameCheap, Inc. | 3 Oct 2019 | - | 3 Oct 2020 |
| 411 | affiliatemarketingmadesimplenow.com | Dynadot, LLC | 9 Feb 2016 | 9 Feb 2016 | 9 Feb 2017 |
| 412 | affiliatemarketingincomesecrets.com | GoDaddy.com, LLC | 19 Jun 2024 | 20 Jun 2025 | 19 Jun 2026 |
| 413 | affiliatemarketingblackbook.com | NameCheap, Inc. | 3 Feb 2023 | 4 Jan 2025 | 3 Feb 2026 |
| 414 | affiliatemarketingtoolz.com | Launchpad, Inc. | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 415 | affiliatemarketing4u.com | GoDaddy.com, LLC | 13 Jun 2025 | 13 Jun 2025 | 13 Jun 2026 |
| 416 | affiliatemarketingdoneright.com | GoDaddy.com, LLC | 14 Jan 2023 | 25 Jan 2024 | 14 Jan 2025 |
| 417 | affiliatemarketingleaders.com | Wild West Domains, LLC | 14 Mar 2023 | 23 Jun 2025 | 14 Mar 2026 |
| 418 | affiliatemarketingbasictraining.com | GoDaddy.com, LLC | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2015 |
| 419 | affiliatemarketingprogramreviews.com | NameCheap, Inc. | 11 Oct 2014 | 11 Sep 2025 | 11 Oct 2026 |
| 420 | affiliatemarketingreport.net | eNom, Inc. | 22 Nov 2014 | 22 Nov 2014 | 22 Nov 2015 |
| 421 | affiliatemarketingsolutions.info | NameCheap, Inc. | 18 Jun 2024 | 19 May 2025 | - |
| 422 | affiliatemarketingwizard.com | GoDaddy.com, LLC | 15 May 2017 | 1 Jun 2025 | 15 May 2026 |
| 423 | affiliatemarketingx.info | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Nov 2019 | 13 Jan 2020 | 14 Nov 2020 |
| 424 | affiliatemarketingdetails.com | GoDaddy.com, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 425 | affiliatemarketingmakeover.com | eNom, Inc. | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 426 | affiliatemarketingsamurai.com | 1&1 Internet AG | 9 Jun 2021 | 23 Jul 2024 | 9 Jun 2024 |
| 427 | affiliatemarketingmethods.com | GoDaddy.com, LLC | 11 Jul 2024 | 22 Aug 2025 | 11 Jul 2026 |
| 428 | affiliatemarketingeh.com | NameCheap, Inc. | 27 Feb 2025 | 27 Feb 2025 | 27 Feb 2026 |
| 429 | affiliatemarketingoutlet.com | GoDaddy.com, LLC | 8 Jan 2016 | 10 Jan 2026 | 8 Jan 2027 |
| 430 | affiliatemarketingtalk.com | Web Commerce Communications Limited dba WebNic.cc | 5 Jan 2024 | 15 Feb 2025 | 5 Jan 2025 |
| 431 | affiliatemarketingminds.com | Squarespace Domains LLC | 20 Jul 2023 | 19 Sep 2024 | 20 Jul 2024 |
| 432 | affiliatemarketingformoney.com | NameCheap, Inc. | 25 Nov 2021 | 6 Feb 2025 | 25 Nov 2024 |
| 433 | affiliatemarketinginfotips.com | eNom, Inc. | 25 Nov 2014 | 26 Nov 2014 | 25 Nov 2015 |
| 434 | affiliatemarketingcashstream.com | eNom, Inc. | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 435 | affiliatemarketingmap.com | Dynadot, LLC | 12 Mar 2023 | 27 Feb 2025 | 12 Mar 2026 |
| 436 | affiliatemarketinggroup.info | GoDaddy.com, LLC | 17 Aug 2023 | 28 Oct 2024 | 17 Aug 2024 |
| 437 | affiliatemarketingwa.com | eNom, Inc. | 29 Nov 2014 | 18 Jan 2017 | 29 Nov 2018 |
| 438 | affiliatemarketingsoftwarereviews.com | CJSC Registrar R01 | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 439 | affiliatemarketingcourse.info | NameCheap, Inc. | 16 Jul 2023 | 27 Aug 2024 | 16 Jul 2024 |
| 440 | affiliatemarketing-secrets-tips.com | Domain.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 441 | affiliatemarketingperformance.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 442 | affiliatemarketingmarketing.com | TurnCommerce, Inc. DBA NameBright.com | 5 Mar 2014 | 17 May 2024 | 5 Mar 2024 |
| 443 | affiliatemarketingguidance.com | - | 25 Oct 2016 | 25 Oct 2016 | 25 Oct 2017 |
| 444 | affiliatemarketingformoms.com | GoDaddy.com, LLC | 19 May 2025 | 19 May 2025 | 19 May 2026 |
| 445 | affiliatemarketingnews.net | Dynadot, LLC | 12 Dec 2019 | 13 Dec 2019 | 12 Dec 2020 |
| 446 | affiliatemarketingpoint.com | GoDaddy.com, LLC | 16 Sep 2020 | 16 Sep 2020 | 16 Sep 2021 |
| 447 | affiliatemarketing101.net | Dynadot, LLC | 9 Jan 2026 | 9 Jan 2026 | 9 Jan 2027 |
| 448 | affiliatemarketingeducation.com | GoDaddy.com, LLC | 18 Mar 2017 | 19 Mar 2025 | 18 Mar 2026 |
| 449 | affiliatemarketingdummies.com | Google, Inc. | 26 Apr 2020 | 26 Apr 2020 | 26 Apr 2021 |
| 450 | affiliatemarketingarticle.net | eNom, Inc. | 15 Dec 2014 | 1 Dec 2016 | 15 Dec 2017 |
| 451 | affiliatemarketingblogclub.com | eNom, Inc. | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 452 | affiliatemarketingwizardry.com | eNom, Inc. | 18 Dec 2014 | 23 Dec 2016 | 18 Dec 2017 |
| 453 | affiliatemarketingwealth.com | NameCheap, Inc. | 8 Mar 2021 | 13 Mar 2025 | 8 Mar 2026 |
| 454 | affiliatemarketingcore.com | GoDaddy.com, LLC | 7 Mar 2022 | 19 May 2024 | 7 Mar 2024 |
| 455 | affiliatemarketingcore.info | GoDaddy.com, LLC | 18 Dec 2014 | 19 Dec 2019 | 18 Dec 2020 |
| 456 | affiliatemarketingproinsights.com | Tucows Domains Inc. | 16 Dec 2013 | 20 Dec 2014 | 16 Dec 2015 |
| 457 | affiliatemarketingcore.org | GoDaddy.com, LLC | 18 Dec 2014 | 19 Dec 2016 | 18 Dec 2017 |
| 458 | affiliatemarketingcore.net | GoDaddy.com, LLC | 18 Dec 2014 | 19 Dec 2016 | 18 Dec 2017 |
| 459 | affiliatemarketingbookreviews.com | Mesh Digital Limited | 21 Dec 2014 | 21 Dec 2014 | 21 Dec 2015 |
| 460 | affiliatemarketinglearninghow.com | eNom, Inc. | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 461 | affiliatemarketingtraining2.com | eNom, Inc. | 23 Dec 2014 | 21 Jan 2017 | 23 Dec 2017 |
| 462 | affiliatemarketingcashcode.com | GoDaddy.com, LLC | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2015 |
| 463 | affiliatemarketingkids.info | 1&1 Internet AG | 24 Dec 2014 | 25 Dec 2014 | 24 Dec 2015 |
| 464 | affiliatemarketing-am.com | - | 6 Mar 2023 | 8 May 2024 | 6 Mar 2024 |
| 465 | affiliatemarketingforall.com | NameCheap, Inc. | 24 Apr 2025 | 9 May 2025 | 24 Apr 2026 |
| 466 | affiliatemarketingincentive.com | eNom, Inc. | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 467 | affiliatemarketingjournal.com | GoDaddy.com, LLC | 29 Dec 2016 | 9 Oct 2025 | 29 Dec 2025 |
| 468 | affiliatemarketinggenesis.com | 1&1 Internet AG | 30 Dec 2014 | 31 Dec 2016 | 30 Dec 2017 |
| 469 | affiliatemarketinginternetbusiness.com | eNom, Inc. | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 470 | affiliatemarketingdocuments.com | GoDaddy.com, LLC | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 471 | affiliatemarketingspot.com | Key-Systems GmbH | 23 Dec 2021 | 27 Nov 2025 | 23 Dec 2026 |
| 472 | affiliatemarketingxpert.com | NameCheap, Inc. | 23 Nov 2023 | 4 Feb 2025 | 23 Nov 2024 |
| 473 | affiliatemarketingfornoobs.com | Google, Inc. | 24 Jun 2019 | 24 Jun 2019 | 24 Jun 2020 |
| 474 | affiliatemarketingwebguide.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 10 Apr 2023 | 18 Apr 2024 | 10 Apr 2024 |
| 475 | affiliatemarketingsos.com | GoDaddy.com, LLC | 12 Oct 2018 | 12 Oct 2018 | 12 Oct 2019 |
| 476 | affiliatemarketingetc.com | DreamHost, LLC | 29 Jan 2021 | 29 Jan 2021 | 29 Jan 2022 |
| 477 | affiliatemarketingunleased.us | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 1 Jan 2016 |
| 478 | affiliatemarketingtips.today | - | 30 Jun 2014 | 30 Jun 2014 | 30 Jun 2015 |
| 479 | affiliatemarketingtrainingvideos.com | eNom, Inc. | 13 Dec 2019 | 13 Dec 2019 | 13 Dec 2020 |
| 480 | affiliatemarketingsweetie.com | - | 4 Nov 2016 | 4 Nov 2016 | 4 Nov 2017 |
| 481 | affiliatemarketingtraining.website | NameCheap, Inc. | 25 Nov 2016 | 13 Dec 2017 | 25 Nov 2018 |
| 482 | affiliatemarketingcourse.website | NameCheap, Inc. | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 483 | affiliatemarketingknowinghow.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 484 | affiliatemarketing101.tips | Key-Systems, LLC | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 485 | affiliatemarketingmastery.club | NameCheap, Inc. | 24 Apr 2021 | 25 Apr 2021 | 24 Apr 2022 |
| 486 | affiliatemarketingbreakout.website | NameCheap, Inc. | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 487 | affiliatemarketingeducation.space | NameCheap, Inc. | 21 Mar 2015 | 21 Mar 2015 | 21 Mar 2016 |
| 488 | affiliatemarketingmakesmoney.com | eNom, Inc. | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 489 | affiliatemarketingreviewed.com | eNom, Inc. | 8 Jan 2015 | 8 Dec 2015 | 8 Jan 2018 |
| 490 | affiliatemarketingmethod.com | NameCheap, Inc. | 8 Jan 2015 | 9 Dec 2025 | 8 Jan 2027 |
| 491 | affiliatemarketingblueprints.com | CloudFlare, Inc. | 23 Jul 2019 | 1 Sep 2025 | 23 Jul 2025 |
| 492 | affiliatemarketingwithyou.org | GoDaddy.com, LLC | 14 Aug 2015 | 15 Aug 2015 | 14 Aug 2016 |
| 493 | affiliatemarketingmaster.info | united-domains AG | 15 Jul 2025 | 12 Nov 2025 | 15 Jul 2026 |
| 494 | affiliatemarketingmk.com | NameCheap, Inc. | 14 Jan 2015 | 15 Dec 2024 | 14 Jan 2026 |
| 495 | affiliatemarketingfast.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 May 2024 | 1 Jul 2025 | 20 May 2025 |
| 496 | affiliatemarketingaddict.com | eNom, Inc. | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 497 | affiliatemarketingmobile.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 498 | affiliatemarketingbasicsfornewbiewebsites.com | GoDaddy.com, LLC | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 499 | affiliatemarketingwarehouse.com | GoDaddy.com, LLC | 14 Jan 2023 | 25 Feb 2025 | 14 Jan 2025 |
| 500 | affiliatemarketingnicheblog.com | eNom, Inc. | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 501 | affiliatemarketingblueprint.ninja | eNom, Inc. | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 502 | affiliatemarketingtrainer.com | GoDaddy.com, LLC | 8 Nov 2020 | 20 Dec 2024 | 8 Nov 2024 |
| 503 | affiliatemarketingusa.link | NameCheap, Inc. | 17 Jul 2015 | 18 Jul 2015 | 17 Jul 2016 |
| 504 | affiliatemarketingprograms.club | GoDaddy.com, LLC | 25 Jul 2015 | 25 Jul 2015 | 24 Jul 2016 |
| 505 | affiliatemarketingwhiz.com | NameCheap, Inc. | 2 Dec 2020 | - | 2 Dec 2021 |
| 506 | affiliatemarketingpdf.com | Ourdomains Limited | 3 Dec 2025 | 3 Dec 2025 | 3 Dec 2026 |
| 507 | affiliatemarketinglearning.com | GoDaddy.com, LLC | 18 Aug 2015 | 14 Aug 2025 | 18 Aug 2026 |
| 508 | affiliatemarketingpractices.com | eNom, Inc. | 31 May 2016 | 31 May 2016 | 31 May 2017 |
| 509 | affiliatemarketingeasy.com | TurnCommerce, Inc. DBA NameBright.com | 13 Apr 2017 | 15 May 2024 | 13 Apr 2024 |
| 510 | affiliatemarketingrevenue.com | FastDomain Inc. | 17 Nov 2017 | 17 Nov 2017 | 17 Nov 2018 |
| 511 | affiliatemarketinginstantpower.com | eNom, Inc. | 25 Jan 2015 | 25 Jan 2015 | 25 Jan 2017 |
| 512 | affiliatemarketingworldwide.com | GoDaddy.com, LLC | 24 Jan 2023 | 7 Mar 2025 | 24 Jan 2025 |
| 513 | affiliatemarketingwinner.com | NameCheap, Inc. | 28 Apr 2020 | 8 May 2022 | 28 Apr 2023 |
| 514 | affiliatemarketing-1.com | eName Technology Co., Ltd. | 25 Apr 2019 | 25 Apr 2019 | 25 Apr 2020 |
| 515 | affiliatemarketingincomeintensive.com | NameCheap, Inc. | 24 Jul 2019 | - | 24 Jul 2020 |
| 516 | affiliatemarketingmag.com | Namesilo, LLC | 16 Mar 2025 | 29 Sep 2025 | 16 Mar 2026 |
| 517 | affiliatemarketingcreateswealth.com | eNom, Inc. | 29 Jan 2015 | 31 Dec 2016 | 29 Jan 2018 |
| 518 | affiliatemarketingexpert.org | GoDaddy.com, LLC | 26 Jan 2015 | 27 Jan 2015 | 26 Jan 2016 |
| 519 | affiliatemarketingfinancialfreedom.com | eNom, Inc. | 1 Feb 2015 | 1 Feb 2015 | 1 Feb 2016 |
| 520 | affiliatemarketinglive.com | TLDs LLC dba SRSplus | 9 Aug 2018 | 9 Aug 2018 | 9 Aug 2019 |
| 521 | affiliatemarketinglab.com | Domeneshop AS dba domainnameshop.com | 19 Aug 2015 | 20 Nov 2025 | 19 Aug 2026 |
| 522 | affiliatemarketingjoint.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 523 | affiliatemarketingmakemoney.com | NameCheap, Inc. | 12 Sep 2022 | 23 Nov 2023 | 12 Sep 2023 |
| 524 | affiliatemarketingfuture.com | Crazy Domains FZ-LLC | 30 Apr 2021 | 30 Apr 2021 | 30 Apr 2022 |
| 525 | affiliatemarketingmasters.net | - | - | - | - |
| 526 | affiliatemarketingtrainingonline.com | GoDaddy.com, LLC | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 527 | affiliatemarketingthesmartway.com | GoDaddy.com, LLC | 21 Aug 2015 | 22 Aug 2025 | 21 Aug 2026 |
| 528 | affiliatemarketingtricks.net | GoDaddy.com, LLC | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2016 |
| 529 | affiliatemarketingwithjim.com | GoDaddy.com, LLC | 17 Aug 2018 | 17 Aug 2018 | 17 Aug 2020 |
| 530 | affiliatemarketingcompany.net | eNom, Inc. | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 531 | affiliatemarketingsecretsexposed.com | GoDaddy.com, LLC | 24 May 2017 | 24 May 2017 | 24 May 2018 |
| 532 | affiliatemarketingmojo.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 Nov 2023 | 13 Jan 2025 | 11 Nov 2024 |
| 533 | affiliatemarketingtipstoday.com | NameCheap, Inc. | 23 Jun 2020 | - | 23 Jun 2021 |
| 534 | affiliatemarketingandsocialmedia.com | Dynadot, LLC | 14 Nov 2022 | 24 Jan 2024 | 14 Nov 2023 |
| 535 | affiliatemarketingmadeeasy.info | eNom, Inc. | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 536 | affiliatemarketinghelp.net | Mesh Digital Limited | 19 Feb 2015 | 4 Feb 2017 | 19 Feb 2018 |
| 537 | affiliatemarketingscamsrevealed.com | eNom, Inc. | 22 Feb 2015 | 22 Feb 2015 | 22 Feb 2016 |
| 538 | affiliatemarketingshare.info | GoDaddy.com, LLC | 21 Feb 2015 | 22 Feb 2015 | 21 Feb 2016 |
| 539 | affiliatemarketingtipforbeginners.com | eNom, Inc. | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 540 | affiliatemarketing10k.com | Domain.com, LLC | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2016 |
| 541 | affiliatemarketingstrategysite.com | NameCheap, Inc. | 8 Nov 2021 | - | 8 Nov 2022 |
| 542 | affiliatemarketingreporters.com | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 543 | affiliatemarketingcollege.com | Wild West Domains, LLC | 8 Aug 2016 | 8 Aug 2025 | 8 Aug 2026 |
| 544 | affiliatemarketingnetworks.com | TurnCommerce, Inc. DBA NameBright.com | 23 Aug 2015 | 4 Oct 2024 | 23 Aug 2024 |
| 545 | affiliatemarketingmaybelfire.com | Epik Inc. | 28 Jan 2009 | 16 Mar 2017 | 28 Jan 2018 |
| 546 | affiliatemarketinga2z.com | FastDomain Inc. | 13 Sep 2016 | 16 Oct 2017 | 13 Sep 2017 |
| 547 | affiliatemarketingly.com | eNom, Inc. | 30 Mar 2021 | 11 Jun 2025 | 30 Mar 2025 |
| 548 | affiliatemarketingsuperstars.com | GoDaddy.com, LLC | 3 Dec 2023 | 4 Dec 2025 | 3 Dec 2026 |
| 549 | affiliatemarketinghelper.com | Webfusion Ltd. | 25 Jun 2022 | 8 Sep 2023 | 25 Jun 2023 |
| 550 | affiliatemarketingtm.info | GoDaddy.com, LLC | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 551 | affiliatemarketingnewbtoninja.com | GoDaddy.com, LLC | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 552 | affiliatemarketingscout.com | eNom, Inc. | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 553 | affiliatemarketingadvisors.com | NameKing.com Inc. | 2 Jan 2023 | 17 Mar 2024 | 2 Jan 2024 |
| 554 | affiliatemarketingmonthly.com | Udamain.com LLC | 19 Jan 2025 | 20 Jan 2026 | 19 Jan 2027 |
| 555 | affiliatemarketingatnocost.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 556 | affiliatemarketingteam.com | GoDaddy.com, LLC | 25 Apr 2021 | 26 Apr 2025 | 25 Apr 2026 |
| 557 | affiliatemarketingpathways.com | eNom, Inc. | 11 Mar 2015 | 6 Mar 2017 | 11 Mar 2018 |
| 558 | affiliatemarketinglist.com | GoDaddy.com, LLC | 10 Jun 2022 | 10 Jun 2024 | 10 Jun 2026 |
| 559 | affiliatemarketingmiljonair.com | Key-Systems GmbH | 11 Mar 2015 | 12 Mar 2015 | 11 Mar 2016 |
| 560 | affiliatemarketinglinx.com | Internet Domain Services BS Corp | 5 Jan 2018 | 20 Dec 2025 | 5 Jan 2027 |
| 561 | affiliatemarketingforsuccess.com | NameCheap, Inc. | 23 Dec 2018 | 14 Nov 2025 | 23 Dec 2026 |
| 562 | affiliatemarketingwithsteve.com | NameCheap, Inc. | 18 Jun 2023 | 30 Jul 2024 | 18 Jun 2024 |
| 563 | affiliatemarketingteacher.com | NameCheap, Inc. | 19 Sep 2022 | 31 Oct 2023 | 19 Sep 2023 |
| 564 | affiliatemarketinghq.org | Dynadot, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 565 | affiliatemarketingbeginners.net | NameCheap, Inc. | 8 Aug 2022 | 20 Oct 2023 | 8 Aug 2023 |
| 566 | affiliatemarketingtycoon.com | NameCheap, Inc. | 22 Jun 2022 | 3 Sep 2023 | 22 Jun 2023 |
| 567 | affiliatemarketingadvisors.us | GoDaddy.com, LLC | 7 Mar 2015 | 11 Mar 2017 | 6 Mar 2018 |
| 568 | affiliatemarketingadvisors.org | GoDaddy.com, LLC | 7 Mar 2015 | 12 Mar 2017 | 7 Mar 2018 |
| 569 | affiliatemarketingadvisors.info | GoDaddy.com, LLC | 7 Mar 2015 | 12 Mar 2017 | 7 Mar 2018 |
| 570 | affiliatemarketingfarm.com | eNom, Inc. | 18 Mar 2015 | 17 Feb 2017 | 18 Mar 2018 |
| 571 | affiliatemarketingmechanic.com | Tucows Domains Inc. | 15 Mar 2013 | 19 Mar 2015 | 15 Mar 2016 |
| 572 | affiliatemarketingtruths.com | GoDaddy.com, LLC | 10 Aug 2021 | 21 Sep 2025 | 10 Aug 2025 |
| 573 | affiliatemarketingearnings.com | GoDaddy.com, LLC | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2016 |
| 574 | affiliatemarketingcommission.com | GoDaddy.com, LLC | 12 Jan 2019 | 12 Jan 2019 | 12 Jan 2020 |
| 575 | affiliatemarketingeducation.info | PSI-USA, Inc. dba Domain Robot | 2 May 2019 | 2 May 2020 | 2 May 2021 |
| 576 | affiliatemarketingsitesuccess.com | eNom, Inc. | 22 Mar 2015 | 22 Mar 2015 | 22 Mar 2016 |
| 577 | affiliatemarketingminisites.com | eNom, Inc. | 22 Mar 2015 | 22 Mar 2015 | 22 Mar 2016 |
| 578 | affiliatemarketingchannels.com | GoDaddy.com, LLC | 5 Sep 2022 | 17 Nov 2024 | 5 Sep 2024 |
| 579 | affiliatemarketingbuildswealth.com | 1&1 Internet AG | 23 Mar 2015 | 23 Mar 2015 | 23 Mar 2016 |
| 580 | affiliatemarketingtribe.com | Tucows Domains Inc. | 13 Jul 2017 | 12 Jul 2025 | 13 Jul 2026 |
| 581 | affiliatemarketingandyou.com | NameCheap, Inc. | 3 May 2021 | 15 Jul 2024 | 3 May 2024 |
| 582 | affiliatemarketingtribe.org | eNom, Inc. | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 583 | affiliatemarketingtribe.net | Web Commerce Communications Limited dba WebNic.cc | 14 Jun 2022 | 24 Aug 2023 | 14 Jun 2023 |
| 584 | affiliatemarketingblueprint.us | GoDaddy.com, LLC | 27 Aug 2015 | 27 Aug 2015 | 26 Aug 2016 |
| 585 | affiliatemarketingvip.com | CV. Jogjacamp | 30 Jul 2025 | 9 Nov 2025 | 30 Jul 2026 |
| 586 | affiliatemarketingmadesimplebybj.com | GoDaddy.com, LLC | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 587 | affiliatemarketinginsiders.com | GoDaddy.com, LLC | 2 Oct 2018 | 12 Sep 2025 | 2 Oct 2026 |
| 588 | affiliatemarketing1.biz | NameCheap, Inc. | 15 Aug 2023 | 30 Aug 2024 | 15 Aug 2024 |
| 589 | affiliatemarketingmoney1.com | Launchpad, Inc. | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 590 | affiliatemarketingtoolkit.com | GoDaddy.com, LLC | 30 Mar 2015 | 30 Mar 2025 | 30 Mar 2026 |
| 591 | affiliatemarketingkitcom.com | - | - | - | - |
| 592 | affiliatemarketinghotspot.com | - | - | - | - |
| 593 | affiliatemarketingcoachingprogram.com | GoDaddy.com, LLC | 12 Jul 2016 | 12 Jul 2016 | 12 Jul 2017 |
| 594 | affiliatemarketingwithliz.com | GoDaddy.com, LLC | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 595 | affiliatemarketingmis.com | GoDaddy.com, LLC | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 596 | affiliatemarketingextreme.com | GoDaddy.com, LLC | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 597 | affiliatemarketingbasics.info | GoDaddy.com, LLC | 30 Mar 2015 | - | 30 Mar 2016 |
| 598 | affiliatemarketingniches.com | Dynadot, LLC | 4 Jul 2025 | 28 Oct 2025 | 4 Jul 2026 |
| 599 | affiliatemarketingcompaniesguide.com | Tucows Domains Inc. | 30 Mar 2013 | 3 Apr 2015 | 30 Mar 2016 |
| 600 | affiliatemarketingmovement.com | NameCheap, Inc. | 17 May 2023 | 28 Jun 2024 | 17 May 2024 |
| 601 | affiliatemarketingspeed.com | GoDaddy.com, LLC | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 602 | affiliatemarketingnovice.com | Hostinger, UAB | 27 Jul 2023 | 27 Jul 2025 | 27 Jul 2026 |
| 603 | affiliatemarketingi.com | NameCheap, Inc. | 29 Aug 2015 | 15 Aug 2025 | 29 Aug 2026 |
| 604 | affiliatemarketingkike.com | GoDaddy.com, LLC | 3 Sep 2015 | 3 Sep 2015 | 3 Sep 2016 |
| 605 | affiliatemarketingleverage.com | eNom, Inc. | 16 Jul 2016 | 17 Jun 2017 | 16 Jul 2018 |
| 606 | affiliatemarketingsnipers.com | GoDaddy.com, LLC | 12 Apr 2015 | 13 Apr 2015 | 12 Apr 2016 |
| 607 | affiliatemarketingsmart.com | Wild West Domains, LLC | 15 Jul 2018 | 15 Jul 2018 | 15 Jul 2019 |
| 608 | affiliatemarketingadvise.com | eNom, Inc. | 4 Sep 2015 | 27 Sep 2016 | 4 Sep 2017 |
| 609 | affiliatemarketingrevolutie.com | NameWeb BVBA | 17 Sep 2021 | 30 Nov 2025 | 17 Sep 2025 |
| 610 | affiliatemarketingreports.org | GoDaddy.com, LLC | 12 Apr 2015 | 13 Apr 2015 | 12 Apr 2016 |
| 611 | affiliatemarketingentrepreneur.com | FastDomain Inc. | 14 Jan 2021 | 14 Jan 2021 | 14 Jan 2022 |
| 612 | affiliatemarketingtipsandinfo.com | Mesh Digital Limited | 18 Apr 2015 | 19 Apr 2015 | 18 Apr 2016 |
| 613 | affiliatemarketingpage.com | Domain Original, LLC | 12 Feb 2022 | 28 Apr 2023 | 12 Feb 2023 |
| 614 | affiliatemarketingpartners.com | TurnCommerce, Inc. DBA NameBright.com | 20 Apr 2015 | 14 Apr 2021 | 20 Apr 2026 |
| 615 | affiliatemarketingbyronald4400.com | GoDaddy.com, LLC | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 616 | affiliatemarketingblog.org | GoDaddy.com, LLC | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 617 | affiliatemarketingclassroom.net | eNom, Inc. | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2016 |
| 618 | affiliatemarketing24.com | TurnCommerce, Inc. DBA NameBright.com | 7 Sep 2015 | 18 Oct 2025 | 7 Sep 2025 |
| 619 | affiliatemarketingwithme.com | NameCheap, Inc. | 6 Dec 2019 | - | 6 Dec 2020 |
| 620 | affiliatemarketingindia.com | Cosmotown, Inc. | 13 Sep 2023 | 14 Sep 2024 | 13 Sep 2025 |
| 621 | affiliatemarketingprofessional.com | NameCheap, Inc. | 6 Feb 2023 | 19 Mar 2024 | 6 Feb 2024 |
| 622 | affiliatemarketing101.info | GoDaddy.com, LLC | 12 Oct 2022 | 26 Nov 2025 | 12 Oct 2026 |
| 623 | affiliatemarketingtip.net | GoDaddy.com, LLC | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 624 | affiliatemarketingtoolstore.com | GoDaddy.com, LLC | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 625 | affiliatemarketingboomer.com | Domain ala Carte, LLC | 17 Jul 2016 | 5 Jan 2017 | 17 Jul 2017 |
| 626 | affiliatemarketinggold101.com | FastDomain Inc. | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 627 | affiliatemarketingtv.com | GoDaddy.com, LLC | 1 Dec 2018 | 13 Dec 2025 | 1 Dec 2026 |
| 628 | affiliatemarketingheaven.com | Namesilo, LLC | 30 Apr 2015 | 1 May 2024 | 30 Apr 2025 |
| 629 | affiliatemarketingnewbies101.com | GoDaddy.com, LLC | 9 Aug 2016 | 5 Aug 2025 | 9 Aug 2026 |
| 630 | affiliatemarketingguideonline.com | Dynadot, LLC | 9 Sep 2015 | 24 Aug 2016 | 9 Sep 2017 |
| 631 | affiliatemarketingblog.info | Key-Systems GmbH | 9 Sep 2015 | 10 Sep 2015 | 9 Sep 2016 |
| 632 | affiliatemarketingreviewer.com | NameCheap, Inc. | 29 Jul 2016 | 6 Sep 2023 | 29 Jul 2024 |
| 633 | affiliatemarketingtoolbelt.com | GoDaddy.com, LLC | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2017 |
| 634 | affiliatemarketingonclickbank.com | Crazy Domains FZ-LLC | 11 Sep 2015 | 22 Sep 2017 | 11 Sep 2017 |
| 635 | affiliatemarketingcastle.com | GoDaddy.com, LLC | 9 May 2015 | 9 May 2015 | 9 May 2016 |
| 636 | affiliatemarketingblueprintreview.com | GoDaddy.com, LLC | 9 May 2015 | 9 May 2015 | 9 May 2016 |
| 637 | affiliatemarketingsurfer.com | - | - | - | - |
| 638 | affiliatemarketingfordummies2015.com | eNom, Inc. | 11 May 2015 | 11 May 2015 | 11 May 2016 |
| 639 | affiliatemarketingrevolution.com | TurnCommerce, Inc. DBA NameBright.com | 25 Dec 2021 | 24 Aug 2022 | 25 Dec 2025 |
| 640 | affiliatemarketingnewbie.com | Squarespace Domains LLC | 25 Sep 2023 | 7 Nov 2025 | 25 Sep 2025 |
| 641 | affiliatemarketingblueprintreview.net | GoDaddy.com, LLC | 11 May 2015 | 11 May 2015 | 11 May 2016 |
| 642 | affiliatemarketingnewbiesupport.com | GoDaddy.com, LLC | 12 Sep 2015 | 12 Sep 2015 | 12 Sep 2017 |
| 643 | affiliatemarketingforboomers.com | Launchpad, Inc. | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 644 | affiliatemarketingconquest.com | eNom, Inc. | 13 May 2015 | 13 May 2015 | 13 May 2016 |
| 645 | affiliatemarketingdashboard.com | Tucows Domains Inc. | 14 May 2015 | 18 May 2017 | 14 May 2017 |
| 646 | affiliatemarketing-guru.com | NameCheap, Inc. | 15 May 2015 | 15 Apr 2025 | 15 May 2026 |
| 647 | affiliatemarketingblueprint.net | - | 10 Sep 2016 | 10 Sep 2016 | 10 Sep 2017 |
| 648 | affiliatemarketingnetworkreviews.com | GoDaddy.com, LLC | 17 May 2015 | 17 May 2015 | 17 May 2016 |
| 649 | affiliatemarketinggold-x.com | eNom, Inc. | 18 May 2015 | 18 May 2015 | 18 May 2016 |
| 650 | affiliatemarketing2015.com | GoDaddy.com, LLC | 18 May 2015 | 18 May 2015 | 18 May 2016 |
| 651 | affiliatemarketingresearch.com | NameKing.com Inc. | 2 Jan 2023 | 17 Mar 2024 | 2 Jan 2024 |
| 652 | affiliatemarketinglatestnews.com | eNom, Inc. | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 653 | affiliatemarketingcounts.com | GoDaddy.com, LLC | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 654 | affiliatemarketingandsfimg.com | register.com, Inc. | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 655 | affiliatemarketingshowcase.com | GoDaddy.com, LLC | 21 May 2015 | 21 May 2015 | 21 May 2016 |
| 656 | affiliatemarketingbeginners.com | Name.com, Inc. | 16 Jul 2025 | 16 Jul 2025 | 16 Jul 2026 |
| 657 | affiliatemarketingbuddy.com | Tucows Domains Inc. | 23 Feb 2024 | 23 Feb 2024 | 23 Feb 2025 |
| 658 | affiliatemarketingnet.com | Google, Inc. | 16 Jun 2025 | 16 Jun 2025 | 16 Jun 2026 |
| 659 | affiliatemarketingland.com | NameCheap, Inc. | 29 Apr 2021 | 1 Apr 2025 | 29 Apr 2026 |
| 660 | affiliatemarketingcliffnotes.com | 1&1 Internet AG | 24 May 2015 | 25 May 2015 | 24 May 2016 |
| 661 | affiliatemarketingandreferralprogramsreviews.com | eNom, Inc. | 25 May 2015 | 25 May 2015 | 25 May 2016 |
| 662 | affiliatemarketingabcs.com | Wix.com Ltd. | 3 Apr 2023 | 13 Jun 2024 | 3 Apr 2024 |
| 663 | affiliatemarketingchannel.com | DropCatch.com 1534 LLC | 14 Nov 2025 | 14 Nov 2025 | 14 Nov 2026 |
| 664 | affiliatemarketinghero.net | GoDaddy.com, LLC | 24 May 2015 | 24 May 2015 | 24 May 2016 |
| 665 | affiliatemarketingprofits.biz | GoDaddy.com, LLC | 26 May 2015 | 26 May 2015 | 25 May 2016 |
| 666 | affiliatemarketingmall.com | GoDaddy.com, LLC | 26 May 2015 | 28 May 2025 | 26 May 2026 |
| 667 | affiliatemarketingeagle.com | Launchpad, Inc. | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 668 | affiliatemarketingboard.com | GoDaddy.com, LLC | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 669 | affiliatemarketingtutor.com | Dynadot, LLC | 14 Sep 2025 | 14 Sep 2025 | 14 Sep 2026 |
| 670 | affiliatemarketingskill.com | GoDaddy.com, LLC | 14 May 2021 | 20 Feb 2025 | 14 May 2027 |
| 671 | affiliatemarketinggameplan.com | Web Commerce Communications Limited dba WebNic.cc | 17 Nov 2022 | 26 Oct 2022 | 17 Nov 2024 |
| 672 | affiliatemarketingwarriors.com | eNom, Inc. | 19 Aug 2022 | 30 Sep 2023 | 19 Aug 2023 |
| 673 | affiliatemarketinginusa.com | TLD Registrar Solutions Ltd. | 30 May 2015 | 30 May 2015 | 30 May 2016 |
| 674 | affiliatemarketingmadeeasy.us | eNom, Inc. | 29 May 2015 | 29 May 2015 | 28 May 2016 |
| 675 | affiliatemarketingstartup.com | Google, Inc. | 3 Mar 2023 | 14 Apr 2025 | 3 Mar 2025 |
| 676 | affiliatemarketingguide.net | Google, Inc. | 23 Dec 2021 | 24 Dec 2023 | 23 Dec 2024 |
| 677 | affiliatemarketingexplained.net | Google, Inc. | 30 May 2015 | 31 May 2015 | 30 May 2016 |
| 678 | affiliatemarketingdr.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 679 | affiliatemarketingmonster.com | GoDaddy.com, LLC | 14 May 2023 | 25 Jun 2024 | 14 May 2024 |
| 680 | affiliatemarketingcentral.net | - | 5 Sep 2016 | 5 Sep 2016 | 5 Sep 2017 |
| 681 | affiliatemarketingforu.com | GoDaddy.com, LLC | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 682 | affiliatemarketinguni.com | Tucows Domains Inc. | 24 Jan 2023 | 5 Apr 2024 | 24 Jan 2024 |
| 683 | affiliatemarketing1on1.com | NameCheap, Inc. | 1 May 2024 | 1 Apr 2025 | 1 May 2026 |
| 684 | affiliatemarketing-googlesnipercourse.com | Tucows Domains Inc. | 31 Jan 2017 | 31 Jan 2017 | 31 Jan 2018 |
| 685 | affiliatemarketingtips.info | Dynadot, LLC | 17 Mar 2022 | 26 May 2023 | 17 Mar 2023 |
| 686 | affiliatemarketingclasses.net | Global Domains International, Inc. DBA DomainCostC… | 4 Jun 2015 | 4 Jun 2017 | 4 Jun 2018 |
| 687 | affiliatemarketingthought.com | GoDaddy.com, LLC | 6 Jun 2015 | 6 Jun 2015 | 6 Jun 2016 |
| 688 | affiliatemarketinginstruction.com | GoDaddy.com, LLC | 7 Jun 2015 | 8 Jun 2015 | 7 Jun 2016 |
| 689 | affiliatemarketingbullets.com | GoDaddy.com, LLC | 7 Jun 2015 | 7 Jun 2015 | 7 Jun 2016 |
| 690 | affiliatemarketingstarter.com | NameCheap, Inc. | 24 Oct 2016 | 24 Sep 2025 | 24 Oct 2026 |
| 691 | affiliatemarketingprogramsforbeginners.org | GoDaddy.com, LLC | 17 Sep 2015 | 17 Sep 2015 | 17 Sep 2016 |
| 692 | affiliatemarketingprogramforbeginners.com | NameCheap, Inc. | 5 Jan 2021 | - | 5 Jan 2022 |
| 693 | affiliatemarketingcursus.com | Key-Systems GmbH | 20 Aug 2020 | 27 Nov 2025 | 20 Aug 2026 |
| 694 | affiliatemarketingactionplan.com | OpenTLD B.V. | 18 Nov 2017 | 18 Nov 2017 | 18 Nov 2018 |
| 695 | affiliatemarketingroadmap.com | NameCheap, Inc. | 28 Nov 2018 | 28 Nov 2018 | 28 Nov 2019 |
| 696 | affiliatemarketinginsider.com | Wild West Domains, LLC | 15 Sep 2022 | 15 Sep 2025 | 15 Sep 2026 |
| 697 | affiliatemarketingsoldier.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 698 | affiliatemarketingmix.com | Namesilo, LLC | 9 May 2024 | 10 May 2025 | 9 May 2026 |
| 699 | affiliatemarketingfriend.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 700 | affiliatemarketingforthebeginners.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 701 | affiliatemarketingfactory.com | GoDaddy.com, LLC | 27 May 2020 | 27 May 2020 | 27 May 2021 |
| 702 | affiliatemarketingconvention.com | Nom-iq Ltd. dba COM LAUDE | 13 Nov 2016 | 18 Oct 2025 | 13 Nov 2026 |
| 703 | affiliatemarketingadvisor.org | GoDaddy.com, LLC | 13 Apr 2014 | 11 Jun 2015 | 13 Apr 2016 |
| 704 | affiliatemarketingezy.com | eNom, Inc. | 14 Jun 2015 | 14 Jun 2015 | 14 Jun 2016 |
| 705 | affiliatemarketingblueprint.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Nov 2019 | 19 Nov 2019 | 14 Nov 2020 |
| 706 | affiliatemarketingpedia.com | NameCheap, Inc. | 3 Nov 2022 | 31 Oct 2025 | 3 Nov 2026 |
| 707 | affiliatemarketingparadise.com | GoDaddy.com, LLC | 28 Jul 2022 | 11 Aug 2025 | 28 Jul 2026 |
| 708 | affiliatemarketingtutorial.net | DropCatch.com 1382 LLC | 10 Jul 2024 | 20 Aug 2025 | 10 Jul 2025 |
| 709 | affiliatemarketingtools.org | PSI-USA, Inc. dba Domain Robot | 7 Nov 2019 | 30 Dec 2024 | 7 Nov 2025 |
| 710 | affiliatemarketingtomorrow.info | GoDaddy.com, LLC | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 711 | affiliatemarketingcorner.com | GoDaddy.com, LLC | 10 Jan 2019 | 11 Jan 2025 | 10 Jan 2026 |
| 712 | affiliatemarketingatoz.com | Wild West Domains, LLC | 9 Nov 2023 | 10 Nov 2025 | 9 Nov 2026 |
| 713 | affiliatemarketingleader.com | eNom, Inc. | 12 Mar 2024 | 12 Mar 2024 | 12 Mar 2025 |
| 714 | affiliatemarketingforretirees.com | eNom, Inc. | 19 Jun 2015 | 18 May 2017 | 19 Jun 2018 |
| 715 | affiliatemarketingideas.net | eNom, Inc. | 12 Jul 2023 | 24 Sep 2025 | 12 Jul 2025 |
| 716 | affiliatemarketingmanagers.com | eNom, Inc. | 20 Jun 2015 | 20 Jun 2015 | 20 Jun 2016 |
| 717 | affiliatemarketingreports.com | TurnCommerce, Inc. DBA NameBright.com | 20 Sep 2015 | 1 Dec 2024 | 20 Sep 2024 |
| 718 | affiliatemarketingengine.com | NameCheap, Inc. | 5 Oct 2019 | 16 Nov 2024 | 5 Oct 2024 |
| 719 | affiliatemarketingspecialoffers.com | NameCheap, Inc. | 16 Dec 2022 | 17 Dec 2025 | 16 Dec 2026 |
| 720 | affiliatemarketingcouncilofcanada.info | GoDaddy.com, LLC | 2 Aug 2014 | 2 Aug 2017 | 2 Aug 2018 |
| 721 | affiliatemarketingcouncilofcanada.com | GoDaddy.com, LLC | 2 Aug 2014 | 21 Sep 2015 | 2 Aug 2016 |
| 722 | affiliatemarketingcouncil.info | GoDaddy.com, LLC | 2 Aug 2014 | 2 Aug 2017 | 2 Aug 2018 |
| 723 | affiliatemarketingcouncil.com | GoDaddy.com, LLC | 2 Aug 2014 | 21 Sep 2015 | 2 Aug 2016 |
| 724 | affiliatemarketingtips.us | NameCheap, Inc. | 5 Apr 2024 | 5 Apr 2025 | 5 Apr 2025 |
| 725 | affiliatemarketingreview.info | GoDaddy.com, LLC | 2 Mar 2017 | 23 May 2017 | 2 Mar 2018 |
| 726 | affiliatemarketingmasterclass.com | GoDaddy.com, LLC | 11 Dec 2017 | 12 Dec 2025 | 11 Dec 2026 |
| 727 | affiliatemarketingexpress.com | 1API GmbH | 15 Dec 2022 | 23 Nov 2025 | 15 Dec 2026 |
| 728 | affiliatemarketingmania.com | NameCheap, Inc. | 25 Oct 2018 | 25 Oct 2018 | 25 Oct 2019 |
| 729 | affiliatemarketingmail.info | Crazy Domains FZ-LLC | 27 Jun 2015 | - | 27 Jun 2016 |
| 730 | affiliatemarketingeducationcenter.com | Launchpad, Inc. | 28 Jun 2015 | 28 Jun 2015 | 28 Jun 2016 |
| 731 | affiliatemarketingsnow.com | Tucows Domains Inc. | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2016 |
| 732 | affiliatemarketinggazette.com | 1&1 Internet AG | 30 Jun 2015 | 30 Jun 2016 | 30 Jun 2018 |
| 733 | affiliatemarketingbusines.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Sep 2016 | 28 Oct 2017 | 15 Sep 2017 |
| 734 | affiliatemarketingpays.com | GoDaddy.com, LLC | 10 Aug 2019 | 10 Aug 2019 | 10 Aug 2020 |
| 735 | affiliatemarketingmasteryfornewbies.com | GoDaddy.com, LLC | 1 Jul 2015 | 1 Jul 2015 | 1 Jul 2016 |
| 736 | affiliatemarketingrookie.com | NameCheap, Inc. | 30 Dec 2019 | - | 30 Dec 2020 |
| 737 | affiliatemarketinggroup.net | GoDaddy.com, LLC | 24 Sep 2015 | 24 Sep 2015 | 24 Sep 2016 |
| 738 | affiliatemarketingstuff.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 11 May 2023 | 19 May 2024 | 11 May 2024 |
| 739 | affiliatemarketingmoneypit.com | GoDaddy.com, LLC | 3 Jul 2015 | 3 Jul 2015 | 3 Jul 2016 |
| 740 | affiliatemarketingsuccesssecrets.com | Epik Inc. | 24 Sep 2015 | 24 Sep 2025 | 24 Sep 2026 |
| 741 | affiliatemarketingadvisory.com | GoDaddy.com, LLC | 9 Mar 2017 | 9 Mar 2017 | 9 Mar 2018 |
| 742 | affiliatemarketingtipster.com | GoDaddy.com, LLC | 3 Nov 2019 | 5 Nov 2025 | 3 Nov 2026 |
| 743 | affiliatemarketingnow.info | GoDaddy.com, LLC | 4 Jul 2015 | 4 Jul 2015 | 4 Jul 2016 |
| 744 | affiliatemarketingg.info | GoDaddy.com, LLC | 4 Jul 2015 | 4 Jul 2015 | 4 Jul 2016 |
| 745 | affiliatemarketingproductreview.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 25 Sep 2021 | 10 Nov 2023 | 25 Sep 2023 |
| 746 | affiliatemarketinggenius.com | NameCheap, Inc. | 1 Mar 2023 | 30 Jan 2025 | 1 Mar 2026 |
| 747 | affiliatemarketing-made-simple.com | GoDaddy.com, LLC | 7 Jul 2015 | 7 Jul 2015 | 7 Jul 2016 |
| 748 | affiliatemarketingblueprint.info | GoDaddy.com, LLC | 6 Jul 2015 | 6 Jul 2015 | 6 Jul 2016 |
| 749 | affiliatemarketingpages.com | GoDaddy.com, LLC | 25 Oct 2022 | 25 Oct 2022 | 25 Oct 2023 |
| 750 | affiliatemarketingstepbystep.org | eNom, Inc. | 25 Sep 2015 | 25 Sep 2015 | 25 Sep 2016 |
| 751 | affiliatemarketinghero.org | eNom, Inc. | 25 Sep 2015 | 21 Sep 2016 | 25 Sep 2017 |
| 752 | affiliatemarketinga-z.com | Porkbun, LLC | 14 Nov 2021 | 13 Nov 2025 | 14 Nov 2026 |
| 753 | affiliatemarketingprofessionals.com | Easy Street Domains, LLC | 27 Sep 2024 | 10 Nov 2025 | 27 Sep 2025 |
| 754 | affiliatemarketinghut.com | Wild West Domains, LLC | 20 Feb 2020 | 20 Feb 2020 | 20 Feb 2022 |
| 755 | affiliatemarketingtipsforbeginners.com | eNom, Inc. | 23 Jul 2017 | 23 Jul 2017 | 23 Jul 2018 |
| 756 | affiliatemarketingden.com | Domain Name Root LLC | 20 Feb 2021 | 20 Feb 2021 | 20 Feb 2022 |
| 757 | affiliatemarketinggroup.org | GoDaddy.com, LLC | 26 Oct 2017 | 26 Oct 2017 | 26 Oct 2018 |
| 758 | affiliatemarketingtrainingforbeginners.com | NameCheap, Inc. | 22 Oct 2022 | 3 Dec 2023 | 22 Oct 2023 |
| 759 | affiliatemarketingstudent.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Sep 2022 | 21 Sep 2023 | 21 Sep 2024 |
| 760 | affiliatemarketinghomebusiness.com | eNom, Inc. | 9 Feb 2021 | 10 Jan 2025 | 9 Feb 2026 |
| 761 | affiliatemarketingarsenal.com | Dynadot, LLC | 12 Jul 2015 | 7 Oct 2015 | 12 Jul 2016 |
| 762 | affiliatemarketingsuccessstory.com | eNom, Inc. | 13 Jul 2015 | 14 Jul 2015 | 13 Jul 2016 |
| 763 | affiliatemarketingsoftware.com | GoDaddy.com, LLC | 4 Jun 2002 | 5 Jun 2025 | 4 Jun 2026 |
| 764 | affiliatemarketingwithdavidross.com | GoDaddy.com, LLC | 14 Jul 2015 | 14 Jul 2015 | 14 Jul 2016 |
| 765 | affiliatemarketinginsidersecrets.com | GoDaddy.com, LLC | 19 Jul 2022 | 30 Sep 2024 | 19 Jul 2024 |
| 766 | affiliatemarketingmum.com | GoDaddy.com, LLC | 17 Jan 2023 | 30 Mar 2024 | 17 Jan 2024 |
| 767 | affiliatemarketingcertification.com | eNom, Inc. | 15 Jul 2015 | 15 Jul 2015 | 15 Jul 2020 |
| 768 | affiliatemarketingwithjoy.com | eNom, Inc. | 16 Jul 2015 | 19 Jul 2017 | 16 Jul 2017 |
| 769 | affiliatemarketingengineer.com | GoDaddy.com, LLC | 16 Jul 2015 | 16 Jul 2015 | 16 Jul 2017 |
| 770 | affiliatemarketingincome.net | BigRock Solutions Ltd. | 15 Jul 2015 | 15 Jul 2015 | 15 Jul 2016 |
| 771 | affiliatemarketinganswers.org | Dynadot, LLC | 15 Jul 2015 | 7 Oct 2015 | 15 Jul 2016 |
| 772 | affiliatemarketingquest.com | NameCheap, Inc. | 27 Dec 2021 | 3 Jan 2026 | 27 Dec 2026 |
| 773 | affiliatemarketingsite.net | Name.com, Inc. | 6 Mar 2025 | 6 Mar 2025 | 6 Mar 2026 |
| 774 | affiliatemarketingonline.biz | GoDaddy.com, LLC | 28 Nov 2016 | 28 Nov 2016 | 27 Nov 2017 |
| 775 | affiliatemarketinghealth.com | GoDaddy.com, LLC | 9 Mar 2023 | 20 Apr 2025 | 9 Mar 2025 |
| 776 | affiliatemarketingpro.info | Dynadot, LLC | 15 Jul 2025 | 20 Jul 2025 | 15 Jul 2026 |
| 777 | affiliatemarketingprograms.info | NameCheap, Inc. | 8 Dec 2018 | 8 Nov 2019 | 8 Dec 2020 |
| 778 | affiliatemarketingsimplified.com | GoDaddy.com, LLC | 3 Dec 2023 | 4 Dec 2025 | 3 Dec 2026 |
| 779 | affiliatemarketingpal.com | GoDaddy.com, LLC | 25 Apr 2021 | 26 Apr 2025 | 25 Apr 2026 |
| 780 | affiliatemarketingstud.com | GoDaddy.com, LLC | 24 Jul 2015 | 4 Oct 2024 | 24 Jul 2024 |
| 781 | affiliatemarketingbusinessonline.com | Fabulous.com Pty Ltd. | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 782 | affiliatemarketingatoz.net | NameCheap, Inc. | 7 Oct 2020 | 8 Sep 2025 | 7 Oct 2026 |
| 783 | affiliatemarketingleads.info | Namesilo, LLC | 17 Jul 2011 | 24 Jul 2015 | 17 Jul 2016 |
| 784 | affiliatemarketingpromo.com | Fabulous.com Pty Ltd. | 28 Jan 2019 | 14 Dec 2024 | 28 Jan 2026 |
| 785 | affiliatemarketingfact.com | Namesilo, LLC | 8 Nov 2022 | 9 Nov 2025 | 8 Nov 2026 |
| 786 | affiliatemarketingbasics.net | NameCheap, Inc. | 14 Mar 2018 | 14 Mar 2018 | 14 Mar 2019 |
| 787 | affiliatemarketinghelpedmefiremyboss.com | eNom, Inc. | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 788 | affiliatemarketingarena.com | NameCheap, Inc. | 3 Feb 2018 | 4 Feb 2018 | 3 Feb 2019 |
| 789 | affiliatemarketingclasses.org | GoDaddy.com, LLC | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 790 | affiliatemarketingtimes.com | GoDaddy.com, LLC | 1 Oct 2015 | 1 Oct 2015 | 1 Oct 2016 |
| 791 | affiliatemarketing-workshop.com | GoDaddy.com, LLC | 30 Sep 2015 | 30 Sep 2015 | 30 Sep 2016 |
| 792 | affiliatemarketingdigital.com | GoDaddy.com, LLC | 28 Nov 2022 | 9 Feb 2025 | 28 Nov 2024 |
| 793 | affiliatemarketingusa.net | NetEarth One Inc. d/b/a NetEarth | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 794 | affiliatemarketingtrainingclub.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 10 Sep 2018 | 11 Sep 2018 | 10 Sep 2019 |
| 795 | affiliatemarketinginyorkpa.com | eNom, Inc. | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2018 |
| 796 | affiliatemarketingformums.com | 1&1 Internet AG | 20 Mar 2018 | 20 Mar 2018 | 20 Mar 2019 |
| 797 | affiliatemarketingsecretsreseller.com | GoDaddy.com, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 798 | affiliatemarketingforbeginners.biz | GoDaddy.com, LLC | 2 Aug 2015 | 14 Aug 2016 | 1 Aug 2017 |
| 799 | affiliatemarketingdeception.com | GoDaddy.com, LLC | 9 Aug 2015 | 9 Aug 2015 | 9 Aug 2016 |
| 800 | affiliatemarketingknol.com | Tucows Domains Inc. | 7 Aug 2008 | 11 Aug 2015 | 7 Aug 2016 |
| 801 | affiliatemarketingitalia.com | Tucows Domains Inc. | 14 Jul 2023 | 24 Sep 2025 | 14 Jul 2025 |
| 802 | affiliatemarketingitalia.net | Key-Systems GmbH | 10 Aug 2015 | 11 Aug 2016 | 10 Aug 2017 |
| 803 | affiliatemarketingitalia.info | Key-Systems GmbH | 10 Aug 2015 | 10 Aug 2016 | 10 Aug 2017 |
| 804 | affiliatemarketingenterprisenetwork.com | GoDaddy.com, LLC | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2017 |
| 805 | affiliatemarketingtrainingclub.org | GoDaddy.com, LLC | 6 Oct 2015 | 28 Jul 2017 | 6 Oct 2017 |
| 806 | affiliatemarketingtrainingclub.net | GoDaddy.com, LLC | 6 Oct 2015 | 11 Oct 2017 | 6 Oct 2017 |
| 807 | affiliatemarketingforbeginners1.com | GoDaddy.com, LLC | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2016 |
| 808 | affiliatemarketingtechnique.com | enom405, Incorporated | 12 Aug 2023 | 26 Oct 2024 | 12 Aug 2024 |
| 809 | affiliatemarketingnetwork.net | Dynadot, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 810 | affiliatemarketingfellowship.com | GoDaddy.com, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2017 |
| 811 | affiliatemarketingblab.com | GoDaddy.com, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 812 | affiliatemarketinglink.com | 1&1 Internet AG | 9 Aug 2024 | 20 Sep 2025 | 9 Aug 2025 |
| 813 | affiliatemarketingexplode.com | eNom, Inc. | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 814 | affiliatemarketingtrust.com | eNom, Inc. | 7 Oct 2009 | 9 Oct 2015 | 7 Oct 2016 |
| 815 | affiliatemarketingcontent.com | Porkbun, LLC | 29 Jun 2025 | 30 Jun 2025 | 29 Jun 2026 |
| 816 | affiliatemarketing-tips.com | Name.com, Inc. | 12 Oct 2015 | 25 Dec 2025 | 12 Oct 2025 |
| 817 | affiliatemarketingatmax.com | FastDomain Inc. | 13 Oct 2015 | 13 Oct 2015 | 13 Oct 2016 |
| 818 | affiliatemarketing-mit-system.com | united-domains AG | 16 Oct 2015 | 25 Oct 2024 | 16 Oct 2024 |
| 819 | affiliatemarketingicon.com | GoDaddy.com, LLC | 8 Nov 2022 | 20 Jan 2024 | 8 Nov 2023 |
| 820 | affiliatemarketingmastertips.xyz | NameCheap, Inc. | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 821 | affiliatemarketingedu.com | NameCheap, Inc. | 9 Feb 2023 | 9 Jul 2025 | 9 Feb 2026 |
| 822 | affiliatemarketingrobots.com | GoDaddy.com, LLC | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 823 | affiliatemarketinginfosite.com | Namesilo, LLC | 22 Feb 2019 | 23 Feb 2019 | 22 Feb 2020 |
| 824 | affiliatemarketinghacks.com | NameCheap, Inc. | 15 Jan 2024 | 16 Dec 2025 | 15 Jan 2027 |
| 825 | affiliatemarketingbasecamp.com | Launchpad, Inc. | 24 Oct 2015 | 13 Oct 2016 | 24 Oct 2017 |
| 826 | affiliatemarketingtraffics.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2016 |
| 827 | affiliatemarketingbeginnersguide.com | GoDaddy.com, LLC | 5 Dec 2016 | 5 Dec 2016 | 5 Dec 2018 |
| 828 | affiliatemarketingassistance.com | GoDaddy.com, LLC | 27 Oct 2015 | 27 Oct 2015 | 27 Oct 2016 |
| 829 | affiliatemarketingplatform.net | NameCheap, Inc. | 8 Aug 2022 | 20 Oct 2023 | 8 Aug 2023 |
| 830 | affiliatemarketingoptimized.com | GoDaddy.com, LLC | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2017 |
| 831 | affiliatemarketingweb.com | DropCatch.com 441 LLC | 27 Jan 2022 | 28 Jan 2022 | 27 Jan 2026 |
| 832 | affiliatemarketinginitiative.com | GoDaddy.com, LLC | 29 Oct 2015 | 29 Oct 2015 | 29 Oct 2016 |
| 833 | affiliatemarketingopportunity.info | GoDaddy.com, LLC | 30 Oct 2015 | 31 Oct 2016 | 30 Oct 2017 |
| 834 | affiliatemarketinginformer.com | GoDaddy.com, LLC | 30 Oct 2015 | 31 Oct 2015 | 30 Oct 2016 |
| 835 | affiliatemarketingskills.com | - | 1 Jul 2023 | 31 Jul 2025 | 1 Jul 2026 |
| 836 | affiliatemarketingold.com | Launchpad, Inc. | 6 Nov 2015 | 17 Nov 2016 | 6 Nov 2017 |
| 837 | affiliatemarketingsistemi.com | GoDaddy.com, LLC | 7 Nov 2015 | 7 Nov 2015 | 7 Nov 2016 |
| 838 | affiliatemarketingprofit.net | Namesilo, LLC | 6 Jun 2021 | 10 Jul 2023 | 6 Jun 2023 |
| 839 | affiliatemarketingtipshq.com | TLD Registrar Solutions Ltd. | 8 Mar 2015 | 8 Mar 2016 | 8 Mar 2018 |
| 840 | affiliatemarketingclub.co.uk | Hello Internet Corp. | 15 Sep 2015 | 16 Sep 2017 | 15 Sep 2019 |
| 841 | affiliatemarketingtipps.com | NameCheap, Inc. | 25 Apr 2024 | 7 Jul 2025 | 25 Apr 2025 |
| 842 | affiliatemarketinggoldbiz.com | eNom, Inc. | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 843 | affiliatemarketingstepbystep.com | NameCheap, Inc. | 11 May 2024 | 21 Dec 2024 | 11 May 2026 |
| 844 | affiliatemarketingg.xyz | NameCheap, Inc. | 13 Nov 2015 | 13 Nov 2015 | 13 Nov 2016 |
| 845 | affiliatemarketingprograms.site | DOTSERVE INC. | 6 Oct 2022 | 7 Oct 2023 | 6 Oct 2024 |
| 846 | affiliatemarketingminute.com | GoDaddy.com, LLC | 14 Nov 2015 | 14 Nov 2015 | 14 Nov 2016 |
| 847 | affiliatemarketing2.com | NameCheap, Inc. | 20 Dec 2022 | 2 Mar 2024 | 20 Dec 2023 |
| 848 | affiliatemarketing-easyway.com | GoDaddy.com, LLC | 14 Nov 2015 | 15 Nov 2015 | 14 Nov 2016 |
| 849 | affiliatemarketingprofessor.com | eNom, Inc. | 8 Mar 2019 | 21 May 2025 | 8 Mar 2025 |
| 850 | affiliatemarketingforgettingstarted.com | DreamHost, LLC | 17 Nov 2015 | 18 Nov 2015 | 17 Nov 2016 |
| 851 | affiliatemarketingblogmalaysia.com | eNom, Inc. | 18 Nov 2015 | 18 Nov 2015 | 18 Nov 2016 |
| 852 | affiliatemarketing101.xyz | GoDaddy.com, LLC | 6 Aug 2017 | 6 Aug 2017 | 6 Aug 2018 |
| 853 | affiliatemarketinginfo.net | Tucows Domains Inc. | 7 May 2020 | 11 May 2022 | 7 May 2022 |
| 854 | affiliatemarketingvietnam.com | Dynadot, LLC | 6 Sep 2025 | 9 Sep 2025 | 6 Sep 2026 |
| 855 | affiliatemarketingtrainingacademy.com | HiChina Zhicheng Technology Limited | 11 Nov 2018 | 12 Nov 2018 | 11 Nov 2019 |
| 856 | affiliatemarketingsteps.com | NameCheap, Inc. | 18 Nov 2022 | 30 Jan 2024 | 18 Nov 2023 |
| 857 | affiliatemarketingforstartup.com | eNom, Inc. | 20 Nov 2015 | 20 Nov 2015 | 20 Nov 2016 |
| 858 | affiliatemarketingquiz.com | GoDaddy.com, LLC | 11 Mar 2025 | 11 Mar 2025 | 11 Mar 2026 |
| 859 | affiliatemarketingmaestro.com | GoDaddy.com, LLC | 20 Jun 2022 | 31 Jul 2025 | 20 Jun 2025 |
| 860 | affiliatemarketingebiz.com | Tucows Domains Inc. | 2 Jun 2020 | 6 Jun 2021 | 2 Jun 2021 |
| 861 | affiliatemarketingbreakthrough.com | GoDaddy.com, LLC | 29 Jan 2021 | 29 Jan 2025 | 29 Jan 2026 |
| 862 | affiliatemarketinglesson.com | eNom, Inc. | 23 Nov 2015 | 18 Nov 2016 | 23 Nov 2017 |
| 863 | affiliatemarketingmine.com | Launchpad, Inc. | 23 Nov 2015 | 23 Nov 2015 | 23 Nov 2016 |
| 864 | affiliatemarketingstorm.com | ChocolateChipDomains, LLC | 13 Feb 2017 | 14 Feb 2017 | 13 Feb 2018 |
| 865 | affiliatemarketingprogramsonline.com | Uniregistrar Corp | 25 Nov 2015 | 25 Nov 2015 | 25 Nov 2016 |
| 866 | affiliatemarketingopporunity.com | Uniregistrar Corp | 25 Nov 2015 | 25 Nov 2015 | 25 Nov 2016 |
| 867 | affiliatemarketingonlineprogram.com | 1API GmbH | 25 Nov 2015 | 25 Nov 2015 | 25 Nov 2016 |
| 868 | affiliatemarketingminute.video | GoDaddy.com, LLC | 25 Nov 2015 | 25 Nov 2015 | 25 Nov 2016 |
| 869 | affiliatemarketingjob.com | GoDaddy.com, LLC | 25 Nov 2015 | 5 Nov 2025 | 25 Nov 2026 |
| 870 | affiliatemarketingindustry.com | NameCheap, Inc. | 29 Dec 2023 | 12 Dec 2025 | 29 Dec 2026 |
| 871 | affiliatemarketingfirms.com | GoDaddy.com, LLC | 25 Nov 2015 | 5 Nov 2025 | 25 Nov 2026 |
| 872 | affiliatemarketingfirm.com | GoDaddy.com, LLC | 25 Nov 2015 | 5 Nov 2025 | 25 Nov 2026 |
| 873 | affiliatemarketingcorporation.com | 1API GmbH | 25 Nov 2015 | 25 Nov 2015 | 25 Nov 2016 |
| 874 | affiliatemarketingadvertising.com | Hostinger, UAB | 26 Jan 2025 | 2 Apr 2025 | 26 Jan 2027 |
| 875 | affiliatemarketingstudio.com | GoDaddy.com, LLC | 9 Oct 2024 | 10 Oct 2025 | 9 Oct 2026 |
| 876 | affiliatemarketingmail.com | GoDaddy.com, LLC | 29 Nov 2015 | 30 Nov 2015 | 29 Nov 2016 |
| 877 | affiliatemarketinggroup.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Nov 2015 | 30 Nov 2015 | 29 Nov 2016 |
| 878 | affiliatemarketingcity.com | GoDaddy.com, LLC | 29 Nov 2015 | 30 Nov 2015 | 29 Nov 2016 |
| 879 | affiliatemarketing4dummies.info | GoDaddy.com, LLC | 28 Nov 2015 | 28 Nov 2015 | 28 Nov 2016 |
| 880 | affiliatemarketinginminutes.com | eNom, Inc. | 1 Dec 2015 | 2 Nov 2016 | 1 Dec 2017 |
| 881 | affiliatemarketingfunnels.com | GoDaddy.com, LLC | 1 Dec 2015 | 5 Dec 2025 | 1 Dec 2026 |
| 882 | affiliatemarketingcanworkforyou.com | eNom, Inc. | 1 Dec 2015 | 1 Dec 2015 | 1 Dec 2016 |
| 883 | affiliatemarketingace.com | NameCheap, Inc. | 17 Oct 2023 | 29 Dec 2024 | 17 Oct 2024 |
| 884 | affiliatemarketingtrainings.org | Hostinger, UAB | 1 Dec 2015 | 28 Dec 2024 | 1 Dec 2026 |
| 885 | affiliatemarketingforbeginners.org | 1&1 Internet AG | 1 Dec 2015 | 2 Dec 2016 | 1 Dec 2017 |
| 886 | affiliatemarketingatwork.com | GoDaddy.com, LLC | 26 Nov 2015 | 26 Nov 2015 | 26 Nov 2016 |
| 887 | affiliatemarketingthings.com | DropCatch.com 361 LLC | 20 Feb 2017 | 20 Feb 2017 | 20 Feb 2018 |
| 888 | affiliatemarketingmastersclub.com | GoDaddy.com, LLC | 4 Dec 2015 | 4 Dec 2015 | 4 Dec 2016 |
| 889 | affiliatemarketinghomestead.com | Jiangsu Bangning Science and technology Co. Ltd. | 17 Feb 2022 | 17 Feb 2022 | 17 Feb 2023 |
| 890 | affiliatemarketingbusiness.net | Namesilo, LLC | 17 Dec 2019 | 17 Dec 2025 | 17 Dec 2026 |
| 891 | affiliatemarketingbusiness.info | eNom, Inc. | 12 Aug 2018 | 14 Jul 2019 | 12 Aug 2020 |
| 892 | affiliatemarketingbiz.net | NameCheap, Inc. | 6 Jan 2020 | - | 6 Jan 2021 |
| 893 | affiliatemarketingbiz.info | GoDaddy.com, LLC | 5 Dec 2015 | - | 5 Dec 2016 |
| 894 | affiliatemarketingonline.net | NameCheap, Inc. | 27 Feb 2018 | 27 Feb 2018 | 27 Feb 2019 |
| 895 | affiliatemarketingfree.com | NameCheap, Inc. | 8 Aug 2022 | 20 Oct 2023 | 8 Aug 2023 |
| 896 | affiliatemarketingaz.net | GMO Internet Inc. | 4 Oct 2022 | 16 Dec 2023 | 4 Oct 2023 |
| 897 | affiliatemarketing777.com | Domain.com, LLC | 9 Dec 2015 | 24 Nov 2025 | 9 Dec 2026 |
| 898 | affiliatemarketing-training.net | Interweb Advertising D.B.A. Profile Builder | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2016 |
| 899 | affiliatemarketingthatworks.com | NameCheap, Inc. | 16 Nov 2018 | 17 Oct 2025 | 16 Nov 2026 |
| 900 | affiliatemarketingprovenblueprint.com | GoDaddy.com, LLC | 10 Dec 2015 | 10 Dec 2015 | 10 Dec 2017 |
| 901 | affiliatemarketingcourses.xyz | NameCheap, Inc. | 10 Dec 2015 | 12 Dec 2016 | 10 Dec 2017 |
| 902 | affiliatemarketingonfire.com | eNom, Inc. | 11 Dec 2015 | 9 Nov 2016 | 11 Dec 2017 |
| 903 | affiliatemarketingmastery.xyz | NameCheap, Inc. | 5 Feb 2022 | 5 Feb 2022 | 5 Feb 2023 |
| 904 | affiliatemarketingcardinal.com | eNom, Inc. | 11 Dec 2015 | 11 Dec 2015 | 11 Dec 2016 |
| 905 | affiliatemarketingadminister.com | Launchpad, Inc. | 11 Dec 2015 | 12 Dec 2015 | 11 Dec 2016 |
| 906 | affiliatemarketingprograms.us | GoDaddy.com, LLC | 13 Dec 2015 | 14 Dec 2015 | 12 Dec 2016 |
| 907 | affiliatemarketingfordummies.info | GoDaddy.com, LLC | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2016 |
| 908 | affiliatemarketingtipsonline.com | GoDaddy.com, LLC | 14 Aug 2018 | 14 Aug 2018 | 14 Aug 2019 |
| 909 | affiliatemarketinginsevensteps.com | GoDaddy.com, LLC | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2017 |
| 910 | affiliatemarketingin7steps.com | GoDaddy.com, LLC | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2017 |
| 911 | affiliatemarketingdecoded.com | Tucows Domains Inc. | 21 Apr 2020 | 2 Jul 2025 | 21 Apr 2025 |
| 912 | affiliatemarketingsecretsreveal.com | eNom, Inc. | 17 Dec 2015 | 15 Nov 2016 | 17 Dec 2017 |
| 913 | affiliatemarketingtraining101.net | FastDomain Inc. | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2016 |
| 914 | affiliatemarketingexposed.org | eNom, Inc. | 19 Dec 2015 | 19 Dec 2015 | 19 Dec 2016 |
| 915 | affiliatemarketingprofitsunleashed.com | Launchpad, Inc. | 20 Dec 2015 | 20 Dec 2015 | 20 Dec 2016 |
| 916 | affiliatemarketingplan4beginners.com | GoDaddy.com, LLC | 22 Mar 2017 | 3 Jun 2023 | 22 Mar 2023 |
| 917 | affiliatemarketingaccounting.com | GoDaddy.com, LLC | 23 Dec 2015 | 23 Dec 2015 | 23 Dec 2016 |
| 918 | affiliatemarketingjourney.com | NameCheap, Inc. | 7 Dec 2024 | 7 Nov 2025 | 7 Dec 2026 |
| 919 | affiliatemarketinggurus.com | GoDaddy.com, LLC | 23 May 2023 | 24 May 2025 | 23 May 2026 |
| 920 | affiliatemarketingbooks.net | GoDaddy.com, LLC | 27 Dec 2015 | 27 Dec 2025 | 27 Dec 2026 |
| 921 | affiliatemarketingcashcow.com | GoDaddy.com, LLC | 27 Dec 2015 | 27 Dec 2015 | 27 Dec 2016 |
| 922 | affiliatemarketingbusinesscoach.com | NameCheap, Inc. | 21 Jun 2021 | 22 Jun 2024 | 21 Jun 2025 |
| 923 | affiliatemarketing-business.com | RegistryGate GmbH | 27 Mar 2021 | 3 Dec 2025 | 27 Mar 2026 |
| 924 | affiliatemarketingmillionairesclub.com | Fabulous.com Pty Ltd. | 28 Dec 2015 | 29 Dec 2016 | 28 Dec 2017 |
| 925 | affiliatemarketingz.com | - | 20 Jan 2025 | 21 Jan 2026 | 20 Jan 2027 |
| 926 | affiliatemarketingmarket.com | GoDaddy.com, LLC | 30 Dec 2015 | 30 Dec 2015 | 30 Dec 2016 |
| 927 | affiliatemarketingnicheprograms.com | Wild West Domains, LLC | 31 Dec 2015 | 31 Dec 2015 | 31 Dec 2016 |
| 928 | affiliatemarketingsuccess.xyz | TLD Registrar Solutions Ltd. | 1 Jan 2016 | 1 Jan 2016 | 1 Jan 2017 |
| 929 | affiliatemarketinghq.xyz | NameCheap, Inc. | 29 Dec 2015 | 29 Dec 2015 | 29 Dec 2016 |
| 930 | affiliatemarketingstudents.com | NameCheap, Inc. | 25 Oct 2021 | 25 Sep 2022 | 25 Oct 2023 |
| 931 | affiliatemarketingexpertjoeross.com | eNom, Inc. | 2 Jan 2016 | 2 Jan 2016 | 2 Jan 2017 |
| 932 | affiliatemarketingstools.com | Launchpad, Inc. | 10 Feb 2022 | 10 Feb 2022 | 10 Feb 2023 |
| 933 | affiliatemarketingproalaska.com | GoDaddy.com, LLC | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2018 |
| 934 | affiliatemarketingmastermind.com | Epik Inc. | 23 Mar 2017 | 5 Aug 2023 | 23 Mar 2026 |
| 935 | affiliatemarketingbusiness4you.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Jan 2016 | 27 Jul 2017 | 2 Jan 2018 |
| 936 | affiliatemarketingproalaska.net | GoDaddy.com, LLC | 3 Jan 2016 | 3 Jan 2016 | 3 Jan 2018 |
| 937 | affiliatemarketingproalaska.info | GoDaddy.com, LLC | 3 Jan 2016 | 3 Mar 2016 | 3 Jan 2018 |
| 938 | affiliatemarketingproalaska.org | GoDaddy.com, LLC | 3 Jan 2016 | 3 Mar 2016 | 3 Jan 2018 |
| 939 | affiliatemarketingonline.org | eNom, Inc. | 3 Jan 2016 | 13 Mar 2017 | 3 Jan 2018 |
| 940 | affiliatemarketinglogic.com | GoDaddy.com, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 941 | affiliatemarketingfashion.com | Crazy Domains FZ-LLC | 5 Jan 2016 | 28 Dec 2025 | 5 Jan 2027 |
| 942 | affiliatemarketingsimplesystem.xyz | NameCheap, Inc. | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 943 | affiliatemarketingforme.com | GoDaddy.com, LLC | 10 Sep 2020 | 10 Sep 2020 | 10 Sep 2021 |
| 944 | affiliatemarketingsuccesswithjay.com | GoDaddy.com, LLC | 7 Jan 2016 | 7 Jan 2016 | 7 Jan 2017 |
| 945 | affiliatemarketingppcsimplified.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 946 | affiliatemarketingonlinesimplified.com | GoDaddy.com, LLC | 8 Jan 2016 | 8 Jan 2016 | 8 Jan 2017 |
| 947 | affiliatemarketingforincome.com | Network Solutions, LLC | 7 Jan 2016 | 7 Jan 2016 | 7 Jan 2017 |
| 948 | affiliatemarketingarticles.com | GoDaddy.com, LLC | 28 Mar 2019 | 30 Mar 2025 | 28 Mar 2026 |
| 949 | affiliatemarketingjunkie.com | Wild West Domains, LLC | 21 Jul 2021 | 22 Jul 2025 | 21 Jul 2027 |
| 950 | affiliatemarketingoppoortunities.com | Tucows Domains Inc. | 10 Jan 2016 | 14 Jan 2017 | 10 Jan 2017 |
| 951 | affiliatemarketingdb.com | Porkbun, LLC | 13 Feb 2021 | 28 Jul 2025 | 13 Feb 2027 |
| 952 | affiliatemarketing4cash.com | GoDaddy.com, LLC | 12 Jan 2016 | 12 Jan 2016 | 12 Jan 2017 |
| 953 | affiliatemarketing-forum.com | Realtime Register B.V. | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 954 | affiliatemarketingsimplicity.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Jan 2016 | 15 Jan 2017 | 16 Jan 2018 |
| 955 | affiliatemarketingplanannab.net | Wild West Domains, LLC | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 956 | affiliatemarketingplan-annab.com | Wild West Domains, LLC | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 957 | affiliatemarketingturkiye.com | NameCheap, Inc. | 18 Jan 2016 | 13 Jan 2025 | 18 Jan 2027 |
| 958 | affiliatemarketinginatlantaga.com | eNom, Inc. | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 959 | affiliatemarketingpro.org | NameCheap, Inc. | 27 Dec 2023 | 9 Mar 2025 | 27 Dec 2024 |
| 960 | affiliatemarketingtipsfree.com | GoDaddy.com, LLC | 19 Jan 2016 | 19 Jan 2016 | 19 Jan 2018 |
| 961 | affiliatemarketingpro.club | NameCheap, Inc. | 13 Dec 2019 | 13 Dec 2019 | 13 Dec 2020 |
| 962 | affiliatemarketingiq.com | Namesilo, LLC | 2 Jan 2021 | 5 Feb 2025 | 2 Jan 2025 |
| 963 | affiliatemarketingcheatsheet.com | NameCheap, Inc. | 21 Dec 2024 | 21 Dec 2025 | 21 Dec 2025 |
| 964 | affiliatemarketingweb.top | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Jan 2016 | 23 Jan 2016 | 23 Jan 2017 |
| 965 | affiliatemarketingsolutions.net | GoDaddy.com, LLC | 16 Aug 2021 | 16 Aug 2021 | 16 Aug 2022 |
| 966 | affiliatemarketingwiththeo.com | eNom, Inc. | 23 Jan 2016 | 23 Jan 2016 | 23 Jan 2017 |
| 967 | affiliatemarketingmatters.com | Netistrar Limited | 30 May 2023 | 11 Jul 2024 | 30 May 2024 |
| 968 | affiliatemarketinginception.com | GoDaddy.com, LLC | 24 Jan 2016 | 24 Jan 2016 | 24 Jan 2017 |
| 969 | affiliatemarketingsuper.com | eNom, Inc. | 25 Jan 2016 | 18 Feb 2017 | 25 Jan 2018 |
| 970 | affiliatemarketingcommissions.com | eNom, Inc. | 21 Jan 2020 | 27 Jan 2025 | 21 Jan 2026 |
| 971 | affiliatemarketingforbeginners.info | NameCheap, Inc. | 16 May 2022 | 27 Jun 2025 | 16 May 2025 |
| 972 | affiliatemarketingresourcecentral.com | NameCheap, Inc. | 21 Jan 2019 | 21 Jan 2019 | 21 Jan 2020 |
| 973 | affiliatemarketingproductreviews.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Oct 2021 | 1 Oct 2021 | 1 Oct 2022 |
| 974 | affiliatemarketingforwomen.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 1 Feb 2016 | 1 Feb 2016 | 1 Feb 2017 |
| 975 | affiliatemarketing2016.com | eNom, Inc. | 3 Feb 2016 | 3 Feb 2016 | 3 Feb 2017 |
| 976 | affiliatemarketingsecrets.info | NameCheap, Inc. | 9 Feb 2020 | 9 Apr 2020 | 9 Feb 2021 |
| 977 | affiliatemarketingprogramsreviews.com | eNom, Inc. | 4 Feb 2016 | 5 Feb 2016 | 4 Feb 2017 |
| 978 | affiliatemarketingmoneysecrets.com | Wild West Domains, LLC | 5 Feb 2016 | 5 Feb 2016 | 5 Feb 2018 |
| 979 | affiliatemarketingstrategyguide.com | GoDaddy.com, LLC | 7 Feb 2016 | 7 Feb 2016 | 7 Feb 2017 |
| 980 | affiliatemarketingstrategyexamples.com | GoDaddy.com, LLC | 7 Feb 2016 | 7 Feb 2016 | 7 Feb 2017 |
| 981 | affiliatemarketingstrategiestipsandtools.com | GoDaddy.com, LLC | 7 Feb 2016 | 7 Feb 2016 | 7 Feb 2017 |
| 982 | affiliatemarketingprogramsfordummies.com | GoDaddy.com, LLC | 7 Feb 2016 | 7 Feb 2016 | 7 Feb 2017 |
| 983 | affiliatemarketingguidepdf.com | GoDaddy.com, LLC | 7 Feb 2016 | 7 Feb 2016 | 7 Feb 2017 |
| 984 | affiliatemarketingsecrets.net | NameCheap, Inc. | 13 Oct 2024 | 13 Sep 2025 | 13 Oct 2026 |
| 985 | affiliatemarketingonlineprogram.org | eNom, Inc. | 7 Feb 2016 | 7 Feb 2016 | 7 Feb 2017 |
| 986 | affiliatemarketingunleashed.com | Tucows Domains Inc. | 8 Apr 2024 | 10 Mar 2025 | 8 Apr 2026 |
| 987 | affiliatemarketingqueens.com | Squarespace Domains LLC | 5 Jan 2024 | 16 Feb 2025 | 5 Jan 2025 |
| 988 | affiliatemarketingqueen.com | Wild West Domains, LLC | 16 Apr 2023 | 27 May 2025 | 16 Apr 2025 |
| 989 | affiliatemarketingdepot.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Aug 2022 | 20 Aug 2024 | 19 Aug 2025 |
| 990 | affiliatemarketing4newbies.org | Global Domains International, Inc. DBA DomainCostC… | 2 Mar 2012 | 10 Apr 2025 | 2 Mar 2025 |
| 991 | affiliatemarketingprogramshq.com | eNom, Inc. | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2017 |
| 992 | affiliatemarketingprogramsheadquarters.com | eNom, Inc. | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2017 |
| 993 | affiliatemarketingfortune.com | NameCheap, Inc. | 13 Sep 2021 | 25 Oct 2025 | 13 Sep 2025 |
| 994 | affiliatemarketingpayraise.com | Wild West Domains, LLC | 16 Feb 2016 | 25 Jan 2025 | 16 Feb 2026 |
| 995 | affiliatemarketingfastcash.com | GoDaddy.com, LLC | 17 Feb 2016 | 17 Feb 2016 | 17 Feb 2017 |
| 996 | affiliatemarketingtools.info | register.com, Inc. | 10 Jun 2023 | 10 Jun 2023 | 10 Jun 2024 |
| 997 | affiliatemarketingbuzz.info | GoDaddy.com, LLC | 17 Feb 2016 | 17 Feb 2016 | 17 Feb 2017 |
| 998 | affiliatemarketingtools.online | GoDaddy.com, LLC | 17 Feb 2016 | 17 Feb 2016 | 17 Feb 2017 |
| 999 | affiliatemarketingsuccess.club | Domain.com, LLC | 14 Apr 2020 | - | 14 Apr 2021 |
| 1000 | affiliatemarketingmastermind.net | Beijing Lanhai Jiye Technology Co., Ltd | 6 May 2024 | 24 Nov 2025 | 6 May 2026 |
Displaying 1,000 out of 4,603 domains starting with the keyword "AFFILIATEMARKETING". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=affiliatemarketing
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |