With support for 
Keyword: ACWA
Reverse Whois » KEYWORD [acwa ] { 1,030 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | acwa.com | Network Solutions, LLC | 7 May 2002 | 8 Mar 2023 | 7 May 2028 |
| 2 | acwa.org | Network Solutions, LLC | 7 Apr 1996 | 3 Feb 2025 | 8 Apr 2027 |
| 3 | acwa.info | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Sep 2018 | 24 Sep 2025 | 26 Sep 2026 |
| 4 | acwa.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Feb 2025 | 1 Mar 2025 | 13 Feb 2026 |
| 5 | acwa.holdings | GoDaddy.com, LLC | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 6 | acwa.party | Alpnames Limited | 24 May 2015 | - | 23 May 2016 |
| 7 | acwa.top | Namesilo, LLC | 29 Jun 2025 | 29 Jun 2025 | 29 Jun 2026 |
| 8 | acwa.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Feb 2016 | - | 28 Feb 2017 |
| 9 | acwa.biz | Synergy Wholesale Pty Ltd | 29 Sep 2004 | 23 Oct 2025 | 28 Sep 2026 |
| 10 | acwa.net | GoDaddy.com, LLC | 8 Jan 2021 | 5 Dec 2025 | 8 Jan 2027 |
| 11 | acwa.win | Chengdu West Dimension Digital Technology Co., Ltd… | 5 Nov 2016 | 8 Apr 2017 | 4 Nov 2017 |
| 12 | acwa.co.uk | - | 14 Dec 2000 | 8 Aug 2024 | 14 Dec 2031 |
| 13 | acwa.online | Network Solutions, LLC | 17 May 2022 | 23 Mar 2025 | 17 May 2026 |
| 14 | acwa.men | West263 International Limited | 20 May 2018 | 20 May 2018 | 20 May 2019 |
| 15 | acwa.quest | Porkbun, LLC | 1 Aug 2021 | 1 Aug 2021 | 1 Aug 2022 |
| 16 | acwa.digital | Tucows Domains Inc. | 20 Dec 2022 | 29 Feb 2024 | 20 Dec 2023 |
| 17 | acwa.ac | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 12 Feb 2007 | 7 Sep 2025 | 12 Feb 2026 |
| 18 | acwa.tech | GoDaddy.com, LLC | 22 Sep 2025 | 23 Oct 2025 | 22 Sep 2028 |
| 19 | acwa.app | eNom, Inc. | 11 Feb 2021 | 8 Oct 2025 | - |
| 20 | acwa.asn.au | - | - | 2 Jun 2024 | - |
| 21 | acwa.com.au | - | - | 13 Nov 2025 | - |
| 22 | acwa.org.au | - | - | 22 Nov 2025 | - |
| 23 | acwa.ae | - | - | - | - |
| 24 | acwa.net.au | - | - | 22 Nov 2025 | - |
| 25 | acwa.ca | - | 21 Feb 2019 | 3 Apr 2025 | 21 Feb 2025 |
| 26 | acwa.nl | - | 12 Mar 2023 | 24 Apr 2023 | - |
| 27 | acwa.site | GoDaddy.com, LLC | 22 Sep 2025 | 23 Oct 2025 | 22 Sep 2028 |
| 28 | acwa.club | NameCheap, Inc. | 9 Apr 2023 | 24 Apr 2025 | 9 Apr 2025 |
| 29 | acwa.in | - | 23 Aug 2022 | 3 Sep 2024 | 23 Aug 2026 |
| 30 | acwa.pl | Namware.com, Inc. | 16 Oct 2025 | 21 Oct 2025 | 16 Oct 2026 |
| 31 | acwa.energy | One.com A/S | 4 Feb 2024 | 2 Feb 2025 | 4 Feb 2026 |
| 32 | acwa.ru | - | 20 Apr 2010 | - | 20 Apr 2026 |
| 33 | acwa.de | - | - | 19 Mar 2007 | - |
| 34 | acwa.cn | ???????????? | 4 Jul 2025 | - | 4 Jul 2026 |
| 35 | acwa.se | - | 25 Aug 2004 | 11 Aug 2025 | 25 Aug 2026 |
| 36 | acwa.news | NameCheap, Inc. | 22 Dec 2024 | - | - |
| 37 | acwa.global | GoDaddy.com, LLC | 11 Aug 2025 | 16 Aug 2025 | 11 Aug 2028 |
| 38 | acwa.asia | GoDaddy.com, LLC | 22 Sep 2025 | 27 Sep 2025 | 22 Sep 2028 |
| 39 | acwa.cloud | GoDaddy.com, LLC | 22 Sep 2025 | 27 Sep 2025 | 22 Sep 2028 |
| 40 | acwa.design | GoDaddy.com, LLC | 22 Sep 2025 | 21 Nov 2025 | 22 Sep 2028 |
| 41 | acwa.store | GoDaddy.com, LLC | 22 Sep 2025 | 23 Oct 2025 | 22 Sep 2027 |
| 42 | acwa.website | GoDaddy.com, LLC | 22 Sep 2025 | 23 Oct 2025 | 22 Sep 2028 |
| 43 | acwa.work | GoDaddy.com, LLC | 22 Sep 2025 | 21 Nov 2025 | 22 Sep 2028 |
| 44 | acwa.group | GoDaddy.com, LLC | 22 Sep 2025 | 27 Sep 2025 | 22 Sep 2028 |
| 45 | acwa.center | GoDaddy.com, LLC | 22 Sep 2025 | 27 Sep 2025 | 22 Sep 2028 |
| 46 | acwa.live | GoDaddy.com, LLC | 22 Sep 2025 | 27 Sep 2025 | 22 Sep 2028 |
| 47 | acwa.solutions | GoDaddy.com, LLC | 22 Sep 2025 | 27 Sep 2025 | 22 Sep 2028 |
| 48 | acwa.world | GoDaddy.com, LLC | 22 Sep 2025 | 27 Sep 2025 | 22 Sep 2028 |
| 49 | acwa.media | GoDaddy.com, LLC | 22 Sep 2025 | 27 Sep 2025 | 22 Sep 2028 |
| 50 | acwa.ltd | GoDaddy.com, LLC | 22 Sep 2025 | 27 Sep 2025 | 22 Sep 2028 |
| 51 | acwa.pro | Hostinger, UAB | 1 Dec 2025 | - | - |
| 52 | acwa.com.br | - | 2 Dec 2025 | 4 Dec 2025 | 2 Dec 2028 |
| 53 | acwatch.co | GMO Internet Inc. | 30 Aug 2014 | 26 Aug 2017 | 29 Aug 2018 |
| 54 | acwaad.com | Key-Systems GmbH | 2 Aug 2019 | 26 Nov 2025 | 2 Aug 2026 |
| 55 | acway.org | Mesh Digital Limited | 12 Dec 2014 | 13 Dec 2025 | 12 Dec 2026 |
| 56 | acwatch.com | TurnCommerce, Inc. DBA NameBright.com | 24 Oct 2014 | 18 Oct 2020 | 24 Oct 2026 |
| 57 | acwavz.com | GoDaddy.com, LLC | 5 Jun 2014 | 6 Jun 2015 | 5 Jun 2016 |
| 58 | acwaala.com | Google, Inc. | 2 Jan 2023 | 13 Feb 2025 | 2 Jan 2025 |
| 59 | acwashingmachines.com | Paknic (Private) Limited | 2 Aug 2022 | 3 Aug 2024 | 2 Aug 2025 |
| 60 | acwab222.com | GoDaddy.com, LLC | 7 Jun 2014 | 7 Jun 2015 | 7 Jun 2016 |
| 61 | acwaterford.com | Jiangsu Bangning Science and technology Co. Ltd. | 20 Nov 2019 | 20 Nov 2019 | 20 Nov 2020 |
| 62 | acwagear.com | Wild West Domains, LLC | 18 Jun 2013 | 19 Jun 2015 | 18 Jun 2016 |
| 63 | acwale.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 64 | acwaimai.com | eName Technology Co., Ltd. | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 65 | acwainfo.com | Instra Corporation Pty Ltd. | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 66 | acwallet.com | TurnCommerce, Inc. DBA NameBright.com | 2 Sep 2014 | 3 Nov 2025 | 2 Sep 2026 |
| 67 | acwanet.com | eNom, Inc. | 17 Apr 2020 | 10 Dec 2025 | 17 Apr 2026 |
| 68 | acwaammathy.com | GoDaddy.com, LLC | 14 Nov 2014 | 26 Nov 2016 | 14 Nov 2017 |
| 69 | acwadfz.com | GoDaddy.com, LLC | 8 Sep 2014 | 9 Sep 2014 | 8 Sep 2015 |
| 70 | acwalberta.com | GoDaddy.com, LLC | 10 Sep 2014 | 11 Sep 2024 | 10 Sep 2026 |
| 71 | acwar.com | PSI-USA, Inc. dba Domain Robot | 27 Apr 2018 | 16 Jun 2025 | 27 Apr 2026 |
| 72 | acwambrechies.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Dec 2021 | 25 Dec 2025 | 25 Dec 2025 |
| 73 | acwadventures.com | Tucows Domains Inc. | 25 Nov 2014 | 10 Nov 2025 | 25 Nov 2026 |
| 74 | acwaq.com | Network Solutions, LLC | 31 Oct 2016 | 2 Nov 2025 | 31 Oct 2026 |
| 75 | acwaholding.xyz | Network Solutions, LLC | 29 Jul 2014 | 29 Jul 2014 | 29 Jul 2015 |
| 76 | acwaq.red | GMO Internet Inc. | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 77 | acwaunrashdob.review | Alpnames Limited | 13 Aug 2015 | - | 12 Aug 2016 |
| 78 | acwatersport.com | Hosting Concepts B.V. dba Openprovider | 8 Jan 2015 | 21 Dec 2025 | 8 Jan 2027 |
| 79 | acwasteequipment.com | GoDaddy.com, LLC | 16 Jan 2015 | 4 Oct 2023 | 16 Jan 2029 |
| 80 | acwallcosmetics.com | GoDaddy.com, LLC | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 81 | acwalltransformers.com | eNom, Inc. | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 82 | acwalltransformer.com | eNom, Inc. | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 83 | acwah.com | CloudFlare, Inc. | 14 Jul 2023 | 14 Jun 2025 | 14 Jul 2026 |
| 84 | acwater.net | 1&1 Internet AG | 26 Feb 2015 | 27 Feb 2017 | 26 Feb 2018 |
| 85 | acwatches.com | Sksa Technology Co., Ltd | 3 Jun 2025 | 18 Sep 2025 | 3 Jun 2026 |
| 86 | acwaopzkn.us | - | 4 Mar 2015 | - | 3 Mar 2016 |
| 87 | acwa2010.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 88 | acwantiques.com | FastDomain Inc. | 12 Mar 2015 | 12 Mar 2017 | 12 Mar 2018 |
| 89 | acwaap.com | GoDaddy.com, LLC | 12 Mar 2015 | 8 Mar 2025 | 12 Mar 2026 |
| 90 | acwaartesia.com | eNom, Inc. | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 91 | acway.net | NameCheap, Inc. | 24 Nov 2018 | 24 Nov 2018 | 24 Nov 2019 |
| 92 | acwashingtondc.com | Name.com, Inc. | 10 Apr 2015 | 10 Mar 2025 | 10 Apr 2026 |
| 93 | acwatersystems.com | GoDaddy.com, LLC | 4 Sep 2015 | 4 Sep 2015 | 4 Sep 2016 |
| 94 | acwame.com | Webfusion Ltd. | 18 Apr 2015 | 18 Apr 2015 | 18 Apr 2017 |
| 95 | acwassociates.com | GoDaddy.com, LLC | 2 Aug 2017 | 3 Aug 2025 | 2 Aug 2027 |
| 96 | acwaterproofingnj.com | register.com, Inc. | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2017 |
| 97 | acwash.com | DropCatch.com 519 LLC | 22 Jan 2025 | 23 Jan 2025 | 22 Jan 2026 |
| 98 | acwanqiu.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 May 2015 | 9 May 2015 | 9 May 2016 |
| 99 | acwaguc.com | FBS Inc. | 17 May 2015 | 29 Jun 2025 | 17 May 2025 |
| 100 | acwapovver.com | NameCheap, Inc. | 15 Aug 2022 | 27 Sep 2023 | 15 Aug 2023 |
| 101 | acwatkins.com | Beijing Lanhai Jiye Technology Co., Ltd | 13 Jul 2023 | 14 Aug 2024 | 13 Jul 2024 |
| 102 | acway8.com | HiChina Zhicheng Technology Limited | 23 May 2015 | 23 May 2015 | 23 May 2016 |
| 103 | acwaqz.com | Bizcn.com, Inc. | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 104 | acwac.com | HiChina Zhicheng Technology Limited | 31 May 2015 | 12 May 2024 | 31 May 2026 |
| 105 | acwarcondicionado.com | GoDaddy.com, LLC | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 106 | acwab.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Dec 2024 | 19 Nov 2025 | 16 Dec 2026 |
| 107 | acwapure.net | GoDaddy.com, LLC | 18 Sep 2015 | 18 Sep 2015 | 18 Sep 2017 |
| 108 | acwapure.com | DropCatch.com 1172 LLC | 30 Sep 2025 | 1 Oct 2025 | 30 Sep 2026 |
| 109 | acwapura.net | GoDaddy.com, LLC | 17 Sep 2015 | 17 Sep 2015 | 17 Sep 2016 |
| 110 | acwapura.com | DropCatch.com 993 LLC | 5 Dec 2017 | 5 Dec 2017 | 5 Dec 2018 |
| 111 | acwaltower.com | GoDaddy.com, LLC | 17 May 2014 | 29 Jul 2025 | 17 May 2025 |
| 112 | acwa6.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jul 2015 | 8 Jul 2015 | 8 Jul 2016 |
| 113 | acwaterpark.com | GoDaddy.com, LLC | 13 Jul 2015 | 20 Apr 2024 | 7 Apr 2025 |
| 114 | acwado.org | TLD Registrar Solutions Ltd. | 3 Aug 2015 | 3 Aug 2015 | 3 Aug 2016 |
| 115 | acwautoagent.com | Melbourne IT, Ltd | 8 Aug 2015 | 26 Jun 2017 | 8 Aug 2017 |
| 116 | acwaz.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 1 Jan 2026 | 1 Jan 2026 | 1 Jan 2027 |
| 117 | acwapi.net | GoDaddy.com, LLC | 16 Oct 2015 | 16 Oct 2015 | 16 Oct 2016 |
| 118 | acwater-nov.com | Network Solutions, LLC | 26 Oct 2015 | 25 Jan 2017 | 26 Oct 2017 |
| 119 | acwab.info | West263 International Limited | 27 Oct 2015 | - | 27 Oct 2016 |
| 120 | acwaterhealth.com | GoDaddy.com, LLC | 6 Nov 2015 | 6 Nov 2015 | 6 Nov 2016 |
| 121 | acwassociatesinc.com | GoDaddy.com, LLC | 5 Nov 2015 | 5 Nov 2015 | 5 Nov 2016 |
| 122 | acwaumbaland.com | Tucows Domains Inc. | 17 Nov 2015 | 2 Nov 2025 | 17 Nov 2026 |
| 123 | acwae.racing | Xiamen Nawang Technology Co., Ltd | 2 Dec 2015 | 6 Dec 2016 | 1 Dec 2016 |
| 124 | acwair.info | Network Solutions, LLC | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 125 | acwac.top | Alpnames Limited | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 126 | acwant.com | Squarespace Domains LLC | 31 Oct 2023 | 31 Dec 2024 | 31 Oct 2024 |
| 127 | acwak.link | Alpnames Limited | 25 Jan 2016 | 7 Mar 2017 | 25 Jan 2017 |
| 128 | acwastewatcher.com | NameCheap, Inc. | 25 Nov 2024 | 26 Nov 2025 | 25 Nov 2026 |
| 129 | acwangluo.com | - | 20 Jul 2024 | 11 Dec 2025 | 20 Jul 2026 |
| 130 | acwarren.info | Network Solutions, LLC | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2017 |
| 131 | acwawa.com | GoDaddy.com, LLC | 6 May 2019 | 6 May 2019 | 6 May 2020 |
| 132 | acwarehouse.com | GoDaddy.com, LLC | 30 Jun 2003 | 30 Sep 2025 | 30 Jun 2028 |
| 133 | acwalaindia.com | GoDaddy.com, LLC | 2 Mar 2016 | 2 Mar 2016 | 2 Mar 2017 |
| 134 | acwavt.xyz | GMO Internet Inc. | 5 Mar 2016 | 5 Mar 2016 | 5 Mar 2017 |
| 135 | acwamusic.com | Webfusion Ltd. | 6 Mar 2016 | 7 Jul 2016 | 6 Mar 2018 |
| 136 | acwarner.com | Tucows Domains Inc. | 18 Nov 2022 | 16 Nov 2025 | 18 Nov 2026 |
| 137 | acwaltersconsulting.org | Wild West Domains, LLC | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 138 | acwaterdamagerepair.com | GoDaddy.com, LLC | 21 Mar 2016 | 21 Mar 2016 | 21 Mar 2017 |
| 139 | acwap-helium.com | register.com, Inc. | 30 Mar 2016 | 30 Mar 2016 | 30 Mar 2019 |
| 140 | acwaap-jgc.com | register.com, Inc. | 30 Mar 2016 | 30 Mar 2016 | 30 Mar 2019 |
| 141 | acwaap-jgpc.com | register.com, Inc. | 3 Apr 2016 | 3 Apr 2016 | 3 Apr 2019 |
| 142 | acwaap-helium.com | Key-Systems GmbH | 11 Jul 2021 | 12 Jul 2021 | 11 Jul 2022 |
| 143 | acwarehouse1.com | GoDaddy.com, LLC | 26 Jan 2015 | 22 Jan 2023 | 26 Jan 2028 |
| 144 | acwafishing.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 12 Apr 2016 | 9 Jul 2025 | 12 Apr 2026 |
| 145 | acwaiter.com | HiChina Zhicheng Technology Limited | 14 Apr 2016 | 25 Sep 2024 | 14 Apr 2027 |
| 146 | acwa4kids.com | Tucows Domains Inc. | 27 Apr 2016 | 1 May 2019 | 27 Apr 2019 |
| 147 | acwardart.com | Tucows Domains Inc. | 20 May 2016 | 24 May 2017 | 20 May 2017 |
| 148 | acwa-alaska.org | Network Solutions, LLC | 25 May 2016 | 7 Jul 2025 | 25 May 2030 |
| 149 | acwatsonauthor.com | Network Solutions, LLC | 26 Mar 2019 | 24 Feb 2025 | 26 Mar 2027 |
| 150 | acward.com | CloudFlare, Inc. | 12 Feb 2025 | 19 Feb 2025 | 12 Feb 2028 |
| 151 | acwa-dz.com | Dynadot, LLC | 5 Jun 2016 | 5 Jun 2016 | 5 Jun 2017 |
| 152 | acwaholding.info | Network Solutions, LLC | 10 Jun 2016 | 7 May 2024 | 10 Jun 2027 |
| 153 | acwahana.com | Hostinger, UAB | 3 Jun 2014 | 22 Sep 2025 | 3 Jun 2027 |
| 154 | acwaterjet.com | GoDaddy.com, LLC | 13 Jul 2004 | 28 Jul 2025 | 27 Jul 2026 |
| 155 | acwallpapers.xyz | - | 29 Jun 2016 | 29 Jun 2016 | 29 Jun 2017 |
| 156 | acwallpaper.xyz | - | 29 Jun 2016 | 29 Jun 2016 | 29 Jun 2017 |
| 157 | acwanna.com | Realtime Register B.V. | 11 Nov 2022 | 25 Dec 2023 | 11 Nov 2023 |
| 158 | acwa9-db5a.click | GMO Internet Inc. | 6 Jul 2016 | 16 Aug 2017 | 6 Jul 2017 |
| 159 | acwaj.top | Alpnames Limited | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 160 | acwarehousehawaii.biz | eNom, Inc. | 11 Feb 2014 | 12 Mar 2017 | 10 Feb 2018 |
| 161 | acwador.biz | NetArt Registrar Sp. z o.o. | 14 Feb 2013 | 5 Mar 2017 | 13 Feb 2018 |
| 162 | acwax.biz | MarkMonitor Inc. | 17 Nov 2001 | 19 Nov 2025 | 18 Nov 2027 |
| 163 | acware.biz | Name.com, Inc. | 24 Jul 2013 | 5 Sep 2025 | 23 Jul 2025 |
| 164 | acwam.biz | Tucows Domains Inc. | 5 Jun 2014 | 15 Jul 2016 | 4 Jun 2016 |
| 165 | acware.site | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Jul 2016 | 31 Aug 2023 | 19 Jul 2026 |
| 166 | acware.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Jul 2016 | 3 Apr 2018 | 19 Jul 2026 |
| 167 | acwakasa.com | Interlink Co., Ltd. | 10 Apr 2007 | 25 Nov 2025 | 10 Apr 2026 |
| 168 | acwalliance.com | CloudFlare, Inc. | 9 Aug 2011 | 9 Jul 2025 | 9 Aug 2026 |
| 169 | acwaonline.com | 1&1 Internet AG | 4 Dec 2013 | 5 Dec 2016 | 4 Dec 2017 |
| 170 | acwatechco.com | GoDaddy.com, LLC | 31 Jan 2014 | 1 Feb 2016 | 31 Jan 2017 |
| 171 | acwaterpump.com | Beijing Lanhai Jiye Technology Co., Ltd | 15 Mar 2022 | 16 May 2024 | 15 Mar 2024 |
| 172 | acwadevelopment.com | Network Solutions, LLC | 25 Mar 2008 | 5 Mar 2017 | 25 Mar 2019 |
| 173 | acwair.com | Network Solutions, LLC | 27 Oct 2011 | 5 Mar 2017 | 27 Oct 2021 |
| 174 | acwaterworks.com | GoDaddy.com, LLC | 20 Feb 2024 | 21 Feb 2025 | 20 Feb 2026 |
| 175 | acwarehousemi.com | GoDaddy.com, LLC | 5 Jan 2025 | 13 Dec 2025 | 5 Jan 2027 |
| 176 | acwaterproofing.com | TurnCommerce, Inc. DBA NameBright.com | 28 Jan 2020 | 22 Jan 2021 | 28 Jan 2026 |
| 177 | acwasia.com | Domain.com, LLC | 9 Jan 2002 | 9 Jul 2025 | 9 Jan 2026 |
| 178 | acwalla.com | Hostinger, UAB | 30 Oct 2023 | 30 Oct 2023 | 30 Oct 2026 |
| 179 | acwa-service.com | Corehub, S.R.L. | 6 Oct 2009 | 6 Oct 2024 | 6 Oct 2026 |
| 180 | acwal.com | GoDaddy.com, LLC | 19 Sep 2005 | 31 Oct 2024 | 19 Sep 2024 |
| 181 | acwave.com | GoDaddy.com, LLC | 15 Aug 2012 | 15 Aug 2025 | 15 Aug 2026 |
| 182 | acwaprowrestling.com | NameSecure L.L.C. | 8 Jul 2011 | 9 Jul 2016 | 8 Jul 2017 |
| 183 | acwaclear.com | 1&1 Internet AG | 12 Mar 2010 | 13 Mar 2025 | 12 Mar 2026 |
| 184 | acwarquitectura.com | Network Solutions, LLC | 12 Jan 2024 | 23 Feb 2025 | 12 Jan 2025 |
| 185 | acwap.com | GoDaddy.com, LLC | 9 Feb 2002 | 10 Feb 2025 | 9 Feb 2026 |
| 186 | acwaechter.com | Wild West Domains, LLC | 11 Jan 2014 | 12 Jan 2015 | 11 Jan 2017 |
| 187 | acwador.com | Key-Systems GmbH | 30 Oct 2024 | 26 Nov 2025 | 30 Oct 2026 |
| 188 | acwaves.com | GoDaddy.com, LLC | 2 Feb 2007 | 13 Jan 2025 | 2 Feb 2026 |
| 189 | acwapi.com | DropCatch.com 934 LLC | 7 Oct 2018 | 7 Oct 2018 | 7 Oct 2019 |
| 190 | acwaltz.com | GoDaddy.com, LLC | 2 Mar 2010 | 2 Mar 2025 | 2 Mar 2027 |
| 191 | acwaconsult.com | FastDomain Inc. | 12 Mar 2020 | 25 Feb 2025 | 12 Mar 2026 |
| 192 | acwalaska.com | GoDaddy.com, LLC | 30 Apr 2014 | 29 Apr 2015 | 30 Apr 2017 |
| 193 | acwallcovering.com | Melbourne IT, Ltd | 24 Jul 2007 | 20 Jul 2025 | 24 Jul 2026 |
| 194 | acwapowerinternational.com | register.com, Inc. | 15 Jul 2008 | 15 Jul 2008 | 15 Jul 2016 |
| 195 | acwaring.com | GoDaddy.com, LLC | 30 Nov 1998 | 30 Nov 2025 | 29 Nov 2026 |
| 196 | acwahq.com | Network Solutions, LLC | 15 Mar 1999 | 28 Jan 2015 | 15 Mar 2017 |
| 197 | acwaco.com | GoDaddy.com, LLC | 22 Sep 2025 | 22 Sep 2025 | 22 Sep 2028 |
| 198 | acwainternational.com | Realtime Register B.V. | 24 Nov 2022 | 8 Dec 2023 | 24 Nov 2023 |
| 199 | acwarren.com | DOMAIN NAME NETWORK PTY LTD | 7 Oct 2024 | 19 Nov 2025 | 7 Oct 2025 |
| 200 | acwaymedia.com | HiChina Zhicheng Technology Limited | 25 Jul 2013 | 28 Aug 2017 | 25 Jul 2020 |
| 201 | acwapowercloud.com | eNom, Inc. | 15 Mar 2013 | 14 Feb 2017 | 15 Mar 2018 |
| 202 | acwatec.com | GoDaddy.com, LLC | 1 Feb 2014 | 1 Feb 2025 | 1 Feb 2026 |
| 203 | acwax.com | MarkMonitor Inc. | 8 Feb 2000 | 19 Nov 2025 | 8 Feb 2027 |
| 204 | acwacombatives.com | Tucows Domains Inc. | 3 Sep 2009 | 19 Aug 2025 | 3 Sep 2026 |
| 205 | acwapower-international.com | register.com, Inc. | 15 Jul 2008 | 15 Jul 2008 | 15 Jul 2016 |
| 206 | acwarneke.com | Wild West Domains, LLC | 4 Apr 2012 | 4 Mar 2025 | 4 Apr 2026 |
| 207 | acwatactical.com | Tucows Domains Inc. | 27 Mar 2013 | 31 Mar 2024 | 27 Mar 2025 |
| 208 | acwaholding.com | Network Solutions, LLC | 29 Jul 2008 | 7 May 2024 | 29 Jul 2027 |
| 209 | acwallace.com | GoDaddy.com, LLC | 27 Jul 2012 | 28 Jul 2025 | 27 Jul 2026 |
| 210 | acwasavannah.com | GoDaddy.com, LLC | 13 Jun 2013 | 14 Jun 2016 | 13 Jun 2017 |
| 211 | acwakahnawake.com | Misk.com, Inc. | 29 Jul 2013 | 29 Jul 2013 | 29 Jul 2016 |
| 212 | acwadallas.com | DreamHost, LLC | 25 Apr 2011 | 8 Jul 2024 | 25 Apr 2024 |
| 213 | acwadev.com | Beijing Lanhai Jiye Technology Co., Ltd | 13 Jun 2019 | 14 Jun 2023 | 13 Jun 2024 |
| 214 | acwartillery.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 28 Aug 2021 | 28 Aug 2021 | 28 Aug 2022 |
| 215 | acwatt.com | Key-Systems GmbH | 22 Dec 2016 | 26 Nov 2025 | 22 Dec 2032 |
| 216 | acwaautomatics.com | Network Solutions, LLC | 1 Aug 2003 | 2 Aug 2025 | 1 Aug 2026 |
| 217 | acwaairproducts.com | Network Solutions, LLC | 15 Oct 2012 | 23 Jul 2023 | 15 Oct 2026 |
| 218 | acwagner.com | GoDaddy.com, LLC | 30 May 2007 | 1 May 2025 | 30 May 2026 |
| 219 | acwarrior.com | GoDaddy.com, LLC | 8 Apr 2010 | 2 Apr 2018 | 8 Apr 2019 |
| 220 | acwa-invest.com | united-domains AG | 11 Dec 2006 | 23 Nov 2025 | 11 Dec 2026 |
| 221 | acwaterdistrict.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Jun 2017 | 18 Jan 2018 | 19 Jun 2018 |
| 222 | acwaircargoconference.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Aug 2017 | 23 Aug 2017 | 23 Aug 2018 |
| 223 | acwarehousehawaii.com | DropCatch.com 1240 LLC | 13 Sep 2025 | 13 Sep 2025 | 13 Sep 2026 |
| 224 | acwale.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Jun 2009 | 7 Jul 2025 | 30 Jun 2026 |
| 225 | acwatson.com | GoDaddy.com, LLC | 19 Jan 2006 | 20 Jan 2026 | 19 Jan 2028 |
| 226 | acwacleanerworld.com | eNom, Inc. | 18 Dec 2011 | 11 Dec 2025 | 18 Dec 2026 |
| 227 | acwam.com | TurnCommerce, Inc. DBA NameBright.com | 13 Feb 2021 | 27 Aug 2021 | 13 Feb 2026 |
| 228 | acwalkerelectric.com | Tucows Domains Inc. | 26 Jul 2005 | 27 Jul 2024 | 26 Jul 2025 |
| 229 | acwasasakura.com | GoDaddy.com, LLC | 25 May 2025 | 26 May 2025 | 25 May 2026 |
| 230 | acwabc.com | eNom, Inc. | 20 Jul 2012 | 21 Jul 2016 | 20 Jul 2016 |
| 231 | acwarehousedirect.com | GoDaddy.com, LLC | 1 Feb 2025 | 1 Feb 2025 | 1 Feb 2026 |
| 232 | acwapowerprojects.com | GMO Internet Inc. | 18 May 2018 | 17 Apr 2025 | 17 May 2026 |
| 233 | acwais.com | Web Commerce Communications Limited dba WebNic.cc | 11 Sep 2025 | 11 Sep 2025 | 11 Sep 2026 |
| 234 | acwatchdog.com | - | 19 Jul 2023 | 20 Sep 2024 | 19 Jul 2024 |
| 235 | acwatersupplies.com | - | 15 Sep 2016 | 15 Sep 2016 | 15 Sep 2017 |
| 236 | acwassets.com | OnlineNIC, Inc. | 5 Aug 2019 | 6 Aug 2019 | 5 Aug 2020 |
| 237 | acwad.com | eNom, Inc. | 7 Mar 2008 | 12 Jan 2026 | 7 Mar 2027 |
| 238 | acwatts.com | DropCatch.com 1114 LLC | 3 Mar 2024 | 4 Mar 2024 | 3 Mar 2026 |
| 239 | acwapipe.com | Network Solutions, LLC | 6 May 2009 | 24 May 2023 | 6 May 2026 |
| 240 | acware.com | GoDaddy.com, LLC | 1 May 2013 | 12 Jun 2025 | 1 May 2026 |
| 241 | acwaterheaterboise.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 3 Jan 2023 | 10 Feb 2024 | 3 Jan 2024 |
| 242 | acwala.com | TurnCommerce, Inc. DBA NameBright.com | 11 Dec 2013 | 26 Aug 2021 | 11 Dec 2025 |
| 243 | acwatersports.com | GoDaddy.com, LLC | 3 Aug 2014 | 26 Sep 2025 | 3 Aug 2028 |
| 244 | acwan.com | DomainSite, Inc. | 12 Nov 2003 | 6 Dec 2025 | 12 Nov 2026 |
| 245 | acwallsaz.com | GoDaddy.com, LLC | 13 Jun 2014 | 22 Jun 2016 | 13 Jun 2017 |
| 246 | acwaterleak.com | FastDomain Inc. | 25 Oct 2008 | 25 Oct 2016 | 25 Oct 2017 |
| 247 | acwapowerint.com | GoDaddy.com, LLC | 18 May 2018 | 11 Sep 2025 | 18 May 2026 |
| 248 | acwappraisal.com | Internet Domain Services BS Corp | 11 Aug 2025 | 25 Nov 2025 | 11 Aug 2026 |
| 249 | acwasolar.com | Hostinger, UAB | 11 Oct 2024 | 17 Sep 2025 | 11 Oct 2026 |
| 250 | acwaterpumps.com | NameKing.com Inc. | 4 Feb 2024 | 20 Mar 2025 | 4 Feb 2025 |
| 251 | acwarbysjobs.com | NameCheap, Inc. | 26 Jan 2015 | 20 Jan 2025 | 26 Jan 2027 |
| 252 | acwalkrollstroll.com | GoDaddy.com, LLC | 14 Jan 2013 | 15 Jan 2015 | 14 Jan 2017 |
| 253 | acwapower-int.com | register.com, Inc. | 15 Jul 2008 | 15 Jul 2008 | 15 Jul 2016 |
| 254 | acway.com | GoDaddy.com, LLC | 9 Mar 2004 | 10 Nov 2025 | 9 Mar 2026 |
| 255 | acwafw.com | DropCatch.com 1514 LLC | 22 Oct 2019 | 22 Oct 2019 | 22 Oct 2020 |
| 256 | acwalker.com | Easyspace LTD | 17 Jul 2006 | 17 Jun 2025 | 17 Jul 2027 |
| 257 | acwagroup.com | - | 12 Sep 2025 | 17 Nov 2025 | 12 Sep 2026 |
| 258 | acwalls.com | Network Solutions, LLC | 30 Oct 2024 | 15 Oct 2025 | 30 Oct 2026 |
| 259 | acwaterspainting.com | GoDaddy.com, LLC | 2 Nov 2018 | 2 Nov 2018 | 2 Nov 2019 |
| 260 | acwarranty.com | GoDaddy.com, LLC | 13 Oct 2008 | 26 Nov 2025 | 13 Oct 2026 |
| 261 | acwasesorias.com | GoDaddy.com, LLC | 30 Apr 2014 | 1 May 2016 | 30 Apr 2017 |
| 262 | acwacombativeseast.com | GoDaddy.com, LLC | 5 Sep 2013 | 5 Sep 2015 | 5 Sep 2016 |
| 263 | acwain.com | Hetzner Online AG | 5 Aug 2001 | 25 Nov 2025 | 5 Aug 2026 |
| 264 | acwa-us.com | Tucows Domains Inc. | 1 Sep 2011 | 7 Jan 2022 | 1 Sep 2027 |
| 265 | acwapower.com | Network Solutions, LLC | 4 Jun 2003 | 4 Jun 2024 | 4 Jun 2034 |
| 266 | acwapowerdevelopment.com | Network Solutions, LLC | 25 Mar 2008 | 5 Mar 2017 | 25 Mar 2019 |
| 267 | acwajpia.com | Network Solutions, LLC | 24 Aug 1996 | 10 May 2017 | 23 Aug 2026 |
| 268 | acwales.com | Tucows Domains Inc. | 26 Apr 2013 | 30 Apr 2020 | 26 Apr 2020 |
| 269 | acwater.com | Uniregistrar Corp | 22 Dec 2002 | 22 Dec 2025 | 22 Dec 2026 |
| 270 | acwarehousehi.com | GoDaddy.com, LLC | 14 Oct 2003 | 20 Oct 2025 | 14 Oct 2030 |
| 271 | acwaterservice.com | GoDaddy.com, LLC | 8 Jun 2014 | 9 Jun 2025 | 8 Jun 2026 |
| 272 | acwaterdamage.com | Dynadot, LLC | 7 Sep 2022 | 17 Nov 2023 | 7 Sep 2023 |
| 273 | acwas.com | TurnCommerce, Inc. DBA NameBright.com | 9 Oct 2010 | 3 Nov 2025 | 9 Oct 2026 |
| 274 | acwaycross.com | Hongkong Domain Name Information Management Co., L… | 11 Oct 2022 | 21 Dec 2023 | 11 Oct 2023 |
| 275 | acwalk.com | OnlineNIC, Inc. | 7 Jun 2014 | 30 May 2017 | 7 Jun 2018 |
| 276 | acwaterdamagerestoration.com | GoDaddy.com, LLC | 19 Jul 2013 | 20 Jul 2019 | 19 Jul 2020 |
| 277 | acwang.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 31 Jul 2000 | 11 Dec 2025 | 31 Jul 2027 |
| 278 | acwatech.com | GoDaddy.com, LLC | 24 Jan 2013 | 25 Jan 2025 | 24 Jan 2026 |
| 279 | acwallunit.com | GoDaddy.com, LLC | 5 May 2020 | 1 May 2025 | 5 May 2026 |
| 280 | acwafortworth.com | Wild West Domains, LLC | 27 Sep 2010 | 1 Aug 2014 | 27 Sep 2016 |
| 281 | acwamericanproperties.com | GoDaddy.com, LLC | 14 Jun 2012 | 26 Jul 2024 | 14 Jun 2024 |
| 282 | acwarehouse.org | GoDaddy.com, LLC | 24 Jul 2016 | 4 Sep 2017 | 24 Jul 2018 |
| 283 | acware.store | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 24 Jul 2016 | 31 Aug 2023 | 24 Jul 2026 |
| 284 | acwa-consulting.com | Xin Net Technology Corporation | 10 Jun 2021 | 12 Feb 2022 | 10 Jun 2022 |
| 285 | acwa06.com | Namesilo, LLC | 4 Aug 2016 | 5 Aug 2025 | 4 Aug 2026 |
| 286 | acwaxed.top | Alpnames Limited | 3 Aug 2016 | 3 Aug 2016 | 3 Aug 2017 |
| 287 | acwai.com | Google, Inc. | 5 Mar 2025 | 21 Mar 2025 | 5 Mar 2026 |
| 288 | acwapawer.com | - | 6 Sep 2016 | 6 Sep 2016 | 6 Sep 2017 |
| 289 | acwarbys.com | - | 19 Sep 2016 | 19 Sep 2016 | 19 Sep 2017 |
| 290 | acwapowerr.com | NameCheap, Inc. | 27 Aug 2025 | 27 Aug 2025 | 27 Aug 2026 |
| 291 | acwa-service.de | - | - | 27 Aug 2014 | - |
| 292 | acwagency.com | NameCheap, Inc. | 29 Sep 2016 | 30 Aug 2025 | 29 Sep 2026 |
| 293 | acwasteservices.com | GoDaddy.com, LLC | 5 Oct 2016 | 4 Oct 2023 | 5 Oct 2029 |
| 294 | acwatts.info | GoDaddy.com, LLC | 26 Jan 2013 | 7 Feb 2015 | 26 Jan 2017 |
| 295 | acwagner.info | GoDaddy.com, LLC | 30 Dec 2010 | 5 Jan 2026 | 30 Dec 2028 |
| 296 | acwal.info | GoDaddy.com, LLC | 14 Sep 2010 | 25 Nov 2024 | 14 Sep 2024 |
| 297 | acwador.info | NetArt Registrar Sp. z o.o. | 14 Feb 2013 | 4 Feb 2020 | 14 Feb 2021 |
| 298 | acwain.info | NameCheap, Inc. | 5 Jul 2024 | 5 Jul 2025 | 5 Jul 2026 |
| 299 | acware.mobi | Name.com, Inc. | 19 May 2013 | 31 Jul 2025 | 19 May 2025 |
| 300 | acwaautomatics.net | GoDaddy.com, LLC | 22 Dec 2011 | 15 Dec 2014 | 22 Dec 2016 |
| 301 | acwan.net | DropCatch.com 1098 LLC | 23 Mar 2019 | 23 Mar 2019 | 23 Mar 2020 |
| 302 | acwarehousehawaii.net | Dynadot, LLC | 21 Jun 2022 | 1 Sep 2023 | 21 Jun 2023 |
| 303 | acwal.net | GoDaddy.com, LLC | 14 Sep 2010 | 26 Nov 2024 | 14 Sep 2024 |
| 304 | acwatts.net | GoDaddy.com, LLC | 26 Jan 2013 | 7 Feb 2015 | 26 Jan 2017 |
| 305 | acwaterjet.net | GoDaddy.com, LLC | 26 Jul 2012 | 28 Jul 2025 | 27 Jul 2030 |
| 306 | acwarehouse.net | eNom, Inc. | 23 Jan 2024 | 11 Jan 2026 | 23 Jan 2027 |
| 307 | acwaterproofing.net | Tucows Domains Inc. | 15 Oct 2012 | 19 Oct 2022 | 15 Oct 2022 |
| 308 | acwaholding.net | Network Solutions, LLC | 1 Feb 2012 | 5 Feb 2025 | 1 Feb 2026 |
| 309 | acwatch.net | Web Commerce Communications Limited dba WebNic.cc | 19 Aug 2013 | 21 Aug 2013 | 19 Aug 2016 |
| 310 | acware.net | Name.com, Inc. | 23 May 2014 | 5 Jul 2025 | 23 May 2025 |
| 311 | acwarranty.net | GoDaddy.com, LLC | 18 Jan 2005 | 19 Jan 2025 | 18 Jan 2027 |
| 312 | acwatic.net | Tucows Domains Inc. | 29 Dec 2007 | 2 Jan 2022 | 29 Dec 2021 |
| 313 | acwas.net | GoDaddy.com, LLC | 9 Oct 2010 | 10 Sep 2015 | 9 Oct 2017 |
| 314 | acwain.net | Hetzner Online AG | 5 Aug 2001 | 25 Nov 2025 | 5 Aug 2026 |
| 315 | acwapowerprojects.net | register.com, Inc. | 26 Feb 2008 | 26 Feb 2008 | 26 Feb 2018 |
| 316 | acwador.net | NetArt Registrar Sp. z o.o. | 14 Feb 2013 | 5 Mar 2017 | 14 Feb 2018 |
| 317 | acwatersports.net | GoDaddy.com, LLC | 3 Aug 2014 | 3 Aug 2016 | 3 Aug 2017 |
| 318 | acwala.net | NameCheap, Inc. | 24 Feb 2024 | 7 Apr 2025 | 24 Feb 2025 |
| 319 | acwallace.us | NameCheap, Inc. | 16 Oct 2016 | 16 Oct 2017 | 15 Oct 2017 |
| 320 | acwalkrollstroll.org | GoDaddy.com, LLC | 14 Jan 2013 | 15 Jan 2015 | 14 Jan 2017 |
| 321 | acwales.org | Tucows Domains Inc. | 26 Apr 2013 | 18 Apr 2017 | 26 Apr 2018 |
| 322 | acwador.org | NetArt Registrar Sp. z o.o. | 14 Feb 2013 | 18 Jan 2016 | 14 Feb 2017 |
| 323 | acware.org | Name.com, Inc. | 23 May 2013 | 5 Jul 2025 | 23 May 2025 |
| 324 | acwastewatcher.org | GoDaddy.com, LLC | 21 Apr 2003 | 5 Jun 2025 | 21 Apr 2026 |
| 325 | acwancestor.org | GoDaddy.com, LLC | 7 Jul 2025 | 12 Jul 2025 | 7 Jul 2035 |
| 326 | acwain.org | Vautron Rechenzentrum AG | 5 Aug 2001 | 19 Sep 2025 | 5 Aug 2026 |
| 327 | acwatts.org | GoDaddy.com, LLC | 26 Jan 2013 | 7 Feb 2015 | 26 Jan 2017 |
| 328 | acwa-rrws.org | Network Solutions, LLC | 18 Sep 2001 | 11 Aug 2025 | 18 Sep 2026 |
| 329 | acwal.org | GMO Internet Inc. | 22 May 2014 | 9 Mar 2017 | 22 May 2018 |
| 330 | acwamaryland.org | Tucows Domains Inc. | 28 Jul 2011 | 18 Jul 2025 | 28 Jul 2026 |
| 331 | acwater.org | GoDaddy.com, LLC | 22 Jun 2005 | 15 Feb 2025 | 22 Jun 2027 |
| 332 | acwa-us.org | Tucows Domains Inc. | 1 Sep 2011 | 7 Jan 2022 | 1 Sep 2027 |
| 333 | acwadam.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Mar 2004 | 14 May 2025 | 30 Mar 2026 |
| 334 | acwantwerpen.be | TLD Registrar Solutions Ltd. | 19 May 2017 | - | - |
| 335 | acwam.de | - | - | 17 Apr 2013 | - |
| 336 | acwaldorf.de | - | - | 27 Jun 2019 | - |
| 337 | acwain.de | - | - | 24 Jun 2010 | - |
| 338 | acwashingmachines.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 17 Jul 2015 | 10 Jul 2017 | 17 Jul 2018 |
| 339 | acwager.co.uk | - | 22 Sep 2001 | 18 Aug 2024 | 22 Sep 2027 |
| 340 | acwall.com | TurnCommerce, Inc. DBA NameBright.com | 16 Jun 2020 | 10 Jun 2021 | 16 Jun 2026 |
| 341 | acwajpie.com | Tucows Domains Inc. | 28 Nov 2016 | 2 Dec 2017 | 28 Nov 2017 |
| 342 | acwajp.com | GMO Internet Inc. | 29 Dec 2016 | 30 Dec 2017 | 29 Dec 2017 |
| 343 | acwaterproofing.org | GoDaddy.com, LLC | 3 Jan 2017 | 15 Jan 2018 | 3 Jan 2019 |
| 344 | acwatchblog.com | Xin Net Technology Corporation | 5 Jul 2019 | 16 Mar 2020 | 5 Jul 2020 |
| 345 | acwapowar.com | Tucows Domains Inc. | 13 Jan 2017 | 17 Jan 2018 | 13 Jan 2018 |
| 346 | acwapowerrenew.com | GoDaddy.com, LLC | 31 Jan 2017 | 31 Jan 2017 | 31 Jan 2018 |
| 347 | acwaladwarka.com | GoDaddy.com, LLC | 8 Feb 2017 | 8 Feb 2017 | 8 Feb 2018 |
| 348 | acwaiss.com | GoDaddy.com, LLC | 14 Feb 2017 | 14 Feb 2017 | 14 Feb 2018 |
| 349 | acwafcdse.click | GMO Internet Inc. | 19 Feb 2017 | 5 Sep 2017 | 19 Feb 2018 |
| 350 | acwaclothing.com | GoDaddy.com, LLC | 13 Mar 2017 | 13 Mar 2017 | 13 Mar 2018 |
| 351 | acwap0wer.com | 1&1 Internet AG | 14 Mar 2017 | 14 Mar 2017 | 14 Mar 2018 |
| 352 | acwapower-sa.com | 1&1 Internet AG | 16 Mar 2017 | 16 Mar 2017 | 16 Mar 2018 |
| 353 | acwas.accountant | Alpnames Limited | 15 Mar 2017 | - | 14 Mar 2018 |
| 354 | acwatchchina.com | DropCatch.com 392 LLC | 19 Aug 2022 | 1 Oct 2023 | 19 Aug 2023 |
| 355 | acwa-japan.com | eNom, Inc. | 22 Mar 2017 | 21 Feb 2025 | 22 Mar 2026 |
| 356 | acwapowergrovp.com | 1&1 Internet AG | 22 Mar 2017 | 22 Mar 2017 | 22 Mar 2018 |
| 357 | acwau-r.com | Ligne Web Services SARL | 10 Apr 2017 | 30 Jan 2018 | 10 Apr 2018 |
| 358 | acwadog.com | CSC Corporate Domains, Inc. | 11 Apr 2017 | 11 Apr 2017 | 11 Apr 2018 |
| 359 | acwapothecary.com | GoDaddy.com, LLC | 23 Apr 2017 | 23 Apr 2017 | 23 Apr 2019 |
| 360 | acwaakez.info | West263 International Limited | 27 Apr 2017 | 26 Jun 2017 | 27 Apr 2018 |
| 361 | acwavyy.com | Gandi SAS | 1 May 2017 | 1 May 2017 | 1 May 2018 |
| 362 | acwaterstudies.com | Tucows Domains Inc. | 22 May 2017 | 2 Aug 2023 | 22 May 2023 |
| 363 | acwaterstudies.org | Tucows Domains Inc. | 22 May 2017 | 1 Aug 2023 | 22 May 2023 |
| 364 | acwady.com | CloudFlare, Inc. | 4 Jun 2021 | 30 Nov 2024 | 4 Jun 2027 |
| 365 | acwatersolutions.com | NameCheap, Inc. | 2 Jun 2017 | 22 Jan 2018 | 2 Jun 2018 |
| 366 | acwapp.com | GoDaddy.com, LLC | 5 Aug 2023 | 17 Oct 2024 | 5 Aug 2024 |
| 367 | acwartists.com | GoDaddy.com, LLC | 28 Jun 2017 | 21 Oct 2025 | 28 Jun 2026 |
| 368 | acwatercraftrentals.com | Name.com, Inc. | 29 Jun 2017 | 29 Jun 2017 | 29 Jun 2018 |
| 369 | acwacademy.com | Tucows Domains Inc. | 20 Jul 2017 | 24 Jul 2023 | 20 Jul 2024 |
| 370 | acwanfs.org | HiChina Zhicheng Technology Limited | 23 Jul 2017 | - | 23 Jul 2018 |
| 371 | acwatchusa.com | Crazy Domains FZ-LLC | 24 Jul 2017 | 21 Jul 2025 | 24 Jul 2026 |
| 372 | acwade.com | GoDaddy.com, LLC | 22 Oct 2023 | 22 Oct 2023 | 22 Oct 2026 |
| 373 | acwalegal.com | Instra Corporation Pty Ltd. | 16 Aug 2017 | 16 Aug 2017 | 16 Aug 2019 |
| 374 | acwang.net | HiChina Zhicheng Technology Limited | 18 Aug 2017 | 18 Aug 2017 | 18 Aug 2018 |
| 375 | acwasc.info | HiChina Zhicheng Technology Limited | 31 Aug 2017 | 31 Aug 2017 | 31 Aug 2018 |
| 376 | acwarnes.com | - | 14 Mar 2024 | 15 Mar 2025 | 14 Mar 2026 |
| 377 | acwalaunique.com | DNSPod, Inc. | 15 Jun 2021 | 16 Jun 2021 | 15 Jun 2022 |
| 378 | acwadxx.info | HiChina Zhicheng Technology Limited | 29 Sep 2017 | 29 Sep 2017 | 29 Sep 2018 |
| 379 | acwa-cmr.org | NetEarth One Inc. d/b/a NetEarth | 2 Nov 2017 | 2 Nov 2017 | 2 Nov 2018 |
| 380 | acwarren.net | CloudFlare, Inc. | 18 Nov 2023 | 11 Dec 2025 | 18 Nov 2026 |
| 381 | acwautochem.com | 1&1 Internet AG | 18 Sep 2025 | 21 Oct 2025 | 18 Sep 2026 |
| 382 | acwa-rrws.com | Network Solutions, LLC | 13 Dec 2017 | 7 Oct 2025 | 13 Dec 2026 |
| 383 | acwayuc.com | 101domain, Inc. | 18 Dec 2017 | 18 Dec 2017 | 18 Dec 2018 |
| 384 | acwajpia.net | Network Solutions, LLC | 24 Dec 2017 | 24 Dec 2017 | 24 Dec 2018 |
| 385 | acwarg.info | HiChina Zhicheng Technology Limited | 30 Dec 2017 | 1 Jan 2018 | 30 Dec 2018 |
| 386 | acwaht.uk | - | 19 Oct 2017 | 19 Oct 2017 | 19 Oct 2019 |
| 387 | acwaspcontrol.uk | - | 1 Aug 2014 | 2 Jul 2023 | 1 Aug 2024 |
| 388 | acwauto.co.uk | - | 14 Apr 2014 | 14 Apr 2022 | 14 Apr 2024 |
| 389 | acwag.org.uk | Reserved | 22 Jun 2012 | 20 Dec 2017 | 22 Jun 2018 |
| 390 | acwaht.org.uk | - | 15 Apr 2004 | 27 Jun 2016 | 15 Apr 2018 |
| 391 | acwaccounting.co.uk | - | 13 Jan 2025 | 13 Feb 2025 | 13 Jan 2026 |
| 392 | acwaspcontrol.co.uk | - | 24 Feb 2011 | 2 May 2024 | 24 Feb 2025 |
| 393 | acwashingmachines.co.uk | - | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2019 |
| 394 | acwales.org.uk | - | 26 Apr 2013 | 19 Apr 2017 | 26 Apr 2018 |
| 395 | acwarborists.co.uk | One.com A/S | 18 Oct 2016 | 18 Sep 2017 | 18 Oct 2019 |
| 396 | acwarb.co.uk | - | 18 May 2011 | 11 Jun 2024 | 18 May 2026 |
| 397 | acwall.co.uk | Click Registrar, Inc. d/b/a publicdomainregistry.c… | 20 Jul 2010 | 23 Jun 2016 | 20 Jul 2018 |
| 398 | acwaterstudies.co.uk | - | 22 May 2017 | 22 May 2017 | 22 May 2018 |
| 399 | acwandsworth.org.uk | - | 6 Dec 2023 | 6 Nov 2024 | 6 Dec 2024 |
| 400 | acwatec.co.uk | - | 19 Aug 2015 | 5 Aug 2017 | 19 Aug 2019 |
| 401 | acwaste.co.uk | - | 4 Oct 2024 | 4 Oct 2024 | 4 Oct 2026 |
| 402 | acwarrington.org.uk | - | 30 Jun 2005 | 25 Jun 2025 | 30 Jun 2026 |
| 403 | acwasptreatments.co.uk | - | 18 Jun 2010 | 19 May 2023 | 18 Jun 2024 |
| 404 | acwaterra.co.uk | - | 11 Dec 2009 | 10 Dec 2025 | 11 Dec 2027 |
| 405 | acwatson.co.uk | - | 4 Jan 2006 | 3 Jan 2026 | 4 Jan 2028 |
| 406 | acwattsandson.co.uk | - | 8 Sep 2016 | 8 Sep 2024 | 8 Sep 2025 |
| 407 | acwaterproofing.co.uk | - | 15 Oct 2012 | 27 Feb 2017 | 15 Oct 2020 |
| 408 | acwalker.co.uk | - | 17 Jul 2006 | 4 Jul 2016 | 17 Jul 2018 |
| 409 | acwascotland.co.uk | - | 29 May 2013 | 30 May 2024 | 29 May 2024 |
| 410 | acwasolutions.com | NameCheap, Inc. | 6 Jun 2024 | 7 May 2025 | 6 Jun 2026 |
| 411 | acwatertank.com | HiChina Zhicheng Technology Limited | 12 Jan 2018 | 12 Jan 2018 | 12 Jan 2019 |
| 412 | acwalay.com | Hostinger, UAB | 8 May 2024 | 21 Jun 2025 | 8 May 2025 |
| 413 | acwaly.com | NameCheap, Inc. | 25 Apr 2021 | - | 25 Apr 2022 |
| 414 | acwaude.science | NameCheap, Inc. | 9 Feb 2018 | 9 Feb 2018 | 9 Feb 2019 |
| 415 | acwad.net | Namesilo, LLC | 12 Feb 2018 | 8 Feb 2025 | 12 Feb 2026 |
| 416 | acwallcraftswelcome.com | Dynadot, LLC | 23 Feb 2018 | 23 Feb 2018 | 23 Feb 2019 |
| 417 | acwauae.com | GoDaddy.com, LLC | 22 Sep 2025 | 22 Sep 2025 | 22 Sep 2028 |
| 418 | acwaenergy.com | URL Solutions, Inc. | 15 Mar 2018 | 15 Mar 2018 | 15 Mar 2019 |
| 419 | acwagk.loan | West263 International Limited | 23 Mar 2018 | - | 23 Mar 2019 |
| 420 | acwamg.loan | West263 International Limited | 23 Mar 2018 | - | 23 Mar 2019 |
| 421 | acwaid.loan | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 29 Mar 2018 | 11 Apr 2018 | 29 Mar 2019 |
| 422 | acwaiw.men | West263 International Limited | 17 Apr 2018 | 22 Apr 2018 | 17 Apr 2019 |
| 423 | acwalyng.com | Namesilo, LLC | 27 Apr 2018 | 28 Apr 2018 | 27 Apr 2019 |
| 424 | acwaos.men | West263 International Limited | 17 Apr 2018 | 22 Apr 2018 | 17 Apr 2019 |
| 425 | acwaycargo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 May 2018 | 14 May 2018 | 14 May 2019 |
| 426 | acwar.biz | HiChina Zhicheng Technology Limited | 15 May 2018 | 17 May 2018 | 15 May 2019 |
| 427 | acwahk.biz | HiChina Zhicheng Technology Limited | 17 May 2018 | 18 May 2018 | 17 May 2019 |
| 428 | acwanbo.com | Xin Net Technology Corporation | 23 May 2018 | 23 May 2018 | 23 May 2019 |
| 429 | acwarnerlit.com | Automattic Inc. | 31 May 2018 | 14 Jul 2025 | 31 May 2025 |
| 430 | acwaxco.com | GoDaddy.com, LLC | 10 Jun 2018 | 12 Jun 2024 | 10 Jun 2024 |
| 431 | acwarbyscareers.com | DNC Holdings, Inc. | 14 Jun 2018 | 14 Jun 2018 | 14 Jun 2019 |
| 432 | acwa-robotics.com | OVH sas | 18 Jun 2018 | 10 Jul 2024 | 18 Jun 2025 |
| 433 | acwanalytics.com | Epik Inc. | 19 Feb 2021 | 19 Feb 2021 | 19 Feb 2022 |
| 434 | acwalas.com | FindUAName.com LLC | 4 Sep 2022 | 10 Oct 2023 | 4 Sep 2024 |
| 435 | acwacuba.com | Network Solutions, LLC | 19 Jun 2018 | 19 Jun 2018 | 19 Jun 2019 |
| 436 | acwa-cuba.com | Network Solutions, LLC | 19 Jun 2018 | 19 Jun 2018 | 19 Jun 2019 |
| 437 | acwaidmf.loan | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 24 Jun 2018 | - | 24 Jun 2019 |
| 438 | acwattblocker.com | 1&1 Internet AG | 25 Jun 2018 | 25 Jun 2018 | 25 Jun 2019 |
| 439 | acwahoikaicher.com | Tucows Domains Inc. | 7 Jul 2018 | 11 Jul 2019 | 7 Jul 2019 |
| 440 | acwahoikai-cher.com | Tucows Domains Inc. | 7 Jul 2018 | 11 Jul 2019 | 7 Jul 2019 |
| 441 | acwahoikai-cher.net | Tucows Domains Inc. | 7 Jul 2018 | 11 Jul 2019 | 7 Jul 2019 |
| 442 | acwahoikaicher.net | Tucows Domains Inc. | 7 Jul 2018 | 11 Jul 2019 | 7 Jul 2019 |
| 443 | acwastremoval.com | Tucows Domains Inc. | 10 Jul 2018 | 14 Jul 2019 | 10 Jul 2019 |
| 444 | acwasteremoval.com | Google, Inc. | 15 Jun 2024 | 1 Jun 2025 | 15 Jun 2026 |
| 445 | acwaterbottle.com | GoDaddy.com, LLC | 24 Jul 2018 | 24 Jul 2018 | 24 Jul 2019 |
| 446 | acwaholdings.com | GoDaddy.com, LLC | 26 Jul 2018 | 26 Jul 2018 | 26 Jul 2020 |
| 447 | acwaglobal.com | GoDaddy.com, LLC | 20 Aug 2025 | 20 Aug 2025 | 20 Aug 2028 |
| 448 | acwawater.com | GoDaddy.com, LLC | 2 Oct 2024 | 2 Oct 2024 | 2 Oct 2027 |
| 449 | acwade.net | register.com, Inc. | 25 Jul 2018 | 25 Jul 2018 | 25 Jul 2019 |
| 450 | acwareus.com | NameCheap, Inc. | 28 Jul 2018 | 28 Jun 2025 | 28 Jul 2026 |
| 451 | acwave.info | Name.com, Inc. | 9 Jun 2024 | 9 Jun 2025 | 9 Jun 2026 |
| 452 | acwag.com | TurnCommerce, Inc. DBA NameBright.com | 15 Feb 2021 | 27 Aug 2021 | 15 Feb 2026 |
| 453 | acwangzhuan.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 Feb 2023 | 14 Mar 2024 | 11 Feb 2024 |
| 454 | acwae.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 1 Jan 2026 | 1 Jan 2026 | 1 Jan 2027 |
| 455 | acwawc.site | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Oct 2018 | 22 Oct 2018 | 22 Oct 2019 |
| 456 | acwaale.com | GoDaddy.com, LLC | 16 Feb 2023 | 30 Mar 2025 | 16 Feb 2025 |
| 457 | acwansor.com | Google, Inc. | 29 Oct 2018 | 29 Oct 2018 | 29 Oct 2019 |
| 458 | acwasandiego.com | GoDaddy.com, LLC | 30 Oct 2018 | 31 Oct 2024 | 30 Oct 2027 |
| 459 | acwawrestling.com | Wix.com Ltd. | 2 Sep 2022 | 3 Aug 2025 | 2 Sep 2026 |
| 460 | acwatic.com | Vautron Rechenzentrum AG | 10 Dec 2018 | 5 Dec 2025 | 10 Dec 2025 |
| 461 | acwatkinsentertainment.com | FastDomain Inc. | 12 Dec 2018 | 27 Nov 2025 | 12 Dec 2026 |
| 462 | acwattscpa.com | GoDaddy.com, LLC | 21 Dec 2018 | 21 Dec 2018 | 21 Dec 2020 |
| 463 | acwapower.net | GoDaddy.com, LLC | 4 Sep 2025 | 4 Sep 2025 | 4 Sep 2026 |
| 464 | acwahanaproject.com | Hostinger, UAB | 2 Jan 2019 | 2 Jan 2019 | 2 Jan 2020 |
| 465 | acwaselfdefenseplano.com | GoDaddy.com, LLC | 8 Jan 2019 | 8 Jan 2019 | 8 Jan 2020 |
| 466 | acwalkerphotography.com | Network Solutions, LLC | 20 Jan 2019 | 20 Jan 2019 | 20 Jan 2020 |
| 467 | acwangdesign.com | NameCheap, Inc. | 26 Jan 2019 | 26 Jan 2019 | 26 Jan 2020 |
| 468 | acwansa.com | Launchpad, Inc. | 6 Feb 2019 | 6 Feb 2019 | 6 Feb 2022 |
| 469 | acwavebrace.com | Dynadot, LLC | 7 Feb 2019 | 7 Feb 2019 | 7 Feb 2020 |
| 470 | acwauto.com | TurnCommerce, Inc. DBA NameBright.com | 17 May 2021 | 28 Jul 2025 | 17 May 2025 |
| 471 | acwance.com | NameCheap, Inc. | 1 Mar 2019 | 1 Mar 2019 | 1 Mar 2020 |
| 472 | acwa-france.com | OVH sas | 11 Mar 2019 | 12 Mar 2024 | 11 Mar 2025 |
| 473 | acwamons.business | Google, Inc. | 22 Feb 2019 | 27 Feb 2019 | 22 Feb 2020 |
| 474 | acwara.com | Crazy Domains FZ-LLC | 25 Mar 2019 | 25 Mar 2019 | 25 Mar 2020 |
| 475 | acwapowerae.com | GoDaddy.com, LLC | 28 Mar 2019 | 28 Mar 2019 | 28 Mar 2020 |
| 476 | acwatek.com | Dynadot14 LLC | 21 Jun 2021 | 22 Jun 2021 | 21 Jun 2022 |
| 477 | acwalkertheauthor.com | GoDaddy.com, LLC | 8 Apr 2019 | 8 Apr 2019 | 8 Apr 2020 |
| 478 | acwayack.com | Gandi SAS | 12 Apr 2019 | 12 Apr 2019 | 12 Apr 2020 |
| 479 | acwallunits.com | GoDaddy.com, LLC | 12 Apr 2019 | 1 Apr 2025 | 12 Apr 2026 |
| 480 | acwatch.club | Xiamen ChinaSource Internet Service Co., Ltd. | 1 May 2019 | 1 May 2019 | 1 May 2020 |
| 481 | acwautotransport.com | GoDaddy.com, LLC | 30 Apr 2018 | 1 May 2019 | 30 Apr 2020 |
| 482 | acward.photography | NameCheap, Inc. | 20 Jun 2019 | 26 May 2020 | 20 Jun 2021 |
| 483 | acwahap.com | HiChina Zhicheng Technology Limited | 20 Jun 2019 | 28 Jul 2020 | 20 Jun 2020 |
| 484 | acwaba.com | Tucows Domains Inc. | 7 Apr 2023 | 8 Apr 2025 | 7 Apr 2026 |
| 485 | acwam22.com | Bizcn.com, Inc. | 21 Jun 2019 | 5 Jul 2019 | 21 Jun 2020 |
| 486 | acwapower.pro | NameCheap, Inc. | 13 Jul 2019 | 13 Jul 2020 | 13 Jul 2021 |
| 487 | acwashington.com | NameCheap, Inc. | 26 Nov 2020 | 27 Oct 2025 | 26 Nov 2026 |
| 488 | acwarsaw.com | GoDaddy.com, LLC | 30 Jul 2019 | 30 Jul 2019 | 30 Jul 2020 |
| 489 | acwatlanta.com | GoDaddy.com, LLC | 9 Aug 2019 | 9 Aug 2025 | 9 Aug 2027 |
| 490 | acwatts.photos | NameCheap, Inc. | 26 Aug 2019 | 31 Aug 2019 | 26 Aug 2020 |
| 491 | acwaley.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 May 2023 | 7 May 2024 | 6 May 2025 |
| 492 | acwatercraftrental.com | GoDaddy.com, LLC | 4 Sep 2019 | 4 Sep 2019 | 4 Sep 2020 |
| 493 | acwagnerdesigns.com | Network Solutions, LLC | 12 Sep 2019 | 12 Sep 2019 | 12 Sep 2020 |
| 494 | acwanh7qdvt.com | Key-Systems GmbH | 14 Sep 2019 | 14 Sep 2019 | 14 Sep 2020 |
| 495 | acwattsdesign.com | Google, Inc. | 20 Sep 2019 | 5 Sep 2025 | 20 Sep 2026 |
| 496 | acwarcdesign.com | GoDaddy.com, LLC | 20 Sep 2019 | 20 Sep 2019 | 20 Sep 2021 |
| 497 | acwaproperties.com | GoDaddy.com, LLC | 26 Sep 2019 | 27 Sep 2025 | 26 Sep 2026 |
| 498 | acwaverunner.com | GoDaddy.com, LLC | 9 Oct 2019 | 9 Oct 2019 | 9 Oct 2020 |
| 499 | acwa-sonodaen.com | Wix.com Ltd. | 1 Nov 2019 | 1 Nov 2019 | 1 Nov 2021 |
| 500 | acwacc.com | Cloud Yuqu LLC | 3 Nov 2019 | 3 Nov 2019 | 3 Nov 2020 |
| 501 | acwatsoninc.com | GoDaddy.com, LLC | 10 Nov 2019 | 10 Nov 2019 | 10 Nov 2020 |
| 502 | acwalter.com | eNom, Inc. | 22 Nov 2019 | 22 Nov 2019 | 22 Nov 2020 |
| 503 | acwatercolors.com | OVH sas | 29 Nov 2019 | 30 Nov 2024 | 29 Nov 2026 |
| 504 | acwardrobe.style | NameCheap, Inc. | 8 Dec 2019 | 13 Dec 2019 | 8 Dec 2020 |
| 505 | acwapowerintl.com | NameCheap, Inc. | 12 Dec 2019 | - | 12 Dec 2020 |
| 506 | acwav.com | Chengdu Fly-Digital Technology Co., Ltd | 17 Dec 2019 | 18 Dec 2019 | 17 Dec 2020 |
| 507 | acwaf.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 1 Jan 2026 | 1 Jan 2026 | 1 Jan 2027 |
| 508 | acwatl.com | Network Solutions, LLC | 17 Jan 2020 | 22 Mar 2025 | 17 Jan 2028 |
| 509 | acwassociates.net | Google, Inc. | 29 Jan 2020 | 29 Jan 2020 | 29 Jan 2021 |
| 510 | acwarealestateanddevelopmentllc.com | GoDaddy.com, LLC | 10 Feb 2020 | 10 Feb 2020 | 10 Feb 2021 |
| 511 | acwallc.com | Wix.com Ltd. | 30 Sep 2025 | 30 Sep 2025 | 30 Sep 2027 |
| 512 | acwaala.net | GoDaddy.com, LLC | 22 Feb 2020 | 22 Feb 2020 | 22 Feb 2022 |
| 513 | acwarch.com | Tucows Domains Inc. | 23 Feb 2020 | 9 Feb 2025 | 23 Feb 2026 |
| 514 | acwart.com | Tucows Domains Inc. | 1 Mar 2020 | 14 Feb 2025 | 1 Mar 2026 |
| 515 | acwaihui.com | GoDaddy.com, LLC | 9 Mar 2020 | 9 Mar 2020 | 9 Mar 2021 |
| 516 | acwang88.com | GoDaddy.com, LLC | 18 Mar 2020 | 18 Mar 2020 | 18 Mar 2022 |
| 517 | acwaa.com | Metaregistrar BV Applications | 28 Aug 2025 | 28 Aug 2025 | 28 Aug 2026 |
| 518 | acwapowre.com | Tucows Domains Inc. | 1 Apr 2020 | 5 Apr 2021 | 1 Apr 2021 |
| 519 | acwanaut.com | Google, Inc. | 14 Apr 2020 | 14 Apr 2020 | 14 Apr 2021 |
| 520 | acways.com | GoDaddy.com, LLC | 19 Apr 2020 | 20 Apr 2025 | 19 Apr 2026 |
| 521 | acwaritsa.com | Google, Inc. | 21 Apr 2020 | 21 Apr 2020 | 21 Apr 2021 |
| 522 | acwali.com | FastDomain Inc. | 12 Nov 2022 | 14 Nov 2025 | 12 Nov 2026 |
| 523 | acwashes.com | GoDaddy.com, LLC | 12 May 2020 | 12 May 2020 | 12 May 2021 |
| 524 | acwalaonline.com | Network Solutions, LLC | 14 May 2020 | 14 May 2020 | 14 May 2021 |
| 525 | acwatt.net | Google, Inc. | 8 May 2020 | 23 Apr 2025 | 8 May 2026 |
| 526 | acwabstract.com | GoDaddy.com, LLC | 21 May 2020 | 21 May 2023 | 21 May 2026 |
| 527 | acwatt.info | Google, Inc. | 8 May 2020 | 8 May 2025 | 8 May 2026 |
| 528 | acwalaoncall.com | GoDaddy.com, LLC | 2 Jun 2020 | 2 Jun 2020 | 2 Jun 2021 |
| 529 | acwahsx.com | NameCheap, Inc. | 16 Jun 2020 | - | 16 Jun 2021 |
| 530 | acwaorg.club | Dynadot, LLC | 20 Jan 2023 | 20 Jan 2026 | 20 Jan 2026 |
| 531 | acwadi.com | GoDaddy.com, LLC | 16 Aug 2023 | 27 Sep 2024 | 16 Aug 2024 |
| 532 | acwardconsulting.com | 1&1 Internet AG | 6 Jul 2020 | 18 Sep 2023 | 6 Jul 2023 |
| 533 | acwarbysjob.com | eNom, Inc. | 13 Jul 2020 | 13 Jul 2020 | 13 Jul 2021 |
| 534 | acwavirtualconference.com | Tucows Domains Inc. | 25 Aug 2024 | 25 Aug 2024 | 25 Aug 2025 |
| 535 | acwar.net | Dynadot, LLC | 16 Oct 2021 | 16 Oct 2021 | 16 Oct 2022 |
| 536 | acwallsplit.com | GoDaddy.com, LLC | 20 Aug 2020 | 1 Aug 2025 | 20 Aug 2026 |
| 537 | acwac.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Jan 2022 | 20 Jan 2022 | 19 Jan 2023 |
| 538 | acwax.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 21 Dec 2021 | 23 Dec 2021 | 21 Dec 2022 |
| 539 | acwakm.icu | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 7 Jan 2020 | 18 Feb 2020 | 7 Jan 2021 |
| 540 | acwaz.icu | Eranet International Limited | 30 Dec 2019 | 4 Jan 2020 | 30 Dec 2020 |
| 541 | acwap.icu | Eranet International Limited | 30 Dec 2019 | 4 Jan 2020 | 30 Dec 2020 |
| 542 | acwaf.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 23 Jan 2022 | 24 Jan 2022 | 23 Jan 2023 |
| 543 | acway.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 23 Jan 2022 | 24 Jan 2022 | 23 Jan 2023 |
| 544 | acwaa.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Jan 2022 | 20 Jan 2022 | 19 Jan 2023 |
| 545 | acwahc.icu | Web Commerce Communications Limited dba WebNic.cc | 6 Aug 2019 | 6 Aug 2020 | 6 Aug 2021 |
| 546 | acwau.icu | Eranet International Limited | 30 Dec 2019 | 4 Jan 2020 | 30 Dec 2020 |
| 547 | acwah.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 5 Feb 2022 | 6 Feb 2022 | 5 Feb 2023 |
| 548 | acwal.icu | Eranet International Limited | 30 Dec 2021 | 30 Dec 2021 | 30 Dec 2022 |
| 549 | acwad.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Jan 2022 | 20 Jan 2022 | 19 Jan 2023 |
| 550 | acwans.com | Amazon Registrar, Inc. | 4 Sep 2020 | 31 Jul 2025 | 4 Sep 2026 |
| 551 | acwaystovote.com | Tucows Domains Inc. | 23 Sep 2020 | 4 Dec 2023 | 23 Sep 2023 |
| 552 | acwatts.online | Crazy Domains FZ-LLC | 24 Sep 2020 | - | 24 Sep 2021 |
| 553 | acwaad-digital.com | Name.com, Inc. | 1 Oct 2020 | 1 Oct 2020 | 1 Oct 2021 |
| 554 | acwarmhome.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 6 May 2022 | 6 May 2022 | 6 May 2032 |
| 555 | acwapower.website | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Nov 2020 | 15 Nov 2020 | 15 Nov 2021 |
| 556 | acwat.com | GoDaddy.com, LLC | 24 Aug 2025 | 24 Nov 2025 | 24 Aug 2026 |
| 557 | acwallet.net | GoDaddy.com, LLC | 27 Nov 2020 | 8 Feb 2024 | 27 Nov 2023 |
| 558 | acwacenet.com | NameCheap, Inc. | 20 Dec 2020 | - | 20 Dec 2021 |
| 559 | acwattzpt.xyz | GMO Internet Inc. | 25 Dec 2020 | - | 25 Dec 2021 |
| 560 | acwares.com | GoDaddy.com, LLC | 29 Jan 2021 | 29 Jan 2021 | 29 Jan 2022 |
| 561 | acwasher.com | Tucows Domains Inc. | 12 Feb 2021 | 28 Jan 2025 | 12 Feb 2026 |
| 562 | acwalaservice.com | GoDaddy.com, LLC | 13 Feb 2021 | 12 Feb 2021 | 13 Feb 2022 |
| 563 | acwallsystems.com | GoDaddy.com, LLC | 2 Mar 2021 | 13 Apr 2025 | 2 Mar 2025 |
| 564 | acwatterson.com | GoDaddy.com, LLC | 10 Mar 2021 | 11 Mar 2025 | 10 Mar 2027 |
| 565 | acwazam.xyz | GMO Internet Inc. | 19 Mar 2021 | - | 19 Mar 2022 |
| 566 | acwato.com | eNom, Inc. | 25 Mar 2021 | 2 Mar 2025 | 25 Mar 2026 |
| 567 | acwaiowa.com | Network Solutions, LLC | 8 Apr 2021 | 6 May 2025 | 8 Apr 2026 |
| 568 | acwartistfeatures.com | GoDaddy.com, LLC | 15 Apr 2021 | 15 Apr 2021 | 15 Apr 2022 |
| 569 | acwashpr.com | FastDomain Inc. | 19 Apr 2021 | 3 Apr 2025 | 19 Apr 2026 |
| 570 | acwarenhaus.com | Automattic Inc. | 9 May 2021 | 22 Jul 2023 | 9 May 2023 |
| 571 | acwailea.com | CSC Corporate Domains, Inc. | 27 May 2021 | 23 May 2025 | 27 May 2026 |
| 572 | acwaxdesign.com | Hosting Concepts B.V. dba Openprovider | 4 Jun 2021 | 15 Jul 2024 | 4 Jun 2024 |
| 573 | acwadd.com | GoDaddy.com, LLC | 13 Jun 2021 | 13 Jun 2021 | 13 Jun 2022 |
| 574 | acwatt.xyz | Google, Inc. | 3 Jul 2021 | 2 Sep 2024 | 3 Jul 2024 |
| 575 | acwardllc.com | FastDomain Inc. | 5 Jul 2021 | 17 Aug 2024 | 5 Jul 2024 |
| 576 | acwar.xyz | NameCheap, Inc. | 7 Jul 2021 | 7 Jul 2021 | 7 Jul 2022 |
| 577 | acwat.space | Beget LLC | 24 Jul 2021 | 24 Jul 2021 | 24 Jul 2022 |
| 578 | acwaterproofingllc.com | Google, Inc. | 29 Jul 2021 | 29 Jul 2021 | 29 Jul 2022 |
| 579 | acwardenterprises.com | Wild West Domains, LLC | 30 Jul 2021 | 30 Jul 2021 | 30 Jul 2022 |
| 580 | acwartist.com | Tucows Domains Inc. | 22 Aug 2021 | 2 Nov 2024 | 22 Aug 2024 |
| 581 | acwares.site | NameCheap, Inc. | 1 Sep 2021 | 30 Sep 2021 | 1 Sep 2023 |
| 582 | acwalkoffame.com | Tucows Domains Inc. | 9 Sep 2021 | 11 Aug 2025 | 9 Sep 2026 |
| 583 | acwaterventitionmin.com | GoDaddy.com, LLC | 20 Sep 2021 | 20 Sep 2021 | 20 Sep 2022 |
| 584 | acwarisoma.site | GoDaddy.com, LLC | 28 Sep 2021 | 28 Sep 2021 | 28 Sep 2022 |
| 585 | acwalter.net | PSI-USA, Inc. dba Domain Robot | 1 Oct 2021 | 1 Dec 2023 | 1 Oct 2023 |
| 586 | acwayonet.info | Wild West Domains, LLC | 16 Oct 2021 | 17 Oct 2021 | 16 Oct 2022 |
| 587 | acwaiytet.xyz | GMO Internet Inc. | 26 Oct 2021 | 13 May 2022 | 26 Oct 2022 |
| 588 | acwang.me | NameCheap, Inc. | 22 Oct 2020 | 22 Oct 2025 | 22 Oct 2026 |
| 589 | acwabt.top | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 9 Nov 2021 | - | 9 Nov 2022 |
| 590 | acwastewater.com | GoDaddy.com, LLC | 16 Nov 2021 | 16 Nov 2021 | 16 Nov 2022 |
| 591 | acwarm.com | NameCheap, Inc. | 1 Dec 2021 | - | 1 Dec 2022 |
| 592 | acwalkerrentals.com | GoDaddy.com, LLC | 2 Dec 2021 | 8 Dec 2025 | 2 Dec 2026 |
| 593 | acwac.online | GoDaddy.com, LLC | 5 Dec 2021 | 20 Jan 2022 | 5 Dec 2022 |
| 594 | acwapowerredstone.com | Tucows Domains Inc. | 21 Dec 2021 | 31 Jan 2025 | 21 Dec 2024 |
| 595 | acwarnty.com | GoDaddy.com, LLC | 23 Dec 2021 | 23 Dec 2021 | 23 Dec 2022 |
| 596 | acwaj.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 31 Dec 2021 | - | 31 Dec 2022 |
| 597 | acwav.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 31 Dec 2021 | 5 Jan 2022 | 31 Dec 2022 |
| 598 | acwak.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Jan 2022 | 18 Jan 2022 | 17 Jan 2023 |
| 599 | acwab.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Jan 2022 | 20 Jan 2022 | 19 Jan 2023 |
| 600 | acwas.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Jan 2022 | 20 Jan 2022 | 19 Jan 2023 |
| 601 | acwat.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Jan 2022 | 20 Jan 2022 | 19 Jan 2023 |
| 602 | acwag.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Jan 2022 | 20 Jan 2022 | 19 Jan 2023 |
| 603 | acwam.xyz | Namesilo, LLC | 21 Jan 2022 | 21 Jan 2022 | 21 Jan 2023 |
| 604 | acwaxles.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Jan 2022 | 3 Mar 2024 | 21 Jan 2024 |
| 605 | acwaste.com | eNom, Inc. | 29 Jul 2024 | 28 Jul 2025 | 29 Jul 2026 |
| 606 | acwae.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 23 Jan 2022 | 24 Jan 2022 | 23 Jan 2023 |
| 607 | acwai.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 23 Jan 2022 | 24 Jan 2022 | 23 Jan 2023 |
| 608 | acwaserviciosgenerales.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 22 Jan 2022 | 22 Jan 2022 | 22 Jan 2023 |
| 609 | acwam.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Jan 2022 | 24 Jan 2022 | 24 Jan 2023 |
| 610 | acwas-sa.biz | NameKing.com Inc. | 28 Jan 2022 | 28 Jan 2022 | 28 Jan 2023 |
| 611 | acwan.icu | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Jan 2022 | 30 Jan 2022 | 29 Jan 2023 |
| 612 | acwarehousepr.com | Google, Inc. | 8 Feb 2022 | 25 Jan 2025 | 8 Feb 2026 |
| 613 | acwatterworth.com | NameCheap, Inc. | 16 Feb 2022 | 17 Jan 2025 | 16 Feb 2026 |
| 614 | acwaypeaks.com | Hosting Concepts B.V. dba Openprovider | 26 Feb 2022 | 8 May 2023 | 26 Feb 2023 |
| 615 | acwarranty.club | GoDaddy.com, LLC | 28 Feb 2022 | 10 Apr 2024 | 28 Feb 2024 |
| 616 | acwarrantyclub.com | GoDaddy.com, LLC | 28 Feb 2022 | 10 May 2024 | 28 Feb 2024 |
| 617 | acwapowerbokpoort.com | Domain Name Services (Pty) Ltd | 16 Mar 2022 | 16 Mar 2025 | 16 Mar 2026 |
| 618 | acwashingmachineserviceinchennai.com | GoDaddy.com, LLC | 4 Apr 2022 | 16 Apr 2023 | 4 Apr 2024 |
| 619 | acwarming.xyz | Namesilo, LLC | 8 Apr 2022 | 6 Jun 2022 | 8 Apr 2024 |
| 620 | acwallet.xyz | GMO Internet Inc. | 8 Dec 2025 | - | 8 Dec 2026 |
| 621 | acwars.com | Media Elite Holdings Limited | 20 Apr 2022 | 21 Apr 2023 | 20 Apr 2023 |
| 622 | acwapowers.com | NameCheap, Inc. | 1 Aug 2024 | 12 Sep 2025 | 1 Aug 2025 |
| 623 | acwaterservice.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Apr 2022 | 25 Apr 2022 | 24 Apr 2023 |
| 624 | acwapower.site | NameCheap, Inc. | 15 Aug 2024 | 26 Sep 2025 | 15 Aug 2025 |
| 625 | acwanih.xyz | NameCheap, Inc. | 9 May 2022 | 6 Jun 2022 | 9 May 2024 |
| 626 | acwaviva.com | 1&1 Internet AG | 11 May 2022 | 24 Jul 2023 | 11 May 2023 |
| 627 | acwarehous.com | eName Technology Co., Ltd. | 17 May 2022 | 28 Jun 2023 | 17 May 2023 |
| 628 | acwabash.com | DreamHost, LLC | 18 May 2022 | 17 Apr 2025 | 18 May 2026 |
| 629 | acwaller.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 May 2022 | 4 Aug 2024 | 23 May 2024 |
| 630 | acwaccounts.com | Total Web Solutions Ltd. trading as TotalRegistrat… | 24 May 2022 | 30 Jul 2025 | 24 May 2026 |
| 631 | acwacolorado.com | GoDaddy.com, LLC | 26 Jul 2017 | 4 Oct 2022 | 26 Jul 2027 |
| 632 | acwanllc.com | Wix.com Ltd. | 23 Jun 2021 | 27 Jun 2022 | 23 Jun 2022 |
| 633 | acwarium.xyz | Epik Inc. | 3 Jul 2022 | 13 Sep 2023 | 3 Jul 2023 |
| 634 | acwa-al.com | Google, Inc. | 19 Jul 2022 | 5 Jul 2025 | 19 Jul 2026 |
| 635 | acwallinglandscapes.co.uk | - | 24 Jul 2022 | 16 Nov 2022 | 24 Jul 2023 |
| 636 | acwadleylogistics.com | Wild West Domains, LLC | 27 Jul 2022 | 7 Oct 2024 | 27 Jul 2024 |
| 637 | acwaaus.com | Google, Inc. | 28 Jul 2022 | 29 Jul 2023 | 28 Jul 2024 |
| 638 | acwaterfan.com | Google, Inc. | 29 Jul 2022 | 28 Sep 2024 | 29 Jul 2024 |
| 639 | acwarehouse.co.uk | - | 29 Jul 2022 | 13 Aug 2024 | 29 Jul 2024 |
| 640 | acwattsdesigns.com | GoDaddy.com, LLC | 3 Aug 2022 | 4 Aug 2025 | 3 Aug 2026 |
| 641 | acwatts.design | eNom, Inc. | 9 Aug 2022 | 9 Aug 2022 | 9 Aug 2023 |
| 642 | acwatts.store | Crazy Domains FZ-LLC | 15 Aug 2022 | 15 Aug 2022 | 15 Aug 2023 |
| 643 | acwatt.fr | - | 27 Oct 2021 | 27 Oct 2021 | 27 Oct 2022 |
| 644 | acwa-robotics.tech | OVH sas | 7 Sep 2022 | 1 Nov 2025 | 7 Sep 2026 |
| 645 | acwa-robotics.net | OVH sas | 7 Sep 2022 | 8 Sep 2024 | 7 Sep 2026 |
| 646 | acwaenterprise.com | GoDaddy.com, LLC | 21 Sep 2022 | 3 Dec 2023 | 21 Sep 2023 |
| 647 | acwagyu.com | Squarespace Domains LLC | 28 Sep 2022 | 28 Nov 2023 | 28 Sep 2023 |
| 648 | acwaverse.com | FastDomain Inc. | 2 Oct 2022 | 14 Nov 2025 | 2 Oct 2025 |
| 649 | acwatechlimited.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Oct 2022 | 23 Oct 2025 | 10 Oct 2026 |
| 650 | acwala.site | Hostinger, UAB | 11 Dec 2024 | 12 Dec 2025 | 11 Dec 2026 |
| 651 | acwajpia.site | Network Solutions, LLC | 18 Oct 2022 | 20 Oct 2025 | 18 Oct 2026 |
| 652 | acwarehousecapetownsouthafrica.com | Google, Inc. | 19 Oct 2022 | 20 Oct 2023 | 19 Oct 2024 |
| 653 | acwa-foundation.org | GoDaddy.com, LLC | 21 Oct 2022 | 5 Dec 2025 | 21 Oct 2026 |
| 654 | acwafoundation.com | GoDaddy.com, LLC | 21 Oct 2022 | 2 Dec 2023 | 21 Oct 2023 |
| 655 | acwa-connect.com | OVH sas | 21 Oct 2022 | 22 Oct 2024 | 21 Oct 2026 |
| 656 | acwa-connect.org | OVH sas | 26 Oct 2022 | 10 Dec 2025 | 26 Oct 2026 |
| 657 | acwaconnect.org | OVH sas | 26 Oct 2022 | 10 Dec 2025 | 26 Oct 2026 |
| 658 | acwanders.online | Key-Systems, LLC | 27 Oct 2022 | 27 Oct 2022 | 27 Oct 2023 |
| 659 | acwaconnect.net | OVH sas | 26 Oct 2022 | 27 Oct 2024 | 26 Oct 2026 |
| 660 | acwa-connect.net | OVH sas | 26 Oct 2022 | 27 Oct 2024 | 26 Oct 2026 |
| 661 | acwaconnect.com | OVH sas | 26 Oct 2022 | 27 Oct 2024 | 26 Oct 2026 |
| 662 | acwanghongdazao.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 5 Nov 2022 | 13 Dec 2023 | 5 Nov 2023 |
| 663 | acwawhdyzlpedjk.xyz | NameCheap, Inc. | 10 Nov 2022 | 21 Jan 2024 | 10 Nov 2023 |
| 664 | acwang.cc | Domaining Oro, LLC | 4 Nov 2022 | 18 Dec 2023 | 4 Nov 2023 |
| 665 | acwaresolutions.com | Key-Systems GmbH | 18 Nov 2022 | 26 Nov 2025 | 18 Nov 2026 |
| 666 | acware.tech | Hostinger, UAB | 28 Nov 2022 | 11 Jan 2025 | 28 Nov 2024 |
| 667 | acwauctions.com | GoDaddy.com, LLC | 2 Dec 2022 | 3 Dec 2025 | 2 Dec 2026 |
| 668 | acwandco.com | Wix.com Ltd. | 6 Dec 2022 | 16 Jan 2025 | 6 Dec 2024 |
| 669 | acwatrust.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Dec 2022 | 17 Dec 2025 | 16 Dec 2026 |
| 670 | acwaterproof.com | Google, Inc. | 16 Dec 2022 | 1 Dec 2025 | 16 Dec 2026 |
| 671 | acwadventure.pl | - | 9 Dec 2021 | 10 Dec 2023 | 9 Dec 2026 |
| 672 | acwag.net | Wix.com Ltd. | 22 Dec 2022 | 22 Nov 2025 | 22 Dec 2026 |
| 673 | acwarrantyclub.us | GoDaddy.com, LLC | 28 Feb 2022 | 10 Apr 2024 | 28 Feb 2024 |
| 674 | acwatulsa.com | GoDaddy.com, LLC | 3 Sep 2017 | 15 Oct 2024 | 3 Sep 2024 |
| 675 | acwador.com.pl | - | 25 Nov 2022 | 25 Nov 2025 | 25 Nov 2026 |
| 676 | acwalee.com | GoDaddy.com, LLC | 7 Jan 2023 | 20 Mar 2024 | 7 Jan 2024 |
| 677 | acwayfair.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 Jan 2023 | 14 Mar 2024 | 11 Jan 2024 |
| 678 | acwallah.com | Hostinger, UAB | 26 Apr 2024 | 21 Apr 2025 | 26 Apr 2026 |
| 679 | acwatercolors.art | OVH sas | 29 Nov 2019 | 1 Dec 2025 | 29 Nov 2026 |
| 680 | acwalker.art | Instra Corporation Pty Ltd. | 13 May 2017 | 31 Aug 2023 | 13 May 2026 |
| 681 | acwax.asia | MarkMonitor Inc. | 6 Feb 2008 | 19 Nov 2025 | 6 Feb 2027 |
| 682 | acwaasland.be | - | 14 Dec 2001 | - | - |
| 683 | acwaq.top | Zhengzhou Century Connect Electronic Technology De… | 8 Sep 2022 | 9 Sep 2023 | 8 Sep 2024 |
| 684 | acwallintergroup.co.th | - | 14 Jan 2019 | 16 Jan 2026 | 13 Jan 2028 |
| 685 | acwatersport.be | - | 8 Jan 2015 | - | - |
| 686 | acwall.co.th | - | 7 Nov 2017 | 15 Oct 2025 | 6 Nov 2027 |
| 687 | acwapowerredstonecsp.com | Wix.com Ltd. | 20 Jan 2022 | 24 Jan 2023 | 20 Jan 2023 |
| 688 | acwagro.com.br | - | 30 May 2019 | 2 May 2025 | 30 May 2027 |
| 689 | acwasoft.com | Tucows Domains Inc. | 28 Jan 2023 | 9 Apr 2024 | 28 Jan 2024 |
| 690 | acwalberta.ca | - | 10 Sep 2014 | 11 Sep 2024 | 10 Sep 2026 |
| 691 | acwad.online | URL Solutions, Inc. | 4 Feb 2023 | 14 Nov 2025 | 4 Feb 2028 |
| 692 | acwang.cn | - | 12 May 2024 | - | 12 May 2026 |
| 693 | acwaoklahomacity.com | GoDaddy.com, LLC | 3 Sep 2017 | 5 Oct 2022 | 3 Sep 2027 |
| 694 | acwattpower.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Feb 2023 | 6 Feb 2025 | 13 Feb 2026 |
| 695 | acwavs.com | GoDaddy.com, LLC | 20 Jul 2017 | 5 Oct 2025 | 20 Jul 2027 |
| 696 | acwamanagement.co.uk | - | 13 Feb 2023 | 14 Jan 2026 | 13 Feb 2027 |
| 697 | acwalaa.com | GoDaddy.com, LLC | 16 Feb 2023 | 30 Mar 2025 | 16 Feb 2025 |
| 698 | acwayne.com | Network Solutions, LLC | 28 Apr 2017 | 29 Mar 2025 | 28 Apr 2026 |
| 699 | acwagers.com | Dynadot4 LLC | 9 Mar 2022 | 19 Apr 2023 | 9 Mar 2023 |
| 700 | acwaverse.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Feb 2023 | 2 Apr 2024 | 25 Feb 2024 |
| 701 | acwamontreal.com | NameCheap, Inc. | 25 Feb 2023 | 26 Jan 2025 | 25 Feb 2026 |
| 702 | acwathon.com | FastDomain Inc. | 25 Feb 2023 | 9 May 2024 | 25 Feb 2024 |
| 703 | acwaverse.net | FastDomain Inc. | 25 Feb 2023 | 9 May 2024 | 25 Feb 2024 |
| 704 | acwassetsllc.com | GoDaddy.com, LLC | 25 Jan 2018 | 8 Mar 2023 | 25 Jan 2023 |
| 705 | acwa-power.net | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 7 Mar 2023 | 8 Mar 2024 | 7 Mar 2025 |
| 706 | acwarmory.com | GoDaddy.com, LLC | 9 Mar 2018 | 9 Mar 2023 | 9 Mar 2028 |
| 707 | acwaudio.com | GoDaddy.com, LLC | 1 Apr 2022 | 13 Apr 2023 | 1 Apr 2024 |
| 708 | acwahana.site | NameCheap, Inc. | 10 Mar 2023 | 21 May 2024 | 10 Mar 2024 |
| 709 | acwanet.net | FastDomain Inc. | 16 Mar 2023 | 27 Apr 2025 | 16 Mar 2025 |
| 710 | acwale.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Mar 2023 | 28 May 2024 | 22 Mar 2024 |
| 711 | acwapower.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Mar 2023 | 30 Apr 2025 | 24 Mar 2026 |
| 712 | acwarchitects.com | DreamHost, LLC | 3 Mar 2021 | 16 May 2024 | 3 Mar 2024 |
| 713 | acwallbox.com | HiChina Zhicheng Technology Limited | 3 Mar 2021 | 4 Mar 2025 | 3 Mar 2026 |
| 714 | acwaterrentals.com | GoDaddy.com, LLC | 25 Mar 2021 | 26 Mar 2025 | 25 Mar 2026 |
| 715 | acwalebaba.com | GoDaddy.com, LLC | 1 Apr 2023 | 13 Jun 2024 | 1 Apr 2024 |
| 716 | acwapower.app | NameKing.com Inc. | 15 Jul 2024 | 14 Aug 2025 | 15 Jul 2025 |
| 717 | acwaf.org | Launchpad, Inc. | 5 Apr 2023 | 26 Mar 2025 | 5 Apr 2026 |
| 718 | acwatfordhamenglish.com | Wix.com Ltd. | 7 Dec 2021 | 17 Jan 2024 | 7 Dec 2023 |
| 719 | acwallets.com | Amazon Registrar, Inc. | 22 Apr 2025 | 7 May 2025 | 22 Apr 2026 |
| 720 | acwatersort.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 29 Jun 2022 | 6 Aug 2025 | 29 Jun 2025 |
| 721 | acwassmus.com | Wix.com Ltd. | 8 Jul 2022 | 26 Jun 2025 | 8 Jul 2026 |
| 722 | acwajapia.com | NameCheap, Inc. | 14 Jul 2022 | 25 Sep 2023 | 14 Jul 2023 |
| 723 | acwalker.design | GoDaddy.com, LLC | 13 May 2017 | 20 Oct 2025 | 13 May 2027 |
| 724 | acwaste.ie | - | 2 Dec 2014 | 9 Mar 2023 | 2 Dec 2027 |
| 725 | acwale.co.in | GoDaddy.com, LLC | 13 Oct 2023 | 24 Nov 2024 | 13 Oct 2024 |
| 726 | acwalla.in | - | 7 Nov 2018 | 7 Nov 2025 | 7 Nov 2026 |
| 727 | acwaipia.com | Key-Systems GmbH | 18 Apr 2023 | 18 Apr 2023 | 18 Apr 2024 |
| 728 | acwand.com | GoDaddy.com, LLC | 19 Apr 2023 | 20 Apr 2025 | 19 Apr 2027 |
| 729 | acwalanearme.com | Hostinger, UAB | 20 Apr 2023 | 3 Jul 2025 | 20 Apr 2025 |
| 730 | acwatercolors.net | Wix.com Ltd. | 3 Jun 2020 | 6 May 2025 | 3 Jun 2026 |
| 731 | acwaterland.nl | - | 4 Apr 2005 | 28 Nov 2021 | - |
| 732 | acwautos.nl | - | 15 Feb 2008 | 1 Aug 2022 | - |
| 733 | acwal.nl | - | 17 Mar 2006 | 4 Oct 2023 | - |
| 734 | acwatersport.nl | - | 30 Jan 2015 | 4 Jul 2025 | - |
| 735 | acwala.online | Network Solutions, LLC | 3 Aug 2020 | 31 Jul 2025 | 3 Aug 2026 |
| 736 | acwacoop.org | Crazy Domains FZ-LLC | 9 Jan 2018 | 6 Jan 2026 | 9 Jan 2027 |
| 737 | acwaterauthority.org | Network Solutions, LLC | 31 Oct 2019 | 6 Sep 2025 | 31 Oct 2028 |
| 738 | acwafoundation.org | Namesilo, LLC | 15 May 2021 | 19 Jun 2024 | 15 May 2024 |
| 739 | acwalkoffame.org | Tucows Domains Inc. | 9 Sep 2021 | 16 Aug 2025 | 9 Sep 2026 |
| 740 | acwagner.photo | eNom, Inc. | 6 Jan 2022 | 27 Dec 2022 | 6 Jan 2024 |
| 741 | acwasteremovalanddemolition.co.uk | - | 28 Apr 2023 | 28 Apr 2023 | 28 Apr 2024 |
| 742 | acwauto.pl | - | 28 Dec 2012 | 9 Dec 2025 | 28 Dec 2026 |
| 743 | acwave.pl | - | 26 Jan 2017 | 20 Feb 2025 | 26 Jan 2026 |
| 744 | acwador.pl | - | 10 May 2023 | 11 Apr 2025 | 10 May 2026 |
| 745 | acwadvocaciaprevidenciaria.com | Google, Inc. | 4 May 2023 | 5 May 2024 | 4 May 2025 |
| 746 | acware.top | DNSPod, Inc. | 24 Jan 2021 | 28 Feb 2024 | 24 Jan 2026 |
| 747 | acwassavingsvault.com | GoDaddy.com, LLC | 10 May 2023 | 22 Jul 2024 | 10 May 2024 |
| 748 | acwapower.vip | Blue Razor Domains, LLC | 11 May 2023 | 22 Jun 2024 | 11 May 2024 |
| 749 | acwademy.org | Google, Inc. | 12 May 2023 | 12 May 2025 | 12 May 2026 |
| 750 | acwapower.xyz | Namesilo, LLC | 25 Feb 2025 | 19 Mar 2025 | 25 Feb 2026 |
| 751 | acwac.org | GoDaddy.com, LLC | 28 May 2023 | 9 Jul 2024 | 28 May 2024 |
| 752 | acwalling.co.uk | - | 3 May 2022 | 27 Jul 2022 | 3 May 2023 |
| 753 | acwatts.co.uk | - | 2 Feb 2022 | 2 Feb 2023 | 2 Feb 2025 |
| 754 | acwalamodiandsons.com | GMO Internet Inc. | 4 Jun 2023 | 10 Aug 2024 | 4 Jun 2024 |
| 755 | acwa-llc.site | GMO Internet Inc. | 5 Jun 2023 | 17 Aug 2024 | 5 Jun 2024 |
| 756 | acwa-llc.com | GMO Internet Inc. | 5 Jun 2023 | 21 May 2025 | 5 Jun 2026 |
| 757 | acwar.cn | ???????????? | 21 Jun 2023 | - | 21 Jun 2025 |
| 758 | acwashing.services | Automattic Inc. | 5 Jul 2023 | 17 Aug 2024 | 5 Jul 2024 |
| 759 | acwarm.homes | NameCheap, Inc. | 19 Jul 2023 | 30 Aug 2024 | 19 Jul 2024 |
| 760 | acwaex.com | Web Commerce Communications Limited dba WebNic.cc | 25 Jul 2023 | 25 Jul 2023 | 25 Jul 2024 |
| 761 | acwaservices.com | Google, Inc. | 28 Jul 2023 | 13 Jul 2025 | 28 Jul 2026 |
| 762 | acwabstractt.com | Wild West Domains, LLC | 1 Aug 2023 | 25 Dec 2023 | 1 Aug 2024 |
| 763 | acwashpr.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Aug 2023 | 14 Sep 2024 | 8 Aug 2024 |
| 764 | acwao.top | Chengdu West Dimension Digital Technology Co., Ltd… | 8 Aug 2023 | 21 Sep 2024 | 8 Aug 2024 |
| 765 | acwaresoluyions.com | Tucows Domains Inc. | 26 Aug 2023 | 6 Oct 2024 | 26 Aug 2024 |
| 766 | acwattpower.online | Limited Liability Company "Registrar of domain nam… | 31 Aug 2023 | 9 Oct 2024 | 31 Aug 2024 |
| 767 | acwap.com.au | - | - | 30 Nov 2025 | - |
| 768 | acwarobotics.com | - | 8 Feb 2025 | 8 Feb 2025 | 8 Feb 2026 |
| 769 | acwapowerinternational.ltd | GoDaddy.com, LLC | 6 Sep 2023 | 18 Oct 2024 | 6 Sep 2024 |
| 770 | acwalehanumanji.com | GoDaddy.com, LLC | 6 Sep 2023 | 18 Sep 2025 | 6 Sep 2026 |
| 771 | acwattpower.pro | Limited Liability Company "Registrar of domain nam… | 13 Sep 2023 | 13 Sep 2024 | 13 Sep 2025 |
| 772 | acwatn.org | GoDaddy.com, LLC | 20 Sep 2023 | 29 Aug 2024 | 20 Sep 2028 |
| 773 | acwaacwa.best | NameKing.com Inc. | 23 Sep 2023 | 7 Dec 2024 | 23 Sep 2024 |
| 774 | acwalley.com | Automattic Inc. | 19 Oct 2023 | 19 Oct 2023 | 19 Oct 2024 |
| 775 | acwad-it.com | Hostinger, UAB | 23 Oct 2023 | 24 Oct 2024 | 23 Oct 2025 |
| 776 | acwapowervip.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 23 Oct 2023 | 31 Dec 2024 | 23 Oct 2024 |
| 777 | acwaannualreport.com | Automattic Inc. | 5 Nov 2023 | 23 Nov 2025 | 5 Nov 2026 |
| 778 | acwaconsultores.com | LiquidNet Ltd. | 8 Nov 2023 | 9 Nov 2025 | 8 Nov 2025 |
| 779 | acwaj.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 1 Jan 2026 | 1 Jan 2026 | 1 Jan 2027 |
| 780 | acwapowercn.com | DNSPod, Inc. | 17 Nov 2023 | 26 Nov 2025 | 17 Nov 2026 |
| 781 | acwajpia.info | Wild West Domains, LLC | 20 Nov 2023 | 21 Nov 2025 | 20 Nov 2026 |
| 782 | acwastecollection.com | GoDaddy.com, LLC | 22 Nov 2023 | 22 Nov 2023 | 22 Nov 2026 |
| 783 | acwautomatics.com | NameCheap, Inc. | 24 Nov 2023 | 25 Nov 2024 | 24 Nov 2025 |
| 784 | acwarehouseonline.com | GoDaddy.com, LLC | 28 Nov 2023 | 28 Nov 2023 | 28 Nov 2026 |
| 785 | acwa-sirv.com | GoDaddy.com, LLC | 4 Dec 2023 | 4 Dec 2023 | 4 Dec 2026 |
| 786 | acwasffm.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Dec 2023 | 14 Dec 2024 | 13 Dec 2025 |
| 787 | acwallpapers.com | Porkbun, LLC | 28 Dec 2023 | 8 Jan 2025 | 28 Dec 2025 |
| 788 | acwatchtradingllc.com | Tucows Domains Inc. | 8 Jan 2024 | 12 Jan 2026 | 8 Jan 2027 |
| 789 | acwatts.com.au | - | - | 19 Sep 2025 | - |
| 790 | acwarmcn.shop | NameCheap, Inc. | 25 Jan 2024 | 9 Feb 2024 | 25 Jan 2025 |
| 791 | acwapower.ae | - | - | - | - |
| 792 | acwahqp0.sbs | - | 1 Feb 2024 | 15 Mar 2025 | 1 Feb 2025 |
| 793 | acwapparels.com | Tucows Domains Inc. | 3 Feb 2024 | 16 Mar 2025 | 3 Feb 2025 |
| 794 | acwaitcn.shop | NameCheap, Inc. | 25 Jan 2024 | 8 Mar 2025 | 25 Jan 2025 |
| 795 | acwarcondicionado.com.br | - | 26 Apr 2015 | 27 Apr 2023 | 26 Apr 2026 |
| 796 | acwaalaa.com | GMO Internet Inc. | 8 Feb 2024 | 16 Mar 2025 | 8 Feb 2025 |
| 797 | acwalah.com | Hostinger, UAB | 9 Feb 2024 | 13 Feb 2025 | 9 Feb 2026 |
| 798 | acwatchdog.org | Automattic Inc. | 12 Feb 2024 | 21 Nov 2025 | 12 Feb 2026 |
| 799 | acwamafoundation.org | NameCheap, Inc. | 20 Feb 2024 | 6 Apr 2025 | 20 Feb 2026 |
| 800 | acwattpower.com.cn | - | 16 Feb 2023 | - | 16 Feb 2035 |
| 801 | acwatches.us | Tucows Domains Inc. | 24 Jan 2023 | 5 Mar 2024 | 24 Jan 2024 |
| 802 | acwapolwer.com | GoDaddy.com, LLC | 5 Mar 2024 | 17 May 2025 | 5 Mar 2025 |
| 803 | acwapopwer.com | GoDaddy.com, LLC | 5 Mar 2024 | 5 Mar 2024 | 5 Mar 2025 |
| 804 | acwareauthor.com | register.com, Inc. | 8 Mar 2024 | 19 Apr 2025 | 8 Mar 2025 |
| 805 | acwatson.uk | - | 19 Mar 2024 | 18 Mar 2025 | 19 Mar 2026 |
| 806 | acwahanapro.com | Hosting Concepts B.V. dba Openprovider | 20 Mar 2024 | 4 Jul 2025 | 20 Mar 2026 |
| 807 | acwaman.com | Epik Inc. | 22 Mar 2024 | 21 Apr 2025 | 22 Mar 2025 |
| 808 | acwang.fun | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 25 Mar 2024 | 14 Apr 2025 | 25 Mar 2026 |
| 809 | acwala.in | GoDaddy.com, LLC | 8 Oct 2021 | 19 Nov 2025 | 8 Oct 2025 |
| 810 | acwang666.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 30 Mar 2024 | 7 Jun 2025 | 30 Mar 2025 |
| 811 | acwang.asia | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 31 Mar 2024 | 7 Jun 2025 | 31 Mar 2025 |
| 812 | acwallunitrepair.com | NameCheap, Inc. | 30 Mar 2024 | 11 May 2025 | 30 Mar 2025 |
| 813 | acwang.love | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 31 Mar 2024 | 7 Jun 2025 | 31 Mar 2025 |
| 814 | acwang.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 31 Mar 2024 | 8 Jun 2025 | 31 Mar 2025 |
| 815 | acwanimation.com | Squarespace Domains LLC | 3 Apr 2024 | 19 Mar 2025 | 3 Apr 2026 |
| 816 | acwaveinn.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 5 Apr 2024 | 11 Jul 2025 | 5 Apr 2026 |
| 817 | acwasteclearance.co.uk | - | 21 Aug 2020 | 19 Sep 2024 | 21 Aug 2026 |
| 818 | acwatercartage.com.au | - | - | 18 Oct 2023 | - |
| 819 | acwatt.co.uk | - | 30 Apr 2021 | 31 Mar 2025 | 30 Apr 2026 |
| 820 | acwaves.co.uk | - | 18 Aug 2021 | 19 Jul 2024 | 18 Aug 2027 |
| 821 | acwalkcn.shop | NameCheap, Inc. | 25 Jan 2024 | 9 Feb 2024 | 25 Jan 2025 |
| 822 | acwalkdn.shop | NameCheap, Inc. | 24 Jan 2024 | 9 Feb 2024 | 24 Jan 2025 |
| 823 | acwantdn.shop | NameCheap, Inc. | 24 Jan 2024 | 9 Feb 2024 | 24 Jan 2025 |
| 824 | acwater.co.uk | - | 8 Sep 2016 | 9 Sep 2024 | 8 Sep 2026 |
| 825 | acwatkins.co.uk | - | 28 Apr 2020 | 30 Apr 2025 | 28 Apr 2026 |
| 826 | acwarmdn.shop | NameCheap, Inc. | 24 Jan 2024 | 9 Feb 2024 | 24 Jan 2025 |
| 827 | acwatercn.shop | NameCheap, Inc. | 25 Jan 2024 | 9 Feb 2024 | 25 Jan 2025 |
| 828 | acwatchdn.shop | NameCheap, Inc. | 24 Jan 2024 | 9 Feb 2024 | 24 Jan 2025 |
| 829 | acwa1.org.au | - | - | 5 May 2025 | - |
| 830 | acwa2012.com.au | - | - | 15 Nov 2025 | - |
| 831 | acwaccounts.co.uk | - | 30 May 2022 | 30 Jul 2025 | 30 May 2026 |
| 832 | acwaconference.com.au | - | - | 22 Nov 2025 | - |
| 833 | acwac.com.au | - | - | 13 Aug 2025 | - |
| 834 | acwaitdn.shop | NameCheap, Inc. | 24 Jan 2024 | 9 Feb 2024 | 24 Jan 2025 |
| 835 | acwallen.co.uk | - | 2 Aug 2020 | 4 Jul 2025 | 2 Aug 2030 |
| 836 | acwallen.uk | - | 2 Aug 2020 | 4 Jul 2025 | 2 Aug 2030 |
| 837 | acwallet.io | GoDaddy.com, LLC | 27 Nov 2020 | 7 Feb 2025 | 27 Nov 2024 |
| 838 | acware.club | Name.com, Inc. | 7 May 2014 | 19 Jun 2025 | 6 May 2025 |
| 839 | acwashermasters.top | NameCheap, Inc. | 7 Oct 2023 | 18 Nov 2024 | 7 Oct 2024 |
| 840 | acwashingmachinespecialist.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Apr 2024 | 5 Jul 2025 | 23 Apr 2025 |
| 841 | acwatt.online | Regional Network Information Center, JSC dba RU-CE… | 25 Apr 2024 | 26 Apr 2025 | 25 Apr 2026 |
| 842 | acwadak.com | Tucows Domains Inc. | 25 Jul 2025 | 25 Jul 2025 | 25 Jul 2026 |
| 843 | acwa-shop.ru | - | 3 Nov 2023 | - | 3 Nov 2024 |
| 844 | acwadomik.ru | - | 1 Nov 2025 | - | 1 Nov 2026 |
| 845 | acwaiter.ru | - | 7 Sep 2020 | - | 7 Sep 2025 |
| 846 | acwall.ru | - | 22 Mar 2024 | - | 22 Mar 2026 |
| 847 | acwallet.ru | - | 9 Apr 2023 | - | 9 Apr 2025 |
| 848 | acwarel.ru | - | 14 Jun 2023 | - | 14 Jun 2025 |
| 849 | acwatercsoti.ru | - | 16 Apr 2024 | - | 16 Apr 2025 |
| 850 | acwatt.ru | - | 19 Jul 2023 | - | 19 Jul 2026 |
| 851 | acwattpower.ru | - | 31 Aug 2023 | - | 31 Aug 2025 |
| 852 | acwax.ru | - | 3 Sep 2008 | - | 3 Sep 2026 |
| 853 | acways.ru | - | 16 Nov 2023 | - | 16 Nov 2024 |
| 854 | acwalter.de | - | - | 23 Dec 2022 | - |
| 855 | acwaservice.de | - | - | 23 Apr 2020 | - |
| 856 | acwaves.de | - | - | 26 Aug 2025 | - |
| 857 | acwapower-redstone.com | Domain Name Services (Pty) Ltd | 7 May 2024 | 6 May 2025 | 7 May 2026 |
| 858 | acwaltdisneycasaluce.com | Tucows Domains Inc. | 10 May 2024 | 14 May 2025 | 10 May 2026 |
| 859 | acwaspower.com | Wild West Domains, LLC | 13 May 2024 | 25 Jul 2024 | 13 May 2025 |
| 860 | acwaale.online | Hostinger, UAB | 18 May 2024 | 1 Jul 2025 | 18 May 2025 |
| 861 | acwaterpumps.za.com | NameKing.com Inc. | 4 Feb 2024 | 21 Mar 2025 | 4 Feb 2025 |
| 862 | acwacker.de | - | - | 15 Jul 2008 | - |
| 863 | acwall.com.br | - | 29 Sep 2021 | 30 Aug 2025 | 29 Sep 2026 |
| 864 | acwalid.com | Wix.com Ltd. | 22 May 2024 | 2 Jul 2025 | 22 May 2025 |
| 865 | acwarehousecares.com | GoDaddy.com, LLC | 4 Jun 2024 | 5 Jun 2025 | 4 Jun 2026 |
| 866 | acwala.org | Hostinger, UAB | 15 Jun 2024 | 15 Jun 2025 | 15 Jun 2026 |
| 867 | acwarrantyregistration.com | GoDaddy.com, LLC | 17 Jun 2024 | 18 Jun 2025 | 17 Jun 2026 |
| 868 | acwagents.com | GoDaddy.com, LLC | 18 Jun 2024 | 18 Jun 2024 | 18 Jun 2025 |
| 869 | acware-author.com | GoDaddy.com, LLC | 28 Jun 2024 | 9 Aug 2025 | 28 Jun 2025 |
| 870 | acwalle.com | Hostinger, UAB | 8 Jul 2024 | 2 Aug 2024 | 8 Jul 2027 |
| 871 | acwaboost.com | Gandi SAS | 11 Jul 2024 | 12 Jul 2025 | 11 Jul 2026 |
| 872 | acwapwr.com | Gandi SAS | 11 Jul 2024 | 12 Jul 2025 | 11 Jul 2026 |
| 873 | acwayconsultancy.com | Hostinger, UAB | 16 Jul 2024 | 19 Jun 2025 | 16 Jul 2026 |
| 874 | acwa9.com | Tucows Domains Inc. | 22 Jul 2024 | 1 Sep 2025 | 22 Jul 2025 |
| 875 | acwallintergroup.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jul 2024 | 16 Jul 2025 | 24 Jul 2026 |
| 876 | acwash.xyz | GMO Internet Inc. | 17 Oct 2025 | 22 Oct 2025 | 17 Oct 2026 |
| 877 | acwaware.com | Gandi SAS | 1 Aug 2024 | 14 Sep 2025 | 1 Aug 2025 |
| 878 | acwax.cn | ???????????? | 29 Nov 2025 | - | 29 Nov 2026 |
| 879 | acwalay.co.in | - | 26 May 2023 | 30 May 2024 | 26 May 2026 |
| 880 | acwapac.org | GoDaddy.com, LLC | 4 Aug 2024 | 9 Aug 2024 | 4 Aug 2029 |
| 881 | acwaa.cn | ???????????? | 12 Nov 2023 | - | 12 Nov 2024 |
| 882 | acwastesolutionsnow.com | Tucows Domains Inc. | 7 Aug 2024 | 24 Aug 2024 | 7 Aug 2026 |
| 883 | acwala.info | Hostinger, UAB | 8 Aug 2024 | 8 Aug 2025 | 8 Aug 2026 |
| 884 | acwala.shop | Hostinger, UAB | 8 Aug 2024 | 10 Oct 2024 | 8 Aug 2025 |
| 885 | acwala.tech | Hostinger, UAB | 8 Aug 2024 | 9 Aug 2025 | 8 Aug 2026 |
| 886 | acwaikobekive.shop | GoDaddy.com, LLC | 10 Aug 2024 | 24 Sep 2024 | 10 Aug 2025 |
| 887 | acwashingfix.com | Hostinger, UAB | 11 Aug 2024 | 23 Sep 2025 | 11 Aug 2025 |
| 888 | acwadwd.com | NameCheap, Inc. | 13 Aug 2024 | 14 Aug 2025 | 13 Aug 2026 |
| 889 | acwacwacwacwcwgerjhgherghoergvergergergerger.icu | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 16 Aug 2024 | 17 Aug 2025 | 16 Aug 2026 |
| 890 | acwapower.cam | NameCheap, Inc. | 20 Aug 2024 | 1 Oct 2025 | 20 Aug 2025 |
| 891 | acwashingmachinefridgedryerservice.shop | NameCheap, Inc. | 19 Aug 2024 | 5 Sep 2024 | 19 Aug 2025 |
| 892 | acwah.top | - | 24 Aug 2024 | - | 24 Aug 2025 |
| 893 | acwashingmachinerepairservices.com | Google, Inc. | 12 Sep 2024 | 24 Nov 2025 | 12 Sep 2025 |
| 894 | acwa-apple.com | NICENIC INTERNATIONAL GROUP CO., LIMITED | 16 Sep 2024 | 26 Nov 2025 | 16 Sep 2025 |
| 895 | acwa-internal.com | NICENIC INTERNATIONAL GROUP CO., LIMITED | 16 Sep 2024 | 26 Nov 2025 | 16 Sep 2025 |
| 896 | acwadrealty.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Sep 2024 | 5 Dec 2025 | 23 Sep 2025 |
| 897 | acwalox.com | Squarespace Domains LLC | 25 Sep 2024 | 10 Sep 2025 | 25 Sep 2026 |
| 898 | acwaclub.vip | Beijing Lanhai Jiye Technology Co., Ltd | 4 Oct 2024 | 17 Oct 2025 | 4 Oct 2025 |
| 899 | acwacoaching.com | Google, Inc. | 7 Oct 2024 | 22 Sep 2025 | 7 Oct 2026 |
| 900 | acwacfilm.com | GoDaddy.com, LLC | 11 Oct 2024 | 11 Oct 2024 | 11 Oct 2026 |
| 901 | acwar.ru | - | 12 Oct 2024 | - | 12 Oct 2025 |
| 902 | acwar.store | Beget LLC | 12 Oct 2024 | 13 Oct 2025 | 12 Oct 2026 |
| 903 | acwalk888z.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Oct 2024 | 18 Oct 2025 | 17 Oct 2026 |
| 904 | acwashing.com | Wix.com Ltd. | 24 Oct 2024 | 24 Sep 2025 | 24 Oct 2026 |
| 905 | acwacquisitions.com | Google, Inc. | 29 Oct 2024 | 14 Oct 2025 | 29 Oct 2026 |
| 906 | acwang.shop | Chengdu West Dimension Digital Technology Co., Ltd… | 4 Nov 2024 | 17 Jan 2025 | 4 Nov 2025 |
| 907 | acwafishing.se | - | 12 Apr 2016 | 29 Mar 2025 | 12 Apr 2026 |
| 908 | acwala.store | Hostinger, UAB | 16 Nov 2024 | 17 Nov 2025 | 16 Nov 2026 |
| 909 | acwashingmachinerefrigerator.org | Hostinger, UAB | 21 Nov 2024 | 21 Nov 2025 | 21 Nov 2026 |
| 910 | acwayalliance.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Nov 2024 | 23 Nov 2025 | 22 Nov 2026 |
| 911 | acwable.com | NameKing.com Inc. | 1 Dec 2024 | 10 Dec 2025 | 1 Dec 2026 |
| 912 | acwakx5.xyz | GoDaddy.com, LLC | 3 Dec 2024 | 4 Dec 2025 | 3 Dec 2026 |
| 913 | acwattups.com | GoDaddy.com, LLC | 3 Dec 2024 | 3 Dec 2025 | 3 Dec 2026 |
| 914 | acwatershed.org | Squarespace Domains LLC | 4 Dec 2024 | 4 Dec 2025 | 4 Dec 2026 |
| 915 | acwayalliance.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Dec 2024 | 9 Dec 2025 | 9 Dec 2026 |
| 916 | acwatlonline.com | Network Solutions, LLC | 11 Dec 2024 | 26 Nov 2025 | 11 Dec 2026 |
| 917 | acwatford.org.uk | - | 10 Dec 2024 | 20 Dec 2024 | 10 Dec 2025 |
| 918 | acwazz.com | Internet Domain Services BS Corp | 13 Apr 2023 | 25 Nov 2025 | 13 Apr 2027 |
| 919 | acwayalliance.ca | - | 9 Dec 2024 | 7 Dec 2025 | 9 Dec 2027 |
| 920 | acwarrest.com | NameCheap, Inc. | 25 Dec 2024 | 16 Dec 2025 | 25 Dec 2026 |
| 921 | acwasteclearanceealing.co.uk | - | 2 Jan 2025 | 2 Jan 2025 | 2 Jan 2026 |
| 922 | acwaacademy.com | Realtime Register B.V. | 5 Jan 2025 | 24 Dec 2025 | 5 Jan 2027 |
| 923 | acwaplus.com | GoDaddy.com, LLC | 8 Jan 2025 | 8 Jan 2025 | 8 Jan 2028 |
| 924 | acwapower.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Jan 2025 | 29 Oct 2025 | 31 Jan 2027 |
| 925 | acwaconsulting.com | NameCheap, Inc. | 31 Jan 2025 | 22 Jul 2025 | 31 Jan 2026 |
| 926 | acwald.com | GoDaddy.com, LLC | 1 Feb 2025 | 27 Feb 2025 | 1 Feb 2028 |
| 927 | acwamerk.homes | - | 4 Feb 2025 | 29 May 2025 | 4 Feb 2026 |
| 928 | acwa-power.com | Cronon AG | 4 Feb 2025 | 26 Mar 2025 | 4 Feb 2026 |
| 929 | acwazafitness.store | DOTSERVE INC. | 7 Feb 2025 | 1 Mar 2025 | 7 Feb 2026 |
| 930 | acwale24x7.com | GoDaddy.com, LLC | 7 Feb 2025 | 7 Feb 2025 | 7 Feb 2026 |
| 931 | acwat.ru | - | 10 Feb 2025 | - | 10 Feb 2026 |
| 932 | acwater-consultants.com | Hostinger, UAB | 18 Feb 2025 | 18 Feb 2025 | 18 Feb 2026 |
| 933 | acwapower.ru | - | 19 Feb 2025 | - | 19 Feb 2026 |
| 934 | acwapower.buzz | Namesilo, LLC | 25 Feb 2025 | 22 Oct 2025 | 25 Feb 2026 |
| 935 | acwaterconsultants.com | Automattic Inc. | 24 Feb 2025 | 23 Nov 2025 | 24 Feb 2026 |
| 936 | acwapower.life | Namesilo, LLC | 25 Feb 2025 | 2 Oct 2025 | - |
| 937 | acwapower.top | Namesilo, LLC | 25 Feb 2025 | 25 Feb 2025 | 25 Feb 2026 |
| 938 | acwarehouse.online | GoDaddy.com, LLC | 26 Feb 2025 | 25 Apr 2025 | 26 Feb 2027 |
| 939 | acwasdhuiwmnkajdslksa16461mkdlsjfoie.com | Beijing Lanhai Jiye Technology Co., Ltd | 28 Feb 2025 | 14 Jan 2026 | 28 Feb 2026 |
| 940 | acwadkliwijncuuimmaldsajojanalkh754jdhdk.com | Beijing Lanhai Jiye Technology Co., Ltd | 28 Feb 2025 | 14 Jan 2026 | 28 Feb 2026 |
| 941 | acwasddjkcuieniucsmnladksa68868sdffsmdkl.com | Beijing Lanhai Jiye Technology Co., Ltd | 28 Feb 2025 | 14 Jan 2026 | 28 Feb 2026 |
| 942 | acwasiuzxcncbzxuicmnnniu.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 Mar 2025 | 15 Jan 2026 | 4 Mar 2026 |
| 943 | acwalla.online | Hostinger, UAB | 6 Mar 2025 | 11 Mar 2025 | 6 Mar 2026 |
| 944 | acwarehousetx.com | GoDaddy.com, LLC | 17 Mar 2025 | 17 Mar 2025 | 17 Mar 2028 |
| 945 | acwala.website | GoDaddy.com, LLC | 21 Mar 2025 | 25 Apr 2025 | 21 Mar 2026 |
| 946 | acway.asia | DNSPod, Inc. | 26 Mar 2025 | 31 Mar 2025 | 26 Mar 2026 |
| 947 | acwadesign.com | GoDaddy.com, LLC | 4 Apr 2025 | 27 Apr 2025 | 4 Apr 2026 |
| 948 | acwacw.cfd | - | 13 Apr 2025 | 28 Jun 2025 | 13 Apr 2026 |
| 949 | acwaddinxveen.nl | - | 4 Apr 2024 | 4 Apr 2024 | - |
| 950 | acwashinmachinerepair.com | Hostinger, UAB | 15 Apr 2025 | 21 Apr 2025 | 15 Apr 2026 |
| 951 | acwaconsulting.online | Synergy Wholesale Pty Ltd | 16 Apr 2025 | 21 Apr 2025 | 16 Apr 2026 |
| 952 | acwasasakura.store | Crazy Domains FZ-LLC | 19 Apr 2025 | - | 19 Apr 2026 |
| 953 | acwala.club | GoDaddy.com, LLC | 23 Apr 2025 | 21 Oct 2025 | 23 Apr 2026 |
| 954 | acwattpower-iot.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 24 Apr 2025 | 25 Apr 2025 | 24 Apr 2026 |
| 955 | acwashingmachinefix.com | Hostinger, UAB | 28 Apr 2025 | 28 Apr 2025 | 28 Apr 2026 |
| 956 | acwagnernonprofit.blog | Automattic Inc. | 1 May 2025 | 20 Nov 2025 | 1 May 2026 |
| 957 | acwamed.pl | - | 28 Apr 2025 | 3 May 2025 | 28 Apr 2026 |
| 958 | acwashingmachinefix.shop | Hostinger, UAB | 3 May 2025 | 3 May 2025 | 3 May 2026 |
| 959 | acwad-techonlogy.com | Hostinger, UAB | 6 May 2025 | 6 May 2025 | 6 May 2026 |
| 960 | acwashingmachinefridgerepair.link | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 May 2025 | 13 May 2025 | 8 May 2026 |
| 961 | acwapparel.com | Squarespace Domains LLC | 11 May 2025 | 11 May 2025 | 11 May 2028 |
| 962 | acwapower.cc | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Aug 2024 | 28 Aug 2025 | 27 Aug 2026 |
| 963 | acwapower-vip.com | CloudFlare, Inc. | 20 May 2025 | 8 Jul 2025 | 20 May 2026 |
| 964 | acwap.online | Synergy Wholesale Pty Ltd | 21 May 2025 | 26 May 2025 | 21 May 2026 |
| 965 | acwajan.xyz | NameCheap, Inc. | 22 May 2025 | 1 Jun 2025 | 22 May 2026 |
| 966 | acwamerica.com | - | 27 May 2025 | 27 May 2025 | 27 May 2026 |
| 967 | acwales.co.uk | - | 27 May 2025 | 13 Jun 2025 | 27 May 2027 |
| 968 | acwaala.xyz | Hostinger, UAB | 11 Jun 2025 | 11 Aug 2025 | - |
| 969 | acwasherrepairpro.com | Web Commerce Communications Limited dba WebNic.cc | 12 Jun 2025 | 12 Jun 2025 | 12 Jun 2026 |
| 970 | acwatu.info | NameCheap, Inc. | 13 Jun 2025 | - | - |
| 971 | acwave.net | - | 12 Jun 2025 | 12 Jun 2025 | 12 Jun 2026 |
| 972 | acwacw.shop | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Jun 2025 | 13 Jun 2025 | 13 Jun 2026 |
| 973 | acwats.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 17 Jun 2025 | 17 Jun 2025 | 17 Jun 2026 |
| 974 | acwacw.beauty | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Jun 2025 | 15 Jul 2025 | 20 Jun 2026 |
| 975 | acwa1.com | Cloud Yuqu LLC | 25 Jun 2025 | 25 Jun 2025 | 25 Jun 2026 |
| 976 | acwalt.com | - | 25 Jun 2025 | 25 Jun 2025 | 25 Jun 2026 |
| 977 | acwairsoft.com | Gandi SAS | 29 Jun 2025 | 29 Jun 2025 | 29 Jun 2026 |
| 978 | acwapowerai.com | - | 4 Jul 2025 | 4 Jul 2025 | 4 Jul 2026 |
| 979 | acwar.org | GoDaddy.com, LLC | 9 Jul 2025 | 14 Jul 2025 | 9 Jul 2026 |
| 980 | acwapower-svip.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 14 Jul 2025 | 14 Jul 2025 | 14 Jul 2026 |
| 981 | acwaprojects.com | NameCheap, Inc. | 23 Jul 2025 | 23 Jul 2025 | 23 Jul 2026 |
| 982 | acwanet.app | Key-Systems GmbH | 25 Jul 2025 | 21 Nov 2025 | 25 Jul 2026 |
| 983 | acwaxacademy.com | GoDaddy.com, LLC | 25 Jul 2025 | 25 Jul 2025 | 25 Jul 2028 |
| 984 | acwaxwellness.com | GoDaddy.com, LLC | 25 Jul 2025 | 25 Jul 2025 | 25 Jul 2028 |
| 985 | acwaspace.com | Realtime Register B.V. | 27 Jul 2025 | 2 Nov 2025 | 27 Jul 2026 |
| 986 | acwaltenbaughservices.com | Hostinger, UAB | 4 Aug 2025 | 4 Aug 2025 | 4 Aug 2026 |
| 987 | acway.day | Dynadot, LLC | 18 Aug 2025 | 23 Aug 2025 | 18 Aug 2026 |
| 988 | acwabd.com | GoDaddy.com, LLC | 24 Aug 2025 | 24 Nov 2025 | 24 Aug 2026 |
| 989 | acwarpower.com | NameCheap, Inc. | 27 Aug 2025 | 27 Aug 2025 | 27 Aug 2026 |
| 990 | acwa-vip.com | Beijing Lanhai Jiye Technology Co., Ltd | 27 Aug 2025 | 15 Jan 2026 | 27 Aug 2026 |
| 991 | acwaa.online | Metaregistrar BV Applications | 28 Aug 2025 | 2 Sep 2025 | 28 Aug 2026 |
| 992 | acwaa.store | Metaregistrar BV Applications | 28 Aug 2025 | 2 Sep 2025 | 28 Aug 2026 |
| 993 | acwaincome.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Aug 2025 | 17 Jan 2026 | 29 Aug 2026 |
| 994 | acwatches.it | - | 25 Feb 2021 | 13 Mar 2025 | 25 Feb 2026 |
| 995 | acwapo-wer.com | NameCheap, Inc. | 5 Sep 2025 | 20 Sep 2025 | 5 Sep 2026 |
| 996 | acwapow-er.com | NameCheap, Inc. | 5 Sep 2025 | 20 Sep 2025 | 5 Sep 2026 |
| 997 | acwale24.com | Hostinger, UAB | 4 Sep 2025 | 20 Sep 2025 | 4 Sep 2028 |
| 998 | acwapowerdonleearm-av.cloud | NameCheap, Inc. | 11 Sep 2025 | 16 Sep 2025 | 11 Sep 2026 |
| 999 | acwashingmachinestoverepairserviceajman.space | NameCheap, Inc. | 13 Sep 2025 | 1 Oct 2025 | 13 Sep 2026 |
| 1000 | acwad.tech | Hostinger, UAB | 14 Sep 2025 | 19 Sep 2025 | 14 Sep 2026 |
Displaying 1,000 out of 1,030 domains starting with the keyword "ACWA". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=acwa
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |