With support for 
Keyword: ACANTH
Reverse Whois » KEYWORD [acanth ] { 1,104 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | acanth.com | TurnCommerce, Inc. DBA NameBright.com | 29 May 2016 | 8 Aug 2025 | 29 May 2025 |
| 2 | acanth.fr | OVH sas | 23 Jan 2014 | 27 May 2023 | 23 Jan 2032 |
| 3 | acanth.sbs | NameCheap, Inc. | 18 Feb 2023 | 30 Apr 2024 | 18 Feb 2024 |
| 4 | acanth.fun | NameCheap, Inc. | 12 Feb 2025 | 3 Mar 2025 | 12 Feb 2026 |
| 5 | acanth.men | NameCheap, Inc. | 17 Feb 2025 | 22 Feb 2025 | 17 Feb 2026 |
| 6 | acanth.irish | NameCheap, Inc. | 3 Jun 2025 | 8 Jun 2025 | 3 Jun 2026 |
| 7 | acanth.watch | NameCheap, Inc. | 18 Jun 2025 | 18 Jun 2025 | 18 Jun 2026 |
| 8 | acanth.live | NameCheap, Inc. | 22 Jun 2025 | 22 Jun 2025 | 22 Jun 2026 |
| 9 | acanth.us | Tucows Domains Inc. | 10 Dec 2024 | 15 Dec 2024 | 10 Dec 2025 |
| 10 | acanthuscaststone.co.uk | - | 14 Feb 2012 | 15 Feb 2025 | 14 Feb 2026 |
| 11 | acanthus.be | - | 6 Feb 1998 | - | - |
| 12 | acanthe-terrain.fr | OVH sas | 4 Oct 2006 | 31 Dec 2024 | 15 Nov 2025 |
| 13 | acanthosisnigricans-options.com | GoDaddy.com, LLC | 27 Sep 2008 | 29 Jan 2015 | 27 Sep 2015 |
| 14 | acanthusfloral.com | GoDaddy.com, LLC | 16 Jan 2020 | 21 Feb 2025 | 16 Jan 2026 |
| 15 | acanthoid.com | Dynadot, LLC | 13 Dec 2024 | 13 Dec 2024 | 13 Dec 2025 |
| 16 | acanthus.biz | Wild West Domains, LLC | 30 Sep 2014 | 27 Jun 2015 | 29 Sep 2015 |
| 17 | acanthopanax.org | GoDaddy.com, LLC | 28 May 2004 | 27 Apr 2017 | 28 May 2018 |
| 18 | acanthopanax.net | Xin Net Technology Corporation | 18 Aug 2014 | 19 Aug 2014 | 18 Aug 2015 |
| 19 | acanthusleaf.com | NameCheap, Inc. | 10 Oct 2017 | 10 Sep 2024 | 10 Oct 2025 |
| 20 | acanthusatelier.com | Hongkong Domain Name Information Management Co., L… | 12 Nov 2021 | 17 Nov 2022 | 12 Nov 2022 |
| 21 | acanthurus.org | NameKing.com Inc. | 12 Feb 2024 | 28 Mar 2025 | 12 Feb 2025 |
| 22 | acanthusmedia.com | Namesilo, LLC | 1 Feb 2019 | 6 Jun 2025 | 1 Feb 2026 |
| 23 | acanthusmanagement.com | register.com, Inc. | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 24 | acanthusworks.com | Hostinger, UAB | 1 Mar 2025 | 1 May 2025 | 1 Mar 2027 |
| 25 | acanthusinc.com | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 26 | acanthe-constructeur.com | Gandi SAS | 29 Sep 2009 | 30 Sep 2014 | 29 Sep 2015 |
| 27 | acanthafireplaces.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 26 May 2022 | 26 May 2022 | 26 May 2023 |
| 28 | acanthia.com | Neubox Internet S.A. de C.V. | 26 Feb 2025 | 28 Apr 2025 | 26 Feb 2026 |
| 29 | acantha-records.com | united-domains AG | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 30 | acanthe-formation91.com | OVH sas | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 31 | acanthusarts.com | NameCheap, Inc. | 11 Dec 2024 | 29 Jan 2025 | 11 Dec 2025 |
| 32 | acanthocereustetragonus.us | Internet.bs Corp. | 7 Oct 2014 | 7 Oct 2014 | 6 Oct 2015 |
| 33 | acanthusgrouppr.com | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 34 | acanthusandcompany.com | Brandon Gray Internet Services, Inc. (dba NameJuic… | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 35 | acantheose.com | 1&1 Internet AG | 1 Dec 2014 | 2 Dec 2020 | 1 Dec 2025 |
| 36 | acanthaceae.com | Dynadot, LLC | 16 Jul 2024 | 17 Jul 2025 | 16 Jul 2026 |
| 37 | acanthahotel.com | Papaki Ltd. | 11 Dec 2014 | 28 Nov 2024 | 11 Dec 2025 |
| 38 | acanthe-lesautres.com | eNom, Inc. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 39 | acanthusarchitects.us | Tucows Domains Inc. | 21 Dec 2012 | 24 Dec 2014 | 20 Dec 2014 |
| 40 | acanthusarchitects.net | Tucows Domains Inc. | 21 Dec 2012 | 25 Dec 2014 | 21 Dec 2015 |
| 41 | acanthus2015.com | GoDaddy.com, LLC | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2015 |
| 42 | acanthite.net | Gandi SAS | 2 Jan 2015 | 28 Nov 2024 | 2 Jan 2026 |
| 43 | acanthusdesign.xyz | Network Solutions, LLC | 22 Jul 2014 | 22 Jul 2014 | 22 Jul 2015 |
| 44 | acanthusarch.xyz | Network Solutions, LLC | 19 Jul 2014 | 21 Jul 2014 | 19 Jul 2015 |
| 45 | acanthis-laboratoire.bio | OVH sas | 22 Aug 2014 | 6 Oct 2024 | 22 Aug 2025 |
| 46 | acanthe-pyrenees.immo | Nameshield SAS | 10 Dec 2014 | 6 Jan 2017 | 10 Dec 2017 |
| 47 | acantho.villas | Marcaria.com International, Inc. | 20 Jan 2015 | 3 Apr 2017 | 20 Jan 2018 |
| 48 | acantho.cruises | Marcaria.com International, Inc. | 20 Jan 2015 | 3 Apr 2017 | 20 Jan 2018 |
| 49 | acanthous.top | OnlineNIC, Inc. | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2016 |
| 50 | acanthopterygii.com | NameCheap, Inc. | 2 Aug 2021 | - | 2 Aug 2022 |
| 51 | acantha.solutions | Tucows Domains Inc. | 22 Jul 2015 | 27 Jul 2025 | 22 Jul 2026 |
| 52 | acanthite.science | Alpnames Limited | 21 Jul 2015 | 21 Jul 2015 | 20 Jul 2016 |
| 53 | acanthoid.faith | Alpnames Limited | 7 Aug 2015 | - | 6 Aug 2016 |
| 54 | acanthashop.com | GoDaddy.com, LLC | 7 Feb 2022 | 20 Mar 2024 | 7 Feb 2024 |
| 55 | acanthustyle.com | eNom, Inc. | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 56 | acanthussoapworks.com | Domaincomesaround.com LLC | 1 Jan 2020 | 2 Jan 2020 | 1 Jan 2021 |
| 57 | acantha.life | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 58 | acanthus-garden.info | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 59 | acanthushomeandgarden.com | FastDomain Inc. | 1 Mar 2015 | 1 Mar 2015 | 1 Mar 2016 |
| 60 | acanthosisnigricans.com | GoDaddy.com, LLC | 6 Sep 2019 | 18 Oct 2024 | 6 Sep 2024 |
| 61 | acanthustech.com | 1API GmbH | 1 Jun 2016 | 1 Jun 2025 | 1 Jun 2026 |
| 62 | acanthocephala.com | - | 23 Aug 2022 | 24 Aug 2023 | 23 Aug 2024 |
| 63 | acanthuscoop.com | Tucows Domains Inc. | 18 Mar 2014 | 8 Mar 2017 | 18 Mar 2018 |
| 64 | acantha-conseils.com | Gandi SAS | 27 Aug 2012 | 31 Jul 2017 | 27 Aug 2019 |
| 65 | acanthadesign.com | GoDaddy.com, LLC | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2016 |
| 66 | acanthae.com | CloudFlare, Inc. | 22 Sep 2019 | 16 Mar 2024 | 22 Sep 2025 |
| 67 | acanthusbook.com | DreamHost, LLC | 15 Apr 2015 | 14 Mar 2016 | 15 Apr 2018 |
| 68 | acanthusart.click | GMO Internet Inc. | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 69 | acanthusbuildersltd.com | Webfusion Ltd. | 9 Sep 2015 | 24 Sep 2015 | 9 Sep 2017 |
| 70 | acanthusfilms.com | 1&1 Internet AG | 10 May 2015 | 14 Jul 2016 | 10 May 2026 |
| 71 | acanthissime.com | Key-Systems GmbH | 22 May 2015 | 23 May 2017 | 22 May 2018 |
| 72 | acanthopodious.com | eNom, Inc. | 26 May 2015 | 26 May 2015 | 26 May 2016 |
| 73 | acanthouseholditems.com | Melbourne IT, Ltd | 14 Sep 2015 | 15 Sep 2015 | 14 Sep 2016 |
| 74 | acanthophoenix-spot.com | 1&1 Internet AG | 1 Jun 2015 | 20 Dec 2017 | 1 Jun 2026 |
| 75 | acanthopterygious.com | register.com, Inc. | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 76 | acanthopterygian.com | TurnCommerce, Inc. DBA NameBright.com | 28 Nov 2019 | 22 Nov 2020 | 28 Nov 2025 |
| 77 | acanthussanjuan.com | Tucows Domains Inc. | 14 Jul 2024 | 18 Jul 2025 | 14 Jul 2026 |
| 78 | acantha-bijoux.com | OVH sas | 13 Jun 2015 | 15 Apr 2017 | 13 Jun 2018 |
| 79 | acanthas.com | Firstserver, Inc. | 15 Sep 2015 | 18 Sep 2015 | 15 Sep 2016 |
| 80 | acanthusgarden.com | FastDomain Inc. | 14 Jun 2015 | 14 Jun 2015 | 14 Jun 2016 |
| 81 | acanthushardware.org | GoDaddy.com, LLC | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2016 |
| 82 | acanthustudio.com | 1&1 Internet AG | 15 Jun 2015 | 16 Jun 2016 | 15 Jun 2018 |
| 83 | acanthushardware.net | GoDaddy.com, LLC | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2016 |
| 84 | acanthushardware.info | GoDaddy.com, LLC | 13 Jun 2015 | - | 13 Jun 2016 |
| 85 | acanthity.com | Dynadot, LLC | 23 Nov 2021 | 23 Nov 2021 | 23 Nov 2022 |
| 86 | acanthopanax.com | GoDaddy.com, LLC | 17 May 2010 | 10 Jun 2025 | 17 May 2026 |
| 87 | acanthin.com | Tucows Domains Inc. | 2 Jul 2015 | 3 Jun 2025 | 2 Jul 2026 |
| 88 | acanthos.org | Tucows Domains Inc. | 3 Jul 2013 | 3 Jul 2017 | 3 Jul 2018 |
| 89 | acanthopteri.com | eNom, Inc. | 13 Jul 2015 | 13 Jul 2015 | 13 Jul 2016 |
| 90 | acanthuskwartet.com | register.com, Inc. | 15 Jul 2015 | 15 Jun 2017 | 15 Jul 2018 |
| 91 | acanthusphoto.com | Tucows Domains Inc. | 17 Dec 2016 | 30 Apr 2025 | 17 Dec 2025 |
| 92 | acanthous.racing | Alpnames Limited | 28 Sep 2015 | - | 27 Sep 2016 |
| 93 | acanthophorous.com | register.com, Inc. | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 94 | acanthopomatous.xyz | NameCheap, Inc. | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 95 | acanthocephalous.xyz | NameCheap, Inc. | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 96 | acanthocephalan.xyz | NameCheap, Inc. | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 97 | acanthusarchitecture.com | Squarespace Domains LLC | 16 Jun 2025 | 9 Jul 2025 | 16 Jun 2026 |
| 98 | acanthusrealty.com | GoDaddy.com, LLC | 6 Aug 2015 | 6 Aug 2015 | 6 Aug 2017 |
| 99 | acanthusgolfclub.com | Webfusion Ltd. | 7 Aug 2015 | 1 Aug 2016 | 7 Aug 2017 |
| 100 | acanthusflorals.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Oct 2015 | 26 Oct 2016 | 10 Oct 2017 |
| 101 | acanthe-fashionmag.com | Gandi SAS | 5 Oct 2015 | 5 Oct 2015 | 5 Oct 2016 |
| 102 | acanthuscaststoneltd.com | eNom, Inc. | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2017 |
| 103 | acanthopterygianrecuperativecarpentaria.xyz | NameCheap, Inc. | 17 Oct 2015 | 17 Oct 2015 | 17 Oct 2016 |
| 104 | acanthopore.com | NameCheap, Inc. | 28 Jul 2024 | 29 Jul 2025 | 28 Jul 2026 |
| 105 | acanthium.com | CloudFlare, Inc. | 9 Aug 2021 | 21 Jul 2025 | 9 Aug 2026 |
| 106 | acanthosaura.xyz | Hostinger, UAB | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 107 | acanthisitta.win | Alpnames Limited | 6 Nov 2015 | - | 5 Nov 2016 |
| 108 | acanthis.biz | Key-Systems GmbH | 17 Nov 2015 | 7 Nov 2024 | 16 Nov 2025 |
| 109 | acanthes.xyz | NETIM SARL | 16 Nov 2015 | 19 Oct 2024 | 16 Nov 2025 |
| 110 | acanthamoeba.org | GoDaddy.com, LLC | 17 Nov 2015 | 2 Nov 2024 | 17 Nov 2025 |
| 111 | acanthium.racing | Alpnames Limited | 26 Nov 2015 | - | 25 Nov 2016 |
| 112 | acanthion.loan | Alpnames Limited | 29 Nov 2015 | - | 28 Nov 2016 |
| 113 | acanthocarpous.com | Dynadot, LLC | 26 Nov 2015 | 26 Nov 2015 | 26 Nov 2016 |
| 114 | acanthushealth.com | Realtime Register B.V. | 3 Aug 2021 | 4 Aug 2021 | 3 Aug 2022 |
| 115 | acanthusart.com | GoDaddy.com, LLC | 27 Sep 2024 | 14 Mar 2025 | 27 Sep 2027 |
| 116 | acanthused.com | Wild West Domains, LLC | 7 Dec 2015 | 7 Dec 2015 | 7 Dec 2020 |
| 117 | acantheor.com | PSI-USA, Inc. dba Domain Robot | 1 Dec 2020 | 1 Dec 2020 | 1 Dec 2021 |
| 118 | acanthuses.com | register.com, Inc. | 8 Dec 2015 | 25 Jan 2017 | 8 Dec 2017 |
| 119 | acanthaceous.info | GoDaddy.com, LLC | 17 Dec 2015 | - | 17 Dec 2016 |
| 120 | acanthoma.science | Alpnames Limited | 18 Dec 2015 | - | 17 Dec 2016 |
| 121 | acanthe-uniformes.com | OVH sas | 18 Dec 2015 | 19 Dec 2024 | 18 Dec 2025 |
| 122 | acanthe-uniforme.com | OVH sas | 18 Dec 2015 | 19 Dec 2024 | 18 Dec 2025 |
| 123 | acanthusadvisers.com | GoDaddy.com, LLC | 19 Jun 2020 | 19 Jun 2020 | 19 Jun 2021 |
| 124 | acanthaceous.com | register.com, Inc. | 24 Dec 2015 | 24 Dec 2015 | 24 Dec 2016 |
| 125 | acanthusantiques.us | 1&1 Internet AG | 27 Dec 2015 | - | 26 Dec 2016 |
| 126 | acanthus2016.com | GoDaddy.com, LLC | 28 Dec 2015 | 28 Dec 2015 | 28 Dec 2016 |
| 127 | acanthusfacilitair.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 9 Jan 2016 | 19 Jul 2025 | 9 Jan 2026 |
| 128 | acanthe-formation.com | Internet Domain Services BS Corp | 4 Mar 2025 | 4 Mar 2025 | 4 Mar 2026 |
| 129 | acanthine.com | register.com, Inc. | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 130 | acanthusmagazine.com | Hostinger, UAB | 29 Jun 2024 | 30 Jun 2025 | 29 Jun 2026 |
| 131 | acanthusmassage.com | Dynamic Network Services, Inc. | 21 Jan 2016 | 15 Jan 2017 | 21 Jan 2018 |
| 132 | acanthuspark.com | Xin Net Technology Corporation | 14 Apr 2018 | 14 Apr 2018 | 14 Apr 2019 |
| 133 | acanthopterygian.xyz | NameCheap, Inc. | 29 Jan 2016 | 29 Jan 2016 | 29 Jan 2017 |
| 134 | acanthopterous.com | Dynadot, LLC | 6 Sep 2024 | 6 Sep 2024 | 6 Sep 2025 |
| 135 | acanthosaura.com | - | 12 Oct 2022 | 14 Dec 2023 | 12 Oct 2023 |
| 136 | acanthusheritageplastering.com | Domain.com, LLC | 15 Feb 2016 | 7 Feb 2025 | 15 Feb 2026 |
| 137 | acanthus-heritage-plastering.com | Domain.com, LLC | 15 Feb 2016 | 7 Feb 2025 | 15 Feb 2026 |
| 138 | acanthamoeba.com | Xin Net Technology Corporation | 19 Apr 2018 | 19 Apr 2018 | 19 Apr 2019 |
| 139 | acanthusherbs.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Feb 2016 | 4 Feb 2025 | 17 Feb 2026 |
| 140 | acantha.cz | REG.BG OOD | 2 Mar 2005 | 20 Feb 2015 | 2 Mar 2017 |
| 141 | acanthustechnology.com | GoDaddy.com, LLC | 13 Jun 2012 | 14 Jun 2025 | 13 Jun 2026 |
| 142 | acanthosisbagginess.net | Uniregistrar Corp | 2 Mar 2016 | 2 Mar 2016 | 2 Mar 2017 |
| 143 | acanthe-boutique.com | GoDaddy.com, LLC | 2 Mar 2016 | 2 Mar 2016 | 2 Mar 2017 |
| 144 | acanthopomatousovermaturityimprovably.site | TLD Registrar Solutions Ltd. | 26 Nov 2015 | 6 Jan 2016 | 26 Nov 2016 |
| 145 | acanthus.design | GoDaddy.com, LLC | 12 Dec 2021 | 17 Jul 2024 | 12 Dec 2026 |
| 146 | acanthusflowers.com | Wild West Domains, LLC | 16 Jun 2021 | 16 Jun 2021 | 16 Jun 2022 |
| 147 | acanthi.com | GoDaddy.com, LLC | 1 Oct 1999 | 21 Sep 2022 | 1 Oct 2029 |
| 148 | acanthus.com | Gandi SAS | 26 Jul 1996 | 27 Jun 2024 | 25 Jul 2027 |
| 149 | acanthsend.red | Alpnames Limited | 25 Mar 2016 | 25 Mar 2016 | 25 Mar 2017 |
| 150 | acanthusproducts.com | Wild West Domains, LLC | 25 Mar 2016 | 31 Mar 2024 | 25 Mar 2025 |
| 151 | acanthus-art.com | Gandi SAS | 30 Mar 2016 | 28 Feb 2017 | 30 Mar 2018 |
| 152 | acanthae.net | NameCheap, Inc. | 3 Apr 2016 | 4 Mar 2025 | 3 Apr 2026 |
| 153 | acanthus.xyz | - | 2 Sep 2022 | 18 Oct 2024 | 2 Sep 2025 |
| 154 | acanthusapparelshop.com | HiChina Zhicheng Technology Limited | 22 Jun 2019 | 30 Jul 2020 | 22 Jun 2020 |
| 155 | acanthus-books.com | GoDaddy.com, LLC | 28 Jan 1999 | 30 Apr 2025 | 29 Apr 2026 |
| 156 | acanthiza.net | Synergy Wholesale Pty Ltd | 13 Apr 2016 | 13 Apr 2016 | 13 Apr 2018 |
| 157 | acanthiza.com | Synergy Wholesale Pty Ltd | 13 Apr 2016 | 13 Apr 2016 | 13 Apr 2018 |
| 158 | acanthurus-technology.com | RegistryGate GmbH | 16 Apr 2016 | 21 May 2025 | 16 Apr 2026 |
| 159 | acanthodeiyou.xyz | TLD Registrar Solutions Ltd. | 19 Apr 2016 | 19 Apr 2016 | 19 Apr 2017 |
| 160 | acanthe-travaux.com | Hosting Concepts B.V. dba Openprovider | 15 Feb 2005 | 19 Jul 2025 | 15 Feb 2026 |
| 161 | acanthusresaerch.com | Namesilo, LLC | 1 May 2016 | 31 Jan 2018 | 1 May 2018 |
| 162 | acanthehotel.review | Alpnames Limited | 5 May 2016 | 5 May 2016 | 4 May 2017 |
| 163 | acanthiovirtual.xyz | NameCheap, Inc. | 6 May 2016 | 18 Jul 2017 | 6 May 2018 |
| 164 | acanthusonline.com | NameCheap, Inc. | 18 May 2016 | 18 Apr 2025 | 18 May 2026 |
| 165 | acanthuseu.com | - | 20 May 2016 | 20 May 2016 | 20 May 2017 |
| 166 | acanthussiliceous.xyz | - | 10 May 2016 | 10 May 2016 | 10 May 2017 |
| 167 | acanthodeararebit.site | - | 9 May 2016 | 9 May 2016 | 9 May 2017 |
| 168 | acanthus.one | Namesilo, LLC | 23 Apr 2016 | 22 Apr 2017 | 23 Apr 2018 |
| 169 | acanthusclews.co.uk | - | 1 Nov 1999 | 2 Oct 2024 | 1 Nov 2026 |
| 170 | acanthsend114.top | Alpnames Limited | 27 May 2016 | 27 May 2016 | 27 May 2017 |
| 171 | acanthuses.xyz | Uniregistrar Corp | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 172 | acanthous.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 173 | acanthou.xyz | OnlineNIC, Inc. | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 174 | acanthostyles.xyz | Gandi SAS | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 175 | acanthoids.xyz | OnlineNIC, Inc. | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 176 | acanthia.xyz | OnlineNIC, Inc. | 1 Jun 2016 | 1 Jun 2016 | 1 Jun 2017 |
| 177 | acanthamoeba.xyz | Gandi SAS | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 178 | acanthodian.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 179 | acanthocytosis.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 180 | acanthes.net | DropCatch.com 369 LLC | 16 Sep 2017 | 16 Sep 2017 | 16 Sep 2018 |
| 181 | acanthuspublishing.info | Network Solutions, LLC | 8 Jun 2016 | 8 Jun 2016 | 8 Jun 2017 |
| 182 | acanthuscannabis.com | GoDaddy.com, LLC | 8 Jul 2016 | 8 Jul 2016 | 8 Jul 2017 |
| 183 | acanthasystems.com | GoDaddy.com, LLC | 9 Jul 2016 | 9 Jul 2016 | 9 Jul 2017 |
| 184 | acanthaceous.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 12 Jun 2016 | 2 Jun 2017 |
| 185 | acanthocyte.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 12 Jun 2016 | 2 Jun 2017 |
| 186 | acanthodianbearded.xyz | - | 22 Jun 2016 | 22 Jun 2016 | 22 Jun 2017 |
| 187 | acanthusassociates.biz | GoDaddy.com, LLC | 9 Dec 2005 | 10 Jun 2024 | 8 Dec 2025 |
| 188 | acanthus.online | GoDaddy.com, LLC | 5 Jul 2024 | 20 Jul 2025 | 5 Jul 2026 |
| 189 | acanthuscaput.com | PSI-USA, Inc. dba Domain Robot | 22 Oct 2009 | 11 Dec 2024 | 22 Oct 2025 |
| 190 | acanthusdesigns.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Jan 2024 | 3 Jul 2025 | 19 Jan 2026 |
| 191 | acanthusinfotech.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Feb 2022 | 27 Jun 2025 | 19 Feb 2026 |
| 192 | acanthebienetre.com | PSI-USA, Inc. dba Domain Robot | 2 Apr 2021 | 5 Apr 2021 | 2 Apr 2022 |
| 193 | acanthus-hotel-consultancy.com | PSI-USA, Inc. dba Domain Robot | 29 Jun 2023 | 28 Jun 2024 | 29 Jun 2024 |
| 194 | acanthe-paris.com | OVH sas | 29 Jun 2009 | 30 Jun 2024 | 29 Jun 2026 |
| 195 | acanthusfurniture.com | Melbourne IT, Ltd | 11 Aug 2003 | 11 Aug 2025 | 11 Aug 2026 |
| 196 | acanthusdev.com | GoDaddy.com, LLC | 3 Dec 2013 | 4 Dec 2023 | 3 Dec 2028 |
| 197 | acanthusconstruction.com | TurnCommerce, Inc. DBA NameBright.com | 11 Oct 2011 | 5 Oct 2020 | 11 Oct 2025 |
| 198 | acanthusantiques.com | Network Solutions, LLC | 18 May 2000 | 19 Mar 2024 | 18 May 2029 |
| 199 | acanthuslodge.com | Tucows Domains Inc. | 5 Mar 2009 | 9 Mar 2019 | 5 Mar 2019 |
| 200 | acanthe-textile.com | OVH sas | 24 Feb 2006 | 25 Feb 2025 | 24 Feb 2026 |
| 201 | acanthis-laboratoire.com | OVH sas | 18 Mar 2008 | 19 Mar 2025 | 18 Mar 2026 |
| 202 | acanthe-conseil.com | 1&1 Internet AG | 7 Jan 2013 | 20 Sep 2022 | 7 Jan 2026 |
| 203 | acanthus-facilitaire-dienstverlening.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 22 Mar 2012 | 21 May 2023 | 22 Mar 2023 |
| 204 | acanthusda.com | Tucows Domains Inc. | 20 May 2013 | 20 Apr 2025 | 20 May 2026 |
| 205 | acanthisviaggi.com | Corehub, S.R.L. | 19 Jun 2001 | 20 Jun 2024 | 19 Jun 2026 |
| 206 | acanthus-reed.com | Network Solutions, LLC | 2 Mar 2000 | 4 Jan 2025 | 2 Mar 2030 |
| 207 | acanthe-pertuis.com | Gandi SAS | 5 Feb 2010 | 3 Feb 2017 | 5 Feb 2018 |
| 208 | acanthuslighting.com | eNom, Inc. | 5 Sep 2002 | 29 Aug 2024 | 5 Sep 2025 |
| 209 | acanthuspr.com | GoDaddy.com, LLC | 25 May 2010 | 26 May 2025 | 25 May 2026 |
| 210 | acanthusfrenchpolishing.com | Webfusion Ltd. | 25 Apr 2011 | 18 Apr 2017 | 25 Apr 2019 |
| 211 | acanthusinternational.com | GoDaddy.com, LLC | 22 Jul 2009 | 23 Jul 2024 | 22 Jul 2026 |
| 212 | acanthe-sol.com | Gandi SAS | 5 Feb 2001 | 5 Feb 2025 | 5 Feb 2032 |
| 213 | acantho-turismo.com | - | 18 Oct 2024 | 21 May 2025 | 18 Oct 2025 |
| 214 | acanthvs.com | GMO Internet Inc. | 17 Jul 2014 | 25 May 2017 | 16 Jul 2018 |
| 215 | acanthus-sf.com | Squarespace Domains LLC | 2 Apr 2008 | 18 Mar 2025 | 2 Apr 2026 |
| 216 | acanthe-menuiserie-28.com | Namebay SAM | 7 Oct 2011 | 8 Sep 2015 | 7 Oct 2016 |
| 217 | acanthe-sas.com | Gandi SAS | 6 Apr 2012 | 2 Apr 2025 | 6 Apr 2026 |
| 218 | acanthusfurnituredesign.com | FastDomain Inc. | 10 Oct 2009 | 10 Oct 2016 | 10 Oct 2017 |
| 219 | acanthusinteriordesign.com | Webfusion Ltd. | 26 Jan 2008 | 22 Jan 2025 | 26 Jan 2027 |
| 220 | acanthe-biotech.com | 1&1 Internet AG | 13 May 2009 | 14 May 2016 | 13 May 2018 |
| 221 | acanthusbooks.com | GoDaddy.com, LLC | 29 Apr 2004 | 30 Apr 2025 | 29 Apr 2026 |
| 222 | acanthus-designs.com | Google, Inc. | 19 May 2008 | 4 May 2025 | 19 May 2026 |
| 223 | acanthusfloralart.com | Squarespace Domains LLC | 12 Nov 2008 | 24 Apr 2022 | 12 Nov 2027 |
| 224 | acanthushardware.com | GoDaddy.com, LLC | 16 Jun 2013 | 13 Jun 2015 | 16 Jun 2019 |
| 225 | acanthe-evenement.com | Gandi SAS | 8 Jan 2008 | 8 Dec 2024 | 8 Jan 2026 |
| 226 | acanthus-architects.com | 1&1 Internet AG | 29 Jan 2009 | 22 May 2025 | 29 Jan 2026 |
| 227 | acanthusbloemen.com | The Registrar Company B.V. | 25 Aug 2011 | 16 Apr 2025 | 25 Aug 2026 |
| 228 | acanthusplants.com | GMO Internet Inc. | 15 Aug 2021 | 16 Aug 2021 | 15 Aug 2022 |
| 229 | acanthicus.com | eNom, Inc. | 17 Jul 2013 | 2 Jul 2025 | 17 Jul 2027 |
| 230 | acanthus-corporation.com | Japan Registry Services Co., Ltd. | 10 Jun 2010 | 24 Apr 2025 | 10 Jun 2026 |
| 231 | acanthusarch.com | Network Solutions, LLC | 19 Mar 2002 | 26 Jan 2024 | 19 Mar 2029 |
| 232 | acanthusdecor.com | DreamHost, LLC | 9 Jun 2020 | 9 Jun 2020 | 9 Jun 2021 |
| 233 | acanthusaccountancy.com | Register.it SPA | 9 Oct 2008 | 9 Oct 2024 | 9 Oct 2026 |
| 234 | acanthoph.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Dec 2007 | 9 Jul 2025 | 10 Dec 2025 |
| 235 | acanthusstudio.com | Network Solutions, LLC | 10 Jun 1999 | 11 Apr 2025 | 10 Jun 2026 |
| 236 | acanthe-atelier.com | Online SAS | 18 Nov 2004 | 20 Sep 2017 | 18 Nov 2018 |
| 237 | acanthusinterior.com | OnlineNIC, Inc. | 26 Mar 2008 | 19 Mar 2025 | 26 Mar 2026 |
| 238 | acanthaclemons.com | register.com, Inc. | 8 Nov 2010 | 8 Nov 2010 | 8 Nov 2020 |
| 239 | acanthusstudios.com | Synergy Wholesale Pty Ltd | 13 Mar 2022 | 13 Jun 2024 | 13 Mar 2026 |
| 240 | acanthera.com | GoDaddy.com, LLC | 31 Mar 2013 | 31 Mar 2013 | 31 Mar 2018 |
| 241 | acanthusarchgroup.com | GoDaddy.com, LLC | 20 Mar 2008 | 21 Mar 2024 | 20 Mar 2026 |
| 242 | acanthuswsm.com | Tucows Domains Inc. | 4 Aug 2003 | 5 Jul 2025 | 4 Aug 2026 |
| 243 | acanthes.com | GoDaddy.com, LLC | 14 May 1998 | 5 May 2025 | 13 May 2026 |
| 244 | acanthe-deco.com | NordNet SA | 26 Feb 2010 | 26 Feb 2025 | 26 Feb 2026 |
| 245 | acanthes-biarritz.com | NordNet SA | 22 Sep 2005 | 22 Sep 2017 | 22 Sep 2018 |
| 246 | acanthum.com | Soluciones Corporativas IP, SLU | 24 Dec 2010 | 16 Mar 2025 | 24 Dec 2027 |
| 247 | acanthus-demo.com | Namesilo, LLC | 6 May 2022 | 7 May 2023 | 6 May 2024 |
| 248 | acanthushome.com | Squarespace Domains LLC | 25 Jun 2018 | 3 May 2025 | 25 Jun 2027 |
| 249 | acanthus-holidays.com | Tucows Domains Inc. | 17 Jan 2006 | 21 Jan 2020 | 17 Jan 2020 |
| 250 | acanthussa.com | GoDaddy.com, LLC | 20 Mar 2014 | 20 Mar 2014 | 20 Mar 2019 |
| 251 | acanthys.com | Hostinger, UAB | 27 Jun 2022 | 7 Aug 2023 | 27 Jun 2023 |
| 252 | acanthe-terrain.com | OVH sas | 3 Oct 2006 | 4 Oct 2024 | 3 Oct 2025 |
| 253 | acanthushotel.com | Inames Co. Ltd. | 6 Apr 2010 | 4 Aug 2025 | 6 Apr 2027 |
| 254 | acanthus-advance.com | Tucows Domains Inc. | 10 Mar 2008 | 14 Mar 2020 | 10 Mar 2020 |
| 255 | acanthus-osaka.com | GMO Internet Inc. | 6 Dec 2010 | 17 Jan 2025 | 6 Dec 2024 |
| 256 | acanthe-ebenisterie.com | DNSPod, Inc. | 5 Jan 2022 | 7 Jan 2022 | 5 Jan 2023 |
| 257 | acanthus6.com | Web Commerce Communications Limited dba WebNic.cc | 5 Jul 2022 | 14 Sep 2023 | 5 Jul 2023 |
| 258 | acanthe-versailles.com | Gandi SAS | 16 Jan 2006 | 19 Oct 2024 | 16 Jan 2027 |
| 259 | acanthite.com | Dynadot, LLC | 9 Mar 2023 | 9 Mar 2025 | 9 Mar 2026 |
| 260 | acanthara.com | Domain.com, LLC | 17 Jan 2017 | 17 Jan 2017 | 17 Jan 2018 |
| 261 | acanthedeveloppement.com | DropCatch.com 874 LLC | 11 Sep 2019 | 11 Sep 2019 | 11 Sep 2020 |
| 262 | acanthainternational.com | Tucows Domains Inc. | 14 Jan 2008 | 2 Jan 2025 | 14 Jan 2026 |
| 263 | acanthusapparel.com | GoDaddy.com, LLC | 26 Oct 2006 | 27 Oct 2024 | 26 Oct 2025 |
| 264 | acanthique.com | OVH sas | 20 Sep 1999 | 21 Sep 2024 | 20 Sep 2025 |
| 265 | acanthos.com | DropCatch.com 854 LLC | 30 Nov 2024 | 30 Nov 2024 | 30 Nov 2025 |
| 266 | acanthusartisan.com | GoDaddy.com, LLC | 1 Dec 2013 | 1 Dec 2013 | 1 Dec 2018 |
| 267 | acantho.com | Tucows Domains Inc. | 24 May 2001 | 19 Jun 2025 | 24 May 2026 |
| 268 | acanthusworkshop.com | Gandi SAS | 27 Sep 2011 | 29 Jul 2025 | 27 Sep 2025 |
| 269 | acanthusdecorations.com | GoDaddy.com, LLC | 28 Feb 2006 | 23 Feb 2015 | 28 Feb 2017 |
| 270 | acanthusreed.com | Network Solutions, LLC | 11 Jun 2009 | 17 Jul 2016 | 11 Jun 2017 |
| 271 | acanthusproductions.com | GoDaddy.com, LLC | 23 Feb 2009 | 5 Sep 2022 | 23 Feb 2028 |
| 272 | acanthe-lux.com | Network Solutions, LLC | 18 Jun 2007 | 24 Jun 2016 | 18 Jun 2017 |
| 273 | acanthoma.com | GoDaddy.com, LLC | 14 Sep 2007 | 15 Sep 2024 | 14 Sep 2025 |
| 274 | acanthe-terrains.com | OVH sas | 3 Oct 2006 | 4 Oct 2024 | 3 Oct 2025 |
| 275 | acanthedor.com | Dynadot4 LLC | 5 Oct 2021 | 6 Oct 2021 | 5 Oct 2022 |
| 276 | acanthedg.com | Beijing Lanhai Jiye Technology Co., Ltd | 24 Dec 2024 | 9 Aug 2025 | 24 Dec 2025 |
| 277 | acanthe-immo.com | OVH sas | 12 Mar 1998 | 12 Mar 2025 | 11 Mar 2026 |
| 278 | acanthusinteriors.com | Gandi SAS | 5 Oct 2006 | 7 Aug 2024 | 5 Oct 2031 |
| 279 | acanthalang.com | Namesilo, LLC | 25 Feb 2012 | 26 Jan 2025 | 25 Feb 2027 |
| 280 | acanthusig.com | GoDaddy.com, LLC | 16 Apr 2007 | 28 Apr 2024 | 16 Apr 2025 |
| 281 | acanthurus.com | TurnCommerce, Inc. DBA NameBright.com | 7 Jul 2013 | 1 Jul 2020 | 7 Jul 2025 |
| 282 | acanthusappraisals.com | Hostinger, UAB | 7 Nov 2008 | 8 Oct 2024 | 7 Nov 2026 |
| 283 | acanthusltd.com | GoDaddy.com, LLC | 1 May 2001 | 21 Jan 2025 | 20 Jan 2026 |
| 284 | acanthusmfg.com | GoDaddy.com, LLC | 30 Apr 2017 | 30 Apr 2017 | 30 Apr 2018 |
| 285 | acanthe-mobilier.com | Gandi SAS | 18 Aug 2011 | 18 Jul 2024 | 18 Aug 2025 |
| 286 | acanthusconsulting.com | DomainPicking LLC | 4 Apr 2014 | 5 Apr 2017 | 4 Apr 2018 |
| 287 | acantheavocats.com | OVH sas | 19 Feb 2008 | 30 Dec 2016 | 19 Feb 2018 |
| 288 | acanthusfabrics.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Jun 2017 | 28 Jul 2019 | 16 Jun 2019 |
| 289 | acantha.com | GoDaddy.com, LLC | 14 Nov 2001 | 10 Dec 2024 | 14 Nov 2025 |
| 290 | acanthaster.com | NameCheap, Inc. | 2 Feb 2025 | 2 Feb 2025 | 2 Feb 2026 |
| 291 | acanthusinn.com | NameCheap, Inc. | 17 Jun 2002 | 18 May 2025 | 17 Jun 2026 |
| 292 | acanthusmake.com | Crazy Domains FZ-LLC | 13 May 2013 | 24 Jun 2023 | 13 May 2023 |
| 293 | acantheschool.com | GoDaddy.com, LLC | 7 Jun 2009 | 19 Jul 2025 | 7 Jun 2025 |
| 294 | acanthus-interiors.com | Dynamic Network Services, Inc. | 8 May 2004 | 2 May 2017 | 8 May 2019 |
| 295 | acanthusleaves.com | Fabulous.com Pty Ltd. | 17 Feb 2005 | 17 Feb 2016 | 17 Feb 2017 |
| 296 | acanthaonline.com | Namesilo, LLC | 26 Sep 2005 | 27 Aug 2024 | 26 Sep 2025 |
| 297 | acanthuscountryliving.com | register.com, Inc. | 2 Aug 2011 | 20 Jul 2024 | 2 Aug 2026 |
| 298 | acanthusgardendesigns.com | NameCheap, Inc. | 22 Jan 2020 | 23 Dec 2024 | 22 Jan 2026 |
| 299 | acanthea.com | 1&1 Internet AG | 30 Dec 2006 | 30 Dec 2016 | 30 Dec 2025 |
| 300 | acanthusassociates.com | GoDaddy.com, LLC | 9 Dec 2005 | 15 Nov 2022 | 9 Dec 2025 |
| 301 | acanthus-tours.com | Mesh Digital Limited | 20 Nov 2001 | 19 Nov 2024 | 20 Nov 2025 |
| 302 | acanthusgolf.com | Namesilo, LLC | 18 Mar 2019 | 19 Mar 2019 | 18 Mar 2020 |
| 303 | acanthussuites.com | Network Solutions, LLC | 8 May 2014 | 6 Feb 2023 | 8 May 2026 |
| 304 | acanthacollection.com | Tucows Domains Inc. | 18 Dec 2008 | 19 Nov 2024 | 18 Dec 2025 |
| 305 | acanthusgreen.com | GoDaddy.com, LLC | 12 Sep 2008 | 13 Sep 2024 | 12 Sep 2025 |
| 306 | acanthusgroup.com | TurnCommerce, Inc. DBA NameBright.com | 9 Jul 2014 | 3 Jul 2020 | 9 Jul 2025 |
| 307 | acanthe-paysage.com | Namebay SAM | 14 Mar 2020 | 13 Feb 2025 | 14 Mar 2026 |
| 308 | acanthe-pyrenees.com | OVH sas | 10 Apr 2001 | 10 Apr 2024 | 9 Apr 2025 |
| 309 | acanthusminiatures.com | Internet Domain Services BS Corp | 7 Jun 2018 | 12 Jun 2018 | 7 Jun 2019 |
| 310 | acanthe1.com | NordNet SA | 26 Jun 2002 | 6 Aug 2024 | 26 Jun 2024 |
| 311 | acanthuscafe.com | GoDaddy.com, LLC | 5 Jun 2012 | 6 Jun 2015 | 5 Jun 2018 |
| 312 | acanthuspartners.com | GoDaddy.com, LLC | 12 Mar 2009 | 23 Jun 2024 | 22 Jun 2026 |
| 313 | acanthuspress.com | Tucows Domains Inc. | 27 Jul 1998 | 11 Jul 2025 | 26 Jul 2026 |
| 314 | acanthastrea.com | NameCheap, Inc. | 25 Sep 2019 | 7 Dec 2024 | 25 Sep 2024 |
| 315 | acanthus-associates.com | Webfusion Ltd. | 12 Nov 2009 | 16 Jul 2025 | 12 Nov 2030 |
| 316 | acanthus-nyc.com | GoDaddy.com, LLC | 8 Dec 2010 | 9 Dec 2024 | 8 Dec 2025 |
| 317 | acanthe-appartement.com | 1&1 Internet AG | 22 Oct 2011 | 20 Dec 2017 | 22 Oct 2025 |
| 318 | acanthusartstudio.com | GoDaddy.com, LLC | 13 Feb 2006 | 14 Feb 2025 | 13 Feb 2026 |
| 319 | acanthe-graveur.com | NordNet SA | 29 Sep 2004 | 19 Mar 2025 | 29 Sep 2025 |
| 320 | acanthe-fleuriste.com | OVH sas | 22 Jan 2009 | 15 Jan 2021 | 22 Jan 2027 |
| 321 | acanthuslw.com | Webfusion Ltd. | 15 Jan 2005 | 15 Jan 2025 | 15 Jan 2026 |
| 322 | acanthis.com | Key-Systems GmbH | 5 Sep 1996 | 20 Jan 2025 | 4 Sep 2025 |
| 323 | acanthusresearch.com | GoDaddy.com, LLC | 17 Mar 2008 | 27 Oct 2022 | 17 Mar 2026 |
| 324 | acanthusdesignstudio.com | GoDaddy.com, LLC | 12 Jul 2024 | 24 Jul 2025 | 12 Jul 2026 |
| 325 | acanthes-cuisines.com | OVH sas | 13 Mar 2012 | 6 Apr 2018 | 13 Mar 2019 |
| 326 | acanthe-honfleur.com | Dynadot, LLC | 29 Jul 2008 | 1 Jul 2025 | 29 Jul 2026 |
| 327 | acantheantiquites.com | NordNet SA | 24 Jan 2008 | 14 Jul 2017 | 24 Jan 2018 |
| 328 | acanthesculture.com | Gandi SAS | 4 Feb 2008 | 9 Oct 2014 | 4 Feb 2018 |
| 329 | acanthusfacilitairedienstverlening.com | Realtime Register B.V. | 20 Apr 2014 | 21 Apr 2025 | 20 Apr 2026 |
| 330 | acantha-trading.com | GoDaddy.com, LLC | 24 Apr 2013 | 18 Jun 2013 | 24 Apr 2018 |
| 331 | acanthosis.com | Namesilo, LLC | 22 Aug 2003 | 4 Feb 2025 | 22 Aug 2025 |
| 332 | acanthe89.com | 1&1 Internet AG | 9 Mar 2006 | 10 Mar 2025 | 9 Mar 2026 |
| 333 | acanthussouthwold.com | Tucows Domains Inc. | 17 Jan 2006 | 21 Jan 2020 | 17 Jan 2020 |
| 334 | acanthuscabinets.com | GoDaddy.com, LLC | 29 Jan 2021 | 29 Jan 2021 | 29 Jan 2022 |
| 335 | acanthe-residences.com | NordNet SA | 9 Jan 2007 | 30 Jun 2017 | 9 Jan 2018 |
| 336 | acanthuskids.com | FastDomain Inc. | 11 Oct 2009 | 23 Oct 2017 | 11 Oct 2017 |
| 337 | acanthusarquitectura.com | TLDs LLC dba SRSplus | 4 Feb 2011 | 15 Feb 2016 | 4 Feb 2017 |
| 338 | acanthe-decors.com | 1&1 Internet AG | 21 Sep 2011 | 5 Dec 2024 | 21 Sep 2024 |
| 339 | acanthusaureus.com | OVH sas | 5 Aug 2013 | 13 Jun 2024 | 5 Aug 2026 |
| 340 | acanthuseducation.com | GoDaddy.com, LLC | 6 May 2024 | 6 May 2024 | 6 May 2027 |
| 341 | acantheparis.com | PSI-USA, Inc. dba Domain Robot | 2 Dec 2020 | 2 Dec 2020 | 2 Dec 2021 |
| 342 | acanthe-france.com | OVH sas | 16 Nov 2007 | 14 Sep 2017 | 16 Nov 2018 |
| 343 | acantheus.com | NameCheap, Inc. | 12 Jun 2025 | 31 Jul 2025 | 12 Jun 2026 |
| 344 | acanthusjewelry.com | GoDaddy.com, LLC | 21 Jan 2009 | 21 Jan 2025 | 21 Jan 2026 |
| 345 | acanthuslabs.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Jun 2009 | 20 Jun 2025 | 19 Jun 2026 |
| 346 | acanthusgallery.com | Domainwards.com LLC | 5 Mar 2012 | 6 Mar 2017 | 5 Mar 2018 |
| 347 | acanthuspublishing.com | Network Solutions, LLC | 9 Apr 2004 | 8 Feb 2025 | 9 Apr 2027 |
| 348 | acantheimmobilier.com | OVH sas | 31 Mar 2000 | 1 Mar 2025 | 31 Mar 2026 |
| 349 | acanthusdesign.com | Dynadot, LLC | 27 May 2024 | 14 Jun 2025 | 27 May 2026 |
| 350 | acanthusarchitects.com | Google, Inc. | 20 Dec 2004 | 6 Dec 2024 | 20 Dec 2025 |
| 351 | acanthe-mag.com | Key-Systems GmbH | 30 Sep 2005 | 2 Aug 2011 | 30 Sep 2018 |
| 352 | acanthe.com | Online SAS | 20 Nov 1998 | 4 Nov 2024 | 19 Nov 2025 |
| 353 | acanthes13.com | DropCatch.com 1195 LLC | 22 Jun 2020 | 23 Jun 2020 | 22 Jun 2026 |
| 354 | acanthe-hotel-bordeaux.com | BDL Systemes SAS dba ProDomaines | 11 Oct 1999 | 12 Oct 2024 | 11 Oct 2025 |
| 355 | acanthusmsr.com | register.com, Inc. | 23 Jun 2014 | 10 Jun 2024 | 23 Jun 2026 |
| 356 | acanthid.com | NameKing.com Inc. | 16 Apr 2021 | 30 Jun 2023 | 16 Apr 2023 |
| 357 | acanthuscorbels.com | GoDaddy.com, LLC | 9 Apr 2014 | 10 Apr 2024 | 9 Apr 2029 |
| 358 | acanthuscarving.com | GoDaddy.com, LLC | 14 Feb 2020 | 14 Feb 2020 | 14 Feb 2021 |
| 359 | acanthus-music.com | GMO Internet Inc. | 16 Apr 2009 | 20 Mar 2025 | 16 Apr 2028 |
| 360 | acanthuscabinetry.com | Brandon Gray Internet Services, Inc. (dba NameJuic… | 29 Dec 2003 | 31 Aug 2020 | 29 Dec 2025 |
| 361 | acanthushouse.com | GoDaddy.com, LLC | 3 Jul 2012 | 26 Jun 2016 | 3 Jul 2017 |
| 362 | acanthuscyan.com | PSI-USA, Inc. dba Domain Robot | 23 Oct 2009 | 12 Dec 2024 | 23 Oct 2025 |
| 363 | acanthe-antiquites.com | GMO Internet Inc. | 17 Aug 2012 | 12 Aug 2017 | 17 Aug 2018 |
| 364 | acanthusholidays.com | Tucows Domains Inc. | 20 Jan 2006 | 24 Jan 2020 | 20 Jan 2020 |
| 365 | acanthusdesigninteriors.com | Internet Domain Services BS Corp | 15 May 2021 | 8 Apr 2023 | 15 May 2026 |
| 366 | acanthusconsultinggroup.com | - | 22 Jul 2016 | 22 Jul 2016 | 22 Jul 2018 |
| 367 | acanthusartadvisors.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 27 Jul 2016 | 28 Jul 2017 | 27 Jul 2018 |
| 368 | acanthusevents.com | GoDaddy.com, LLC | 7 Jul 2023 | 17 Aug 2024 | 7 Jul 2024 |
| 369 | acanthusllc.net | - | 29 Jul 2010 | 29 Jul 2010 | 29 Jul 2017 |
| 370 | acanthuscapital.com | GoDaddy.com, LLC | 20 Oct 2019 | 21 Oct 2024 | 20 Oct 2025 |
| 371 | acanthologyrangefinder.org | eNom, Inc. | 9 Aug 2016 | 20 Sep 2017 | 9 Aug 2018 |
| 372 | acanthaceaemeloplast.com | eNom, Inc. | 10 Aug 2016 | 21 Sep 2017 | 10 Aug 2017 |
| 373 | acanthopterygianciffs.top | CommuniGal Communication Ltd. | 9 Aug 2016 | 10 Sep 2017 | 10 Sep 2017 |
| 374 | acanthushoyaauricula.com | Network Solutions, LLC | 22 Aug 2016 | 20 Aug 2017 | 22 Aug 2018 |
| 375 | acanthanails.com | Network Information Center Mexico, S.C. | 16 Oct 2015 | 29 Sep 2016 | 16 Oct 2018 |
| 376 | acantheleloftdelaguiole.com | OVH sas | 25 Aug 2016 | 1 Aug 2018 | 25 Aug 2019 |
| 377 | acanthe.in | - | 30 Mar 2009 | 20 Mar 2025 | 30 Mar 2026 |
| 378 | acanthousger.com | - | 9 Sep 2016 | 9 Sep 2016 | 9 Sep 2017 |
| 379 | acanthodianbearded.win | CommuniGal Communication Ltd. | 15 Sep 2016 | 17 Sep 2017 | 14 Sep 2017 |
| 380 | acanthusambiental.com | Network Solutions, LLC | 15 Sep 2016 | 15 Sep 2016 | 15 Sep 2018 |
| 381 | acanthusz.xyz | GMO Internet Inc. | 16 Sep 2016 | 27 Oct 2017 | 16 Sep 2017 |
| 382 | acantho.it | - | 7 Mar 2001 | 28 Jul 2025 | 12 Jul 2026 |
| 383 | acanthusadvisors.com | Tucows Domains Inc. | 2 Oct 2016 | 17 Sep 2024 | 2 Oct 2025 |
| 384 | acanthus.us | NameCheap, Inc. | 13 Aug 2018 | 13 Aug 2018 | 13 Aug 2019 |
| 385 | acanthe.info | OVH sas | 3 Jun 2025 | 8 Jun 2025 | 3 Jun 2026 |
| 386 | acanthusassociates.info | GoDaddy.com, LLC | 9 Dec 2005 | 8 Jun 2024 | 9 Dec 2025 |
| 387 | acanthique.info | OVH sas | 31 Jan 2006 | 5 Oct 2024 | 31 Jan 2026 |
| 388 | acanthuspublishing.net | Network Solutions, LLC | 9 Apr 2004 | 8 Feb 2025 | 9 Apr 2027 |
| 389 | acanthalang.net | Namesilo, LLC | 28 Oct 2011 | 14 Oct 2024 | 28 Oct 2025 |
| 390 | acanthe-hotel-bordeaux.net | 1&1 Internet AG | 11 May 2012 | 10 Jun 2021 | 11 May 2026 |
| 391 | acanthis.net | OVH sas | 6 Jan 2004 | 7 Jan 2025 | 6 Jan 2026 |
| 392 | acanthusdesign.net | GoDaddy.com, LLC | 15 Aug 2018 | 16 Aug 2024 | 15 Aug 2027 |
| 393 | acanthusconstruction.net | Tucows Domains Inc. | 8 Dec 2005 | 9 Nov 2024 | 8 Dec 2025 |
| 394 | acanthe.net | Online SAS | 15 Sep 2022 | 8 Apr 2025 | 15 Sep 2026 |
| 395 | acanthus.net | Uniregistrar Corp | 16 Feb 1997 | 11 Feb 2025 | 17 Feb 2026 |
| 396 | acanthusgroup.net | Beijing Lanhai Jiye Technology Co., Ltd | 27 Nov 2023 | 29 Jan 2025 | 27 Nov 2024 |
| 397 | acanthephyra.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Jul 2009 | 14 Jul 2025 | 31 Jul 2026 |
| 398 | acanthusassociates.net | GoDaddy.com, LLC | 9 Dec 2005 | 15 Nov 2022 | 9 Dec 2025 |
| 399 | acantho.net | Tucows Domains Inc. | 24 May 2001 | 25 Apr 2025 | 24 May 2026 |
| 400 | acanthera.net | GoDaddy.com, LLC | 31 Mar 2013 | 31 Mar 2013 | 31 Mar 2018 |
| 401 | acantha.net | Ligne Web Services SARL | 16 Jan 2023 | 16 Jan 2023 | 16 Jan 2025 |
| 402 | acanthusfurniture.net | GoDaddy.com, LLC | 28 Sep 2021 | 28 Sep 2021 | 28 Sep 2022 |
| 403 | acanthosisnigricansnyc.net | eNom, Inc. | 8 Oct 2010 | 28 Sep 2017 | 8 Oct 2018 |
| 404 | acanthuslodge.org | Tucows Domains Inc. | 10 Jan 2013 | 29 Mar 2024 | 10 Jan 2026 |
| 405 | acanthegroup.org | eNom, Inc. | 3 Apr 2012 | 30 Sep 2016 | 3 Apr 2017 |
| 406 | acanthus632.org | Dynamic Network Services, Inc. | 5 Feb 2008 | 12 Jul 2023 | 5 Feb 2026 |
| 407 | acanthum.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 31 May 2011 | 18 Jul 2025 | 31 May 2026 |
| 408 | acanthe.org | Gandi SAS | 25 Feb 2000 | 28 May 2025 | 25 Feb 2030 |
| 409 | acanthosisnigricansnyc.org | eNom, Inc. | 5 Jun 2010 | 14 Nov 2017 | 5 Jun 2018 |
| 410 | acanthusgroup.org | GoDaddy.com, LLC | 27 Jun 2014 | 7 Sep 2024 | 27 Jun 2024 |
| 411 | acanthus.org | GoDaddy.com, LLC | 2 Sep 2004 | 30 Jun 2025 | 2 Sep 2025 |
| 412 | acanthusdance.org | Network Solutions, LLC | 4 Apr 2003 | 4 Apr 2025 | 4 Apr 2026 |
| 413 | acanthosisnigricans.org | Netowl, Inc. | 6 Nov 2013 | 13 Apr 2016 | 6 Nov 2016 |
| 414 | acantha.org | OVH sas | 24 Dec 2008 | 7 Feb 2025 | 24 Dec 2025 |
| 415 | acanthus-park.com | eNom, Inc. | 20 Oct 2016 | 21 Sep 2017 | 20 Oct 2019 |
| 416 | acanthaceousdubbahhelladotherium.xyz | NameCheap, Inc. | 3 Jun 2016 | 27 Jun 2016 | 3 Jun 2017 |
| 417 | acanthotics.xyz | NameCheap, Inc. | 3 Jun 2016 | 28 Jun 2016 | 3 Jun 2017 |
| 418 | acanthaster.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 419 | acanthi.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 420 | acanthias.xyz | OnlineNIC, Inc. | 1 Jun 2016 | 29 Jul 2016 | 1 Jun 2017 |
| 421 | acanthoid.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Jun 2024 | 19 Jun 2025 | 18 Jun 2026 |
| 422 | acanthologicalincorrespondencybedimple.xyz | NameCheap, Inc. | 3 Jun 2016 | 27 Jun 2016 | 3 Jun 2017 |
| 423 | acantha.xyz | Dynadot, LLC | 27 Jun 2025 | 27 Jun 2025 | 27 Jun 2026 |
| 424 | acanthoma.xyz | Namesilo, LLC | 27 Jun 2021 | 27 Jun 2021 | 27 Jun 2022 |
| 425 | acanthouseideas.xyz | NameCheap, Inc. | 3 Jun 2016 | 29 Jun 2016 | 3 Jun 2017 |
| 426 | acanthinsservice.xyz | TLD Registrar Solutions Ltd. | 9 May 2016 | 15 Jul 2016 | 9 May 2017 |
| 427 | acanthouseto.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 428 | acanthostyle.xyz | Gandi SAS | 2 Jun 2016 | 7 Jun 2016 | 2 Jun 2017 |
| 429 | acanthite.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 430 | acanthine.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 431 | acanthinez.xyz | URL Solutions, Inc. | 2 Jun 2016 | 29 Jul 2016 | 2 Jun 2017 |
| 432 | acanthuskattenpension.be | One.com A/S | 20 Aug 2011 | - | - |
| 433 | acantha.ca | - | 27 Jul 2004 | 10 Sep 2022 | 27 Jul 2023 |
| 434 | acantha.be | One.com A/S | 5 Feb 2008 | - | - |
| 435 | acanthe-groupe.com | Gandi SAS | 26 Oct 2016 | 17 Nov 2016 | 26 Oct 2017 |
| 436 | acanthe.ch | - | - | - | - |
| 437 | acanthushotel.de | - | - | 14 Oct 2024 | - |
| 438 | acanthus-tours.de | - | - | 19 Jan 2021 | - |
| 439 | acanthe-deco.fr | - | 7 Oct 2005 | 31 Dec 2024 | 10 Nov 2025 |
| 440 | acanthoweb.fr | - | 19 May 2023 | 13 Jul 2025 | 19 May 2026 |
| 441 | acanthedeveloppement.fr | OVH sas | 10 Oct 2001 | 28 Feb 2025 | 29 Jan 2026 |
| 442 | acanthemaconnerie.fr | - | 14 Oct 2008 | 31 May 2025 | 3 Apr 2026 |
| 443 | acanthe.fr | - | 1 Jul 1996 | 7 Jan 2025 | 7 Jan 2026 |
| 444 | acanthe-paysage.fr | - | 29 Jan 2021 | 3 Apr 2025 | 29 Jan 2026 |
| 445 | acanthe-paris.fr | - | 17 Nov 2006 | 1 Dec 2017 | 25 Jan 2019 |
| 446 | acanthe-sarl.fr | OVH sas | 1 Feb 2008 | 31 Mar 2025 | 1 Feb 2026 |
| 447 | acanthus.it | - | 25 Apr 2011 | 11 May 2025 | 25 Apr 2026 |
| 448 | acanthus-antiques.co.uk | - | 27 May 2006 | 28 May 2025 | 27 May 2026 |
| 449 | acanthus-holden.co.uk | - | 11 Aug 2000 | 11 Aug 2024 | 11 Aug 2025 |
| 450 | acanthusflorist.co.uk | - | 9 Jul 2000 | 8 Jul 2024 | 9 Jul 2026 |
| 451 | acanthus.co.uk | - | 4 Nov 1996 | 25 Sep 2024 | 4 Nov 2029 |
| 452 | acanthedevelloppement.com | - | 2 Nov 2016 | 2 Nov 2016 | 2 Nov 2017 |
| 453 | acantho.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jun 2016 | 2 Aug 2016 | 2 Jun 2017 |
| 454 | acanthusmillwork.com | Google, Inc. | 28 Dec 2018 | 13 Dec 2024 | 28 Dec 2025 |
| 455 | acanthusproperties.com | Google, Inc. | 28 Dec 2018 | 13 Dec 2024 | 28 Dec 2025 |
| 456 | acanthylis.com | eNom, Inc. | 7 Nov 2016 | 10 Nov 2017 | 7 Nov 2017 |
| 457 | acanthefleurs.com | OVH sas | 8 Nov 2016 | 3 Nov 2017 | 8 Nov 2018 |
| 458 | acanthe-fleurs.com | OVH sas | 8 Nov 2016 | 3 Nov 2017 | 8 Nov 2018 |
| 459 | acanthusdance.info | Network Solutions, LLC | 14 Nov 2016 | 16 Nov 2017 | 14 Nov 2018 |
| 460 | acanthus2017.com | GoDaddy.com, LLC | 14 Nov 2016 | 14 Nov 2016 | 14 Nov 2017 |
| 461 | acanthus.cloud | eNom, Inc. | 16 Nov 2016 | 16 Nov 2017 | 16 Nov 2017 |
| 462 | acanthuscloud.com | DreamHost, LLC | 16 Nov 2016 | 18 Nov 2017 | 16 Nov 2017 |
| 463 | acanthus.tech | Google, Inc. | 19 Nov 2016 | 29 May 2025 | 19 Nov 2025 |
| 464 | acanthustattoostudio.com | Tucows Domains Inc. | 1 Mar 2019 | 11 Apr 2023 | 1 Mar 2023 |
| 465 | acanthustechnology.net | CloudFlare, Inc. | 17 Feb 2025 | 17 Feb 2025 | 17 Feb 2026 |
| 466 | acanthe-immobilier.com | 1&1 Internet AG | 18 Apr 2025 | 18 Apr 2025 | 18 Apr 2026 |
| 467 | acanthatech.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Dec 2016 | 17 Dec 2017 | 17 Dec 2018 |
| 468 | acanthusdemosite.com | eNom, Inc. | 23 Dec 2016 | 27 Dec 2017 | 23 Dec 2017 |
| 469 | acanthusbegraafplaats.com | Tucows Domains Inc. | 17 Jan 2017 | 19 Dec 2017 | 17 Jan 2019 |
| 470 | acanthuseventdesign.com | NameCheap, Inc. | 7 Aug 2024 | 27 Aug 2024 | 7 Aug 2029 |
| 471 | acanthalifestyle.com | NameCheap, Inc. | 24 Jan 2017 | 24 Jan 2017 | 24 Jan 2018 |
| 472 | acanthamedical.com | Namesilo, LLC | 23 Jan 2017 | 15 Jan 2018 | 23 Jan 2018 |
| 473 | acanthusbythesea.com | GoDaddy.com, LLC | 30 Jan 2017 | 30 Jan 2017 | 30 Jan 2018 |
| 474 | acanthusgardens.com | Easyspace LTD | 31 Jan 2017 | 11 Apr 2024 | 31 Jan 2024 |
| 475 | acanthaworld.com | Wix.com Ltd. | 26 May 2023 | 6 Jul 2025 | 26 May 2025 |
| 476 | acanthopolis.com | GoDaddy.com, LLC | 14 Feb 2017 | 14 Feb 2017 | 14 Feb 2018 |
| 477 | acanthophis.com | NameCheap, Inc. | 13 Jun 2025 | 18 Jun 2025 | 13 Jun 2026 |
| 478 | acanthocarpous.date | NameCheap, Inc. | 22 Mar 2017 | 25 Mar 2017 | 21 Mar 2018 |
| 479 | acanthuskitchens.co.uk | - | 22 Nov 2024 | 22 Nov 2024 | 22 Nov 2025 |
| 480 | acanthushotels.com | OnlineNIC, Inc. | 29 Mar 2017 | 3 Aug 2023 | 29 Mar 2028 |
| 481 | acanthe.be | OVH sas | 12 Apr 2006 | - | - |
| 482 | acantha.it | - | 6 Sep 2016 | 22 Sep 2024 | 6 Sep 2025 |
| 483 | acanthusadvisory.com | FastDomain Inc. | 25 Apr 2017 | 25 Apr 2017 | 25 Apr 2018 |
| 484 | acanthusdance.net | Network Solutions, LLC | 29 Apr 2017 | 29 Apr 2017 | 29 Apr 2018 |
| 485 | acanthusfridayharbor.com | GoDaddy.com, LLC | 12 May 2017 | 13 May 2025 | 12 May 2026 |
| 486 | acantha.tech | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Nov 2020 | 13 Nov 2020 | 13 Nov 2021 |
| 487 | acanthernel.com | OVH sas | 29 May 2017 | 18 Dec 2024 | 29 May 2025 |
| 488 | acanthusdance.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Mar 2021 | 18 Mar 2021 | 18 Mar 2022 |
| 489 | acanthosisnigricanspedia.com | Namesilo, LLC | 16 Jun 2017 | 9 Feb 2018 | 16 Jun 2018 |
| 490 | acanthusandvine.com | Network Solutions, LLC | 19 Jun 2017 | 19 Jun 2017 | 19 Jun 2019 |
| 491 | acanthusstudioroma.com | Network Solutions, LLC | 20 Jun 2017 | 22 Jun 2025 | 20 Jun 2026 |
| 492 | acanthamerida.com | Domain.com, LLC | 23 Jun 2017 | 23 Jun 2017 | 23 Jun 2018 |
| 493 | acanthaster.org | RegistryGate GmbH | 27 Jun 2017 | 1 Nov 2017 | 27 Jun 2018 |
| 494 | acanthacosmetics.com | Register.it SPA | 5 Jul 2017 | 7 Aug 2025 | 5 Jul 2026 |
| 495 | acanthacolleen.loan | NameCheap, Inc. | 1 Aug 2017 | 2 Aug 2017 | 1 Aug 2018 |
| 496 | acanthus-idi.com | Network Solutions, LLC | 23 Aug 2017 | 23 Aug 2017 | 23 Aug 2019 |
| 497 | acantho.ltd | 1&1 Internet AG | 31 Aug 2017 | 31 Aug 2017 | 31 Aug 2018 |
| 498 | acantho.co.uk | Reserved | 31 Aug 2017 | 31 Aug 2017 | 31 Aug 2018 |
| 499 | acanthologic.review | NameCheap, Inc. | 4 Oct 2017 | 4 Oct 2017 | 4 Oct 2018 |
| 500 | acanthuscapital.net | Cronon AG | 10 Oct 2017 | 10 Oct 2017 | 10 Oct 2018 |
| 501 | acanthus-advertising.com | Namesilo, LLC | 10 Oct 2017 | 11 Oct 2017 | 10 Oct 2018 |
| 502 | acanthusmaps.com | Tucows Domains Inc. | 11 Oct 2017 | 21 Oct 2024 | 11 Oct 2025 |
| 503 | acantholysis.com | Launchpad, Inc. | 11 Oct 2017 | 26 Sep 2024 | 11 Oct 2025 |
| 504 | acanthesprovence.com | Google, Inc. | 18 Oct 2017 | 17 Nov 2024 | 18 Oct 2024 |
| 505 | acanthuscapitalllc.com | Tucows Domains Inc. | 21 Oct 2017 | 7 Oct 2024 | 21 Oct 2025 |
| 506 | acanthessudouest.com | Google, Inc. | 10 Nov 2017 | 10 Nov 2017 | 10 Nov 2018 |
| 507 | acanthe.co.uk | - | 4 Feb 2016 | 1 Oct 2022 | 4 Feb 2026 |
| 508 | acanthusleaf.co.uk | - | 5 Sep 2021 | 13 Sep 2024 | 5 Sep 2024 |
| 509 | acanthuseducation.co.uk | Key-Systems GmbH | 7 Sep 2014 | 25 Aug 2017 | 7 Sep 2018 |
| 510 | acanthusworkshops.co.uk | - | 20 Jan 2012 | 22 Dec 2017 | 20 Jan 2019 |
| 511 | acanthus-jewellery.co.uk | - | 10 Oct 2005 | 10 Sep 2017 | 10 Oct 2018 |
| 512 | acanthusinteriordesign.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 26 Jan 2008 | 6 Dec 2013 | 26 Jan 2019 |
| 513 | acanthus-management.co.uk | - | 6 Nov 2009 | 8 Sep 2023 | 6 Nov 2025 |
| 514 | acanthisconstruction.co.uk | - | 7 May 2015 | 8 May 2025 | 7 May 2026 |
| 515 | acanthusroad.co.uk | Reserved | 10 Oct 2012 | 20 Dec 2017 | 10 Oct 2018 |
| 516 | acanthusbuildersltd.org.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 9 Sep 2015 | 18 Aug 2017 | 9 Sep 2019 |
| 517 | acanthusholidays.co.uk | - | 6 May 2016 | 30 Mar 2017 | 6 May 2018 |
| 518 | acantha-cacti.co.uk | Reserved | 13 Feb 2011 | 20 Dec 2017 | 13 Feb 2019 |
| 519 | acanthus-holidays.co.uk | - | 17 Jan 2006 | 9 Dec 2017 | 17 Jan 2019 |
| 520 | acanthuscurtains.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 6 Oct 2012 | 27 Nov 2016 | 6 Oct 2018 |
| 521 | acanthuscorbridge.co.uk | - | 9 Jan 2024 | 9 Feb 2025 | 9 Jan 2025 |
| 522 | acanthus-colour.co.uk | - | 17 Feb 2000 | 17 Mar 2025 | 17 Feb 2026 |
| 523 | acanthus.org.uk | - | 2 Jun 2024 | 7 Jun 2024 | 2 Jun 2025 |
| 524 | acanthus-associates.co.uk | - | 12 Nov 2009 | 13 Nov 2024 | 12 Nov 2025 |
| 525 | acanthus-advance.co.uk | - | 10 Mar 2008 | 10 Feb 2016 | 10 Mar 2018 |
| 526 | acanthuspress.uk | - | 12 Jun 2014 | 13 May 2024 | 12 Jun 2026 |
| 527 | acanthusglass.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 2 Jul 2011 | 25 Jun 2017 | 2 Jul 2019 |
| 528 | acanthis.co.uk | - | 10 Aug 2006 | 15 Aug 2024 | 10 Aug 2026 |
| 529 | acanthusvintage.co.uk | - | 2 Jul 2014 | 31 Jan 2017 | 2 Jul 2024 |
| 530 | acanthe.uk | - | 4 Feb 2016 | 1 Oct 2022 | 4 Feb 2026 |
| 531 | acanthussouthwold.co.uk | - | 17 Jan 2006 | 10 Dec 2017 | 17 Jan 2019 |
| 532 | acanthusprojects.uk | - | 8 Feb 2015 | 9 Feb 2025 | 8 Feb 2026 |
| 533 | acanthusadmin.co.uk | - | 28 Jun 2013 | 27 Jun 2025 | 28 Jun 2026 |
| 534 | acanthuspark.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 22 Jan 2016 | 22 Jan 2016 | 22 Jan 2018 |
| 535 | acanthuspress.co.uk | - | 23 Mar 2011 | 21 Feb 2025 | 23 Mar 2027 |
| 536 | acanthurus.co.uk | - | 9 Feb 2016 | 2 Jul 2024 | 9 Feb 2027 |
| 537 | acanthusdesign.co.uk | - | 22 Feb 2000 | 31 Jan 2017 | 22 Feb 2018 |
| 538 | acanthusventures.co.uk | - | 2 Sep 2013 | 26 Aug 2024 | 2 Sep 2025 |
| 539 | acanthusaccountancy.co.uk | - | 9 Oct 2008 | 9 Oct 2024 | 9 Oct 2027 |
| 540 | acanthus-dev.co.uk | - | 9 Feb 2015 | 7 Feb 2025 | 9 Feb 2026 |
| 541 | acanthusframing.co.uk | - | 4 Mar 2010 | 24 Feb 2023 | 4 Mar 2026 |
| 542 | acanthusinteriors.co.uk | - | 25 Feb 2013 | 11 Jan 2017 | 25 Feb 2019 |
| 543 | acanthusbuildersltd.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 9 Sep 2015 | 18 Aug 2017 | 9 Sep 2019 |
| 544 | acanthus-antiques.org.uk | Reserved | 27 May 2006 | 20 Dec 2017 | 27 May 2018 |
| 545 | acanthus-stoneware.co.uk | - | 6 Jun 2017 | 6 Jun 2017 | 6 Jun 2018 |
| 546 | acanthus-gallery.co.uk | - | 9 Jun 2017 | 9 Jun 2017 | 9 Jun 2018 |
| 547 | acanthusdigital.co.uk | - | 1 Dec 1999 | 30 Nov 2017 | 1 Dec 2019 |
| 548 | acantho.uk | Reserved | 31 Aug 2017 | 31 Aug 2017 | 31 Aug 2018 |
| 549 | acanthusframes.co.uk | Your Domain LLC | 24 Jan 2016 | 25 Dec 2023 | 24 Jan 2026 |
| 550 | acanthuscaststone.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 16 Oct 2017 | 8 Jan 2018 | 16 Oct 2019 |
| 551 | acanthus-antiques.me.uk | Reserved | 27 May 2006 | 20 Dec 2017 | 27 May 2018 |
| 552 | acanthusfm.co.uk | Dynadot, LLC | 21 Dec 2023 | 5 Mar 2025 | 21 Dec 2025 |
| 553 | acanthuslw.co.uk | - | 9 May 2011 | 10 May 2025 | 9 May 2026 |
| 554 | acanthe-web.fr | OVH sas | 13 Jun 2005 | 30 Apr 2025 | 5 Mar 2026 |
| 555 | acanthemaison.com | OVH sas | 25 Jan 2018 | 25 Jan 2018 | 25 Jan 2019 |
| 556 | acanthemaisons.com | OVH sas | 25 Jan 2018 | 25 Jan 2018 | 25 Jan 2019 |
| 557 | acanthe-maison.com | OVH sas | 25 Jan 2018 | 25 Jan 2018 | 25 Jan 2019 |
| 558 | acanthe-maisons.com | OVH sas | 25 Jan 2018 | 25 Jan 2018 | 25 Jan 2019 |
| 559 | acanthusdemoweb.com | eNom, Inc. | 16 Feb 2018 | 16 Feb 2018 | 16 Feb 2019 |
| 560 | acanthus-age.com | GMO Internet Inc. | 28 Feb 2018 | 28 Feb 2018 | 28 Feb 2019 |
| 561 | acanthuscreative.com | Google, Inc. | 12 Mar 2018 | 12 Mar 2018 | 12 Mar 2019 |
| 562 | acanthusfloristry.co.uk | - | 21 Mar 2018 | 20 Feb 2024 | 21 Mar 2026 |
| 563 | acanthadorure.com | register.com, Inc. | 28 Mar 2018 | 28 Feb 2025 | 28 Mar 2027 |
| 564 | acanthuseiendom.com | Network Solutions, LLC | 14 Apr 2018 | 12 May 2024 | 14 Apr 2026 |
| 565 | acanthadijaya.com | NameCheap, Inc. | 16 Apr 2018 | 16 Apr 2018 | 16 Apr 2019 |
| 566 | acanthus.info | - | 13 Dec 2024 | 18 Dec 2024 | 13 Dec 2025 |
| 567 | acanthusconsult.com | Tucows Domains Inc. | 28 Apr 2018 | 29 Mar 2025 | 28 Apr 2026 |
| 568 | acanthamoebakeratitis.com | GoDaddy.com, LLC | 12 Aug 2023 | 28 Dec 2024 | 12 Aug 2026 |
| 569 | acanthamoebaprevention.com | NameCheap, Inc. | 29 Apr 2018 | 29 Apr 2018 | 29 Apr 2019 |
| 570 | acanthesinprovence.com | register.com, Inc. | 3 May 2018 | 20 Apr 2024 | 3 May 2029 |
| 571 | acanthuscoop.it | - | 18 Mar 2014 | 3 Apr 2018 | 18 Mar 2019 |
| 572 | acanthite.biz | GMO Internet Inc. | 7 May 2018 | 7 May 2018 | 7 May 2019 |
| 573 | acantheformation.com | Network Solutions, LLC | 23 May 2018 | 23 May 2018 | 23 May 2019 |
| 574 | acantho.cloud | Tucows Domains Inc. | 28 May 2018 | 4 May 2025 | 28 May 2026 |
| 575 | acanthodei.science | NameCheap, Inc. | 3 Jun 2018 | 3 Jun 2018 | 3 Jun 2019 |
| 576 | acanthusandivory.com | GoDaddy.com, LLC | 5 Jun 2018 | 5 Jun 2018 | 5 Jun 2019 |
| 577 | acanthusindia.com | NetEarth One Inc. d/b/a NetEarth | 22 Jun 2018 | 22 Jun 2018 | 22 Jun 2019 |
| 578 | acanthaindonesia.com | Tucows Domains Inc. | 30 Sep 2021 | 30 Sep 2021 | 30 Sep 2022 |
| 579 | acanthopholis.party | NameCheap, Inc. | 6 Jul 2018 | 6 Jul 2018 | 6 Jul 2019 |
| 580 | acantheconseil.com | TurnCommerce, Inc. DBA NameBright.com | 14 Jul 2018 | 14 Jul 2018 | 14 Jul 2019 |
| 581 | acanthacosmetica.com | Register.it SPA | 16 Jul 2018 | 18 Aug 2024 | 16 Jul 2025 |
| 582 | acanthite.info | NameCheap, Inc. | 2 Aug 2018 | 2 Aug 2018 | 2 Aug 2019 |
| 583 | acanthous.com | Network Solutions, LLC | 13 Aug 2018 | 13 Aug 2018 | 13 Aug 2020 |
| 584 | acanthusantiques.net | Network Solutions, LLC | 18 Aug 2018 | 19 Aug 2018 | 18 Aug 2019 |
| 585 | acanthophyllia.com | NameCheap, Inc. | 23 Aug 2018 | 24 Jul 2023 | 23 Aug 2024 |
| 586 | acanthophylliacorals.com | NameCheap, Inc. | 23 Aug 2018 | 24 Jul 2023 | 23 Aug 2024 |
| 587 | acanthuscontracts.com | GoDaddy.com, LLC | 30 Aug 2018 | 30 Aug 2018 | 30 Aug 2020 |
| 588 | acanthe-voyages.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 6 Sep 2018 | 6 Sep 2018 | 6 Sep 2019 |
| 589 | acanthuschapel.com | Tucows Domains Inc. | 8 Sep 2018 | 12 Sep 2019 | 8 Sep 2019 |
| 590 | acanthopterygian.net | NameCheap, Inc. | 10 Sep 2018 | 10 Sep 2018 | 10 Sep 2019 |
| 591 | acanthamullercam.com | EuroDNS S.A. | 18 Oct 2018 | 18 Oct 2018 | 17 Oct 2019 |
| 592 | acanthis.info | Key-Systems GmbH | 19 Oct 2018 | 14 Jan 2025 | 19 Oct 2025 |
| 593 | acanthion.com | GoDaddy.com, LLC | 20 Oct 2018 | 29 Sep 2024 | 20 Oct 2025 |
| 594 | acanthouseassistsnow.com | Namesilo, LLC | 11 Nov 2018 | 12 Nov 2018 | 11 Nov 2019 |
| 595 | acanthus.life | GoDaddy.com, LLC | 31 Aug 2024 | 5 Sep 2024 | 31 Aug 2025 |
| 596 | acanthusstudio.net | Network Solutions, LLC | 2 Dec 2018 | 2 Dec 2018 | 2 Dec 2019 |
| 597 | acanthamoebakeratitis.info | NameCheap, Inc. | 15 Jun 2025 | 15 Jun 2025 | 15 Jun 2026 |
| 598 | acanthastech.com | Ligne Web Services SARL | 14 Dec 2018 | 21 Aug 2019 | 14 Dec 2025 |
| 599 | acanthocheilonemiasisnews.com | CloudFlare, Inc. | 13 Jan 2019 | 17 Mar 2025 | 13 Jan 2026 |
| 600 | acanthosisnigricansnews.com | CloudFlare, Inc. | 13 Jan 2019 | 17 Mar 2025 | 13 Jan 2026 |
| 601 | acanthusht.com | GoDaddy.com, LLC | 7 Jun 2021 | 8 Jun 2025 | 7 Jun 2026 |
| 602 | acanthophacelus.com | - | 22 Jan 2025 | 22 Jan 2025 | 22 Jan 2026 |
| 603 | acanthaspharma.com | GoDaddy.com, LLC | 31 Jan 2019 | 12 Feb 2024 | 31 Jan 2025 |
| 604 | acanthusflorist.com | Wix.com Ltd. | 7 Feb 2019 | 8 Jan 2025 | 7 Feb 2026 |
| 605 | acanthis.company | Gandi SAS | 10 Feb 2019 | 9 Feb 2020 | 10 Feb 2021 |
| 606 | acanthe-portage.com | 1&1 Internet AG | 18 Feb 2019 | 20 Sep 2022 | 18 Feb 2026 |
| 607 | acanthusllc.com | 1&1 Internet AG | 27 Nov 2024 | 12 Dec 2024 | 27 Nov 2025 |
| 608 | acanthecarinate.com | Internet Domain Services BS Corp | 27 Feb 2019 | 27 Feb 2019 | 27 Feb 2020 |
| 609 | acanthapp.com | eNom, Inc. | 1 Mar 2019 | 1 Mar 2019 | 1 Mar 2020 |
| 610 | acanthusbotanicals.com | GoDaddy.com, LLC | 5 Mar 2019 | 5 Mar 2019 | 5 Mar 2021 |
| 611 | acanthus-legal.com | 1&1 Internet AG | 21 Mar 2019 | 21 Mar 2019 | 21 Mar 2026 |
| 612 | acanthebenisterie.com | Network Solutions, LLC | 24 Mar 2019 | 5 Apr 2024 | 24 Mar 2025 |
| 613 | acanthusclub.com | Japan Registry Services Co., Ltd. | 29 Mar 2019 | 29 Mar 2019 | 29 Mar 2020 |
| 614 | acanthe-archi.com | Google, Inc. | 8 Apr 2019 | 9 Apr 2024 | 8 Apr 2025 |
| 615 | acanthusdallas.com | GoDaddy.com, LLC | 24 Apr 2019 | 24 Apr 2019 | 24 Apr 2020 |
| 616 | acanthuscarpets.com | Google, Inc. | 27 Apr 2019 | 27 Apr 2019 | 27 Apr 2020 |
| 617 | acanthusbaroque.com | Ledl.net GmbH | 30 Apr 2019 | 1 May 2025 | 30 Apr 2026 |
| 618 | acanthusism.com | GMO Internet Inc. | 11 May 2019 | 23 Jul 2025 | 11 May 2025 |
| 619 | acanthusconsultingllc.com | GoDaddy.com, LLC | 17 May 2019 | 17 May 2019 | 17 May 2020 |
| 620 | acanthaberry.com | GoDaddy.com, LLC | 7 Jun 2019 | 18 Jul 2025 | 7 Jun 2025 |
| 621 | acanthusdesigngroup.com | 1&1 Internet AG | 20 Jun 2019 | 20 Jun 2019 | 20 Jun 2020 |
| 622 | acanthomyrmex.com | Wix.com Ltd. | 23 Jun 2019 | 27 Jun 2022 | 23 Jun 2022 |
| 623 | acanthushomes.com | Squarespace Domains LLC | 10 May 2025 | 10 May 2025 | 10 May 2028 |
| 624 | acantho.club | NameCheap, Inc. | 9 Jul 2019 | 9 Jul 2019 | 9 Jul 2020 |
| 625 | acanthltd.com | Papaki Ltd. | 15 Jul 2019 | 7 Jul 2025 | 15 Jul 2026 |
| 626 | acanthasf.com | Google, Inc. | 29 Jul 2019 | 29 Jul 2019 | 29 Jul 2020 |
| 627 | acanthusmarmoles.com | Wix.com Ltd. | 1 Aug 2019 | 2 Jul 2025 | 1 Aug 2026 |
| 628 | acanthusengland.com | Google, Inc. | 23 Aug 2019 | 23 Aug 2019 | 23 Aug 2020 |
| 629 | acanthusmedicalcreations.com | Tucows Domains Inc. | 4 Sep 2019 | 8 Sep 2020 | 4 Sep 2020 |
| 630 | acanthajoya.com | Arsys Internet, S.L. dba NICLINE.COM | 12 Sep 2019 | 12 Sep 2019 | 12 Sep 2020 |
| 631 | acanthajewelry.com | Tucows Domains Inc. | 11 Jun 2023 | 22 Aug 2024 | 11 Jun 2024 |
| 632 | acanthajewel.com | Arsys Internet, S.L. dba NICLINE.COM | 12 Sep 2019 | 12 Sep 2019 | 12 Sep 2020 |
| 633 | acanthajoyeria.com | Arsys Internet, S.L. dba NICLINE.COM | 12 Sep 2019 | 12 Sep 2019 | 12 Sep 2020 |
| 634 | acanthajewels.com | Arsys Internet, S.L. dba NICLINE.COM | 12 Sep 2019 | 12 Sep 2019 | 12 Sep 2020 |
| 635 | acanthajoyas.com | Above.com Pty Ltd. | 18 Nov 2022 | 28 Sep 2023 | 18 Nov 2025 |
| 636 | acanthusartanddesign.com | DreamHost, LLC | 27 Sep 2019 | 27 Sep 2019 | 27 Sep 2020 |
| 637 | acanthosisassociation.com | GoDaddy.com, LLC | 6 Oct 2019 | 7 Oct 2024 | 6 Oct 2025 |
| 638 | acanthusinteriors.top | Namesilo, LLC | 8 Oct 2019 | 8 Oct 2019 | 8 Oct 2020 |
| 639 | acanthusconstructions.com | Hosting Concepts B.V. dba Openprovider | 22 Oct 2019 | 22 Oct 2019 | 22 Oct 2020 |
| 640 | acanthusfloral.ca | Domain.com, LLC | 20 Oct 2014 | 5 Oct 2024 | 20 Oct 2025 |
| 641 | acanthebiotech.com | NameCheap, Inc. | 4 Nov 2019 | - | 4 Nov 2020 |
| 642 | acanthussol.com | FastDomain Inc. | 23 Nov 2019 | 8 Nov 2024 | 23 Nov 2025 |
| 643 | acanthusjd.com | Tucows Domains Inc. | 2 Dec 2019 | 2 Dec 2019 | 2 Dec 2020 |
| 644 | acanthmlvt.club | NameCheap, Inc. | 22 Dec 2019 | 22 Dec 2019 | 22 Dec 2020 |
| 645 | acanthus-services.com | Gandi SAS | 3 Jan 2020 | 19 Mar 2025 | 3 Jan 2025 |
| 646 | acantha-kreasi-indonesia.com | Google, Inc. | 14 Jan 2020 | 14 Jan 2020 | 14 Jan 2021 |
| 647 | acanthe-studio.com | OVH sas | 20 Jan 2020 | 1 Jan 2024 | 20 Jan 2025 |
| 648 | acanthusmd.com | Squarespace Domains LLC | 28 Jan 2020 | 19 Jun 2025 | 28 Jan 2028 |
| 649 | acantharose.com | 1&1 Internet AG | 5 Feb 2020 | 5 Feb 2020 | 5 Feb 2021 |
| 650 | acanthussecurity.com | GoDaddy.com, LLC | 7 Jan 2022 | 8 Jan 2025 | 7 Jan 2026 |
| 651 | acanthusflowersandinteriors.com | GoDaddy.com, LLC | 7 Apr 2020 | 7 Apr 2020 | 7 Apr 2021 |
| 652 | acanthafitness.com | NameCheap, Inc. | 9 Apr 2020 | - | 9 Apr 2021 |
| 653 | acanthusmuse.com | Automattic Inc. | 20 May 2020 | 20 May 2020 | 20 May 2021 |
| 654 | acanthius.com | OVH sas | 28 May 2020 | 29 May 2023 | 28 May 2023 |
| 655 | acanthusandangelica.com | NameCheap, Inc. | 1 Jun 2020 | 2 May 2025 | 1 Jun 2026 |
| 656 | acanthusarchitecture.co.uk | - | 5 Jun 2020 | 5 Jun 2022 | 5 Jun 2023 |
| 657 | acantha.mba | NameCheap, Inc. | 11 Jun 2020 | 11 Jun 2020 | 11 Jun 2021 |
| 658 | acanthusblue.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 20 Jun 2020 | 1 Apr 2025 | 20 Jun 2026 |
| 659 | acanthislaboratoire.com | 1&1 Internet AG | 2 Jul 2020 | 29 Jul 2021 | 2 Jul 2022 |
| 660 | acanthe-imprimerie.com | 1&1 Internet AG | 15 Jun 2020 | 25 Jun 2025 | 15 Jun 2026 |
| 661 | acanthus.pro | Soluciones Corporativas IP, SLU | 20 Jan 2017 | 4 Jun 2024 | 20 Jan 2028 |
| 662 | acanthusbyevabende.com | Tucows Domains Inc. | 22 Jul 2020 | 25 Jul 2025 | 22 Jul 2026 |
| 663 | acanthocarpouslightful.xyz | Name.com, Inc. | 4 Nov 2019 | 14 Dec 2019 | 4 Nov 2020 |
| 664 | acanthae.xyz | CloudFlare, Inc. | 1 Oct 2019 | 20 Jan 2024 | 1 Oct 2025 |
| 665 | acanthous2.website | NameCheap, Inc. | 30 Aug 2019 | 4 Sep 2019 | 30 Aug 2020 |
| 666 | acanthus-spring.com | GoDaddy.com, LLC | 12 Aug 2020 | 27 Jan 2021 | 12 Aug 2021 |
| 667 | acanthuskrigler.com | EuroDNS S.A. | 16 Aug 2020 | 27 Jul 2025 | 15 Aug 2026 |
| 668 | acanthus.legal | 1&1 Internet AG | 19 Aug 2020 | 3 Oct 2024 | 19 Aug 2025 |
| 669 | acanthuspaint.com | Tucows Domains Inc. | 21 Aug 2020 | 25 Aug 2024 | 21 Aug 2025 |
| 670 | acanthe-34.com | OVH sas | 26 Aug 2020 | 27 Aug 2024 | 26 Aug 2025 |
| 671 | acanthus-landscape.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Sep 2020 | 21 Sep 2020 | 21 Sep 2021 |
| 672 | acanthus-re.com | 1&1 Internet AG | 30 Sep 2020 | 30 Sep 2020 | 30 Sep 2021 |
| 673 | acanthus-foundation.com | 1&1 Internet AG | 30 Sep 2020 | 30 Sep 2020 | 30 Sep 2025 |
| 674 | acanthuskantoorschoonmaak.com | Realtime Register B.V. | 4 Oct 2020 | 2 Nov 2023 | 4 Oct 2023 |
| 675 | acanthejardins.com | PlanetHoster Inc. | 12 Oct 2020 | 10 Nov 2023 | 12 Oct 2025 |
| 676 | acanthusarch.online | Network Solutions, LLC | 1 Nov 2020 | 1 Nov 2020 | 1 Nov 2021 |
| 677 | acanthosstore.com | Launchpad, Inc. | 6 Nov 2020 | 7 Nov 2020 | 6 Nov 2021 |
| 678 | acanthussolutionslimited.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Nov 2020 | 4 Nov 2024 | 6 Nov 2025 |
| 679 | acanthosstore.net | Automattic Inc. | 8 Nov 2020 | 8 Nov 2020 | 8 Nov 2021 |
| 680 | acanthus.site | GMO Internet Inc. | 10 Nov 2020 | 26 Dec 2024 | 10 Nov 2025 |
| 681 | acantholyda.online | Limited Liability Company "Registrar of domain nam… | 18 Nov 2020 | - | 18 Nov 2021 |
| 682 | acanthyruskeydecor.com | GoDaddy.com, LLC | 19 Nov 2020 | 30 Jan 2025 | 19 Nov 2024 |
| 683 | acanthophis.online | Limited Liability Company "Registrar of domain nam… | 24 Nov 2020 | - | 24 Nov 2021 |
| 684 | acanthosstores.com | Automattic Inc. | 2 Dec 2020 | 2 Dec 2020 | 2 Dec 2021 |
| 685 | acanth6ine.online | NICENIC INTERNATIONAL GROUP CO., LIMITED | 9 Dec 2020 | 9 Dec 2020 | 9 Dec 2021 |
| 686 | acanthismaster.com | Namesilo, LLC | 17 Dec 2020 | 18 Dec 2020 | 17 Dec 2021 |
| 687 | acanthus-lp-story.com | GMO Internet Inc. | 25 Jan 2021 | 25 Jan 2021 | 25 Jan 2022 |
| 688 | acanthusdeli.com | NameCheap, Inc. | 26 Jan 2021 | 27 Jan 2024 | 26 Jan 2025 |
| 689 | acanthusfunds.com | GoDaddy.com, LLC | 6 Feb 2021 | 7 Feb 2025 | 6 Feb 2027 |
| 690 | acanthusstonemasonry.com | Key-Systems GmbH | 17 Feb 2021 | 2 Apr 2025 | 17 Feb 2025 |
| 691 | acanthisantiquites.com | NameCheap, Inc. | 23 Feb 2021 | 6 May 2024 | 23 Feb 2024 |
| 692 | acanthisco.com | GoDaddy.com, LLC | 16 Mar 2021 | 16 Mar 2021 | 16 Mar 2022 |
| 693 | acanthusventures.com | GoDaddy.com, LLC | 27 Mar 2021 | 2 Apr 2025 | 27 Mar 2026 |
| 694 | acanthe.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 12 Apr 2021 | - | 12 Apr 2022 |
| 695 | acanthuspharma.com | Sibername Internet and Software Technologies Inc. | 12 Apr 2021 | 7 Apr 2025 | 12 Apr 2026 |
| 696 | acanthuswoodworks.com | NameCheap, Inc. | 20 Apr 2021 | 21 Mar 2025 | 20 Apr 2026 |
| 697 | acanthus.global | Mesh Digital Limited | 23 Apr 2021 | 23 Apr 2021 | 23 Apr 2022 |
| 698 | acanthus-pe.com | Webfusion Ltd. | 27 Apr 2021 | 5 May 2025 | 27 Apr 2030 |
| 699 | acantha2.com | 1&1 Internet AG | 7 Jul 2025 | 9 Jul 2025 | 7 Jul 2026 |
| 700 | acanthad.xyz | Namesilo, LLC | 23 Jun 2021 | 23 Jun 2021 | 23 Jun 2022 |
| 701 | acantha-cacti.com | Tucows Domains Inc. | 22 Jun 2021 | 2 Sep 2023 | 22 Jun 2023 |
| 702 | acanthacacti.com | Tucows Domains Inc. | 22 Jun 2021 | 2 Sep 2023 | 22 Jun 2023 |
| 703 | acanthusintl.com | GoDaddy.com, LLC | 7 Jul 2021 | 8 Jul 2025 | 7 Jul 2027 |
| 704 | acanthus-official.com | GMO Internet Inc. | 14 Jul 2021 | 29 Jun 2025 | 14 Jul 2026 |
| 705 | acanthopomatous.com | NameCheap, Inc. | 16 Jul 2021 | - | 16 Jul 2022 |
| 706 | acanthocladous.com | NameCheap, Inc. | 19 Jul 2021 | - | 19 Jul 2022 |
| 707 | acanthusadvertising.com | Automattic Inc. | 26 Jul 2021 | 8 Oct 2023 | 26 Jul 2023 |
| 708 | acanthus-skincare.com | Automattic Inc. | 27 Jul 2021 | 4 Jul 2024 | 27 Jul 2024 |
| 709 | acanthodeis.info | NameCheap, Inc. | 9 Aug 2021 | 9 Aug 2021 | 9 Aug 2022 |
| 710 | acanthazia.com | NameCheap, Inc. | 1 Sep 2021 | - | 1 Sep 2022 |
| 711 | acanthffyp.life | NameCheap, Inc. | 6 Sep 2021 | 6 Sep 2021 | 6 Sep 2022 |
| 712 | acanthusrenovations.com | GoDaddy.com, LLC | 14 Sep 2021 | 14 Sep 2021 | 14 Sep 2022 |
| 713 | acantha.me | Namesilo, LLC | 28 Oct 2011 | 19 Oct 2024 | 28 Oct 2025 |
| 714 | acanthe-doree.com | Online SAS | 8 Oct 2021 | 8 Oct 2021 | 8 Oct 2022 |
| 715 | acanthusrha.com | Webfusion Ltd. | 12 Oct 2021 | 12 Oct 2022 | 12 Oct 2032 |
| 716 | acanthus.club | Hosting Concepts B.V. dba Openprovider | 15 Oct 2021 | 20 Oct 2024 | 15 Oct 2025 |
| 717 | acanthopomatous.info | NameCheap, Inc. | 22 Oct 2021 | 22 Oct 2021 | 22 Oct 2022 |
| 718 | acanthaclinic.com | FastDomain Inc. | 25 Oct 2021 | 10 Oct 2024 | 25 Oct 2025 |
| 719 | acanthocladous.info | NameCheap, Inc. | 27 Oct 2021 | 27 Oct 2021 | 27 Oct 2022 |
| 720 | acanthustrades.com | GoDaddy.com, LLC | 31 Oct 2021 | 12 Jan 2024 | 31 Oct 2023 |
| 721 | acanthocereus.com | Dynadot, LLC | 16 Dec 2021 | 16 Dec 2021 | 16 Dec 2022 |
| 722 | acanthisdroneservices.com | Automattic Inc. | 22 Dec 2021 | 22 Dec 2021 | 22 Dec 2022 |
| 723 | acanthopterygii.info | Dynadot, LLC | 8 Nov 2024 | 27 Feb 2025 | 8 Nov 2025 |
| 724 | acanthe-gestion.com | Online SAS | 20 Jan 2022 | 20 Nov 2024 | 20 Jan 2026 |
| 725 | acanthusspring.com | Wix.com Ltd. | 7 Sep 2020 | 17 Nov 2023 | 7 Sep 2023 |
| 726 | acanthocytosiss.info | NameCheap, Inc. | 23 Feb 2022 | 6 Apr 2023 | 23 Feb 2023 |
| 727 | acanthe-news.com | Gandi SAS | 18 Feb 2025 | 27 Mar 2025 | 18 Feb 2026 |
| 728 | acanthattua.xyz | NameCheap, Inc. | 11 Mar 2022 | 22 Apr 2023 | 11 Mar 2023 |
| 729 | acanthos.xyz | NameCheap, Inc. | 31 Mar 2022 | 15 Apr 2023 | 31 Mar 2024 |
| 730 | acanthushoveniersbedrijf.com | NameWeb BVBA | 30 Mar 2022 | 28 Mar 2025 | 30 Mar 2026 |
| 731 | acanthus.furniture | GoDaddy.com, LLC | 18 Apr 2022 | 30 May 2024 | 18 Apr 2024 |
| 732 | acanthejardins.fr | - | 25 Nov 2020 | 10 Nov 2024 | 25 Nov 2025 |
| 733 | acantha-suites.com | NETIM SARL | 13 May 2022 | 3 May 2024 | 13 May 2026 |
| 734 | acanthopodous.info | NameCheap, Inc. | 16 May 2022 | 16 May 2023 | 16 May 2024 |
| 735 | acanthrtzu.store | Beget LLC | 16 May 2022 | 21 May 2022 | 16 May 2024 |
| 736 | acanthuscollection.com | Wix.com Ltd. | 20 May 2022 | 20 Apr 2025 | 20 May 2026 |
| 737 | acanthusventuresllc.com | Network Solutions, LLC | 16 Jun 2022 | 16 Jun 2022 | 16 Jun 2027 |
| 738 | acanthuseducation.org | GoDaddy.com, LLC | 6 May 2024 | 20 Jun 2025 | 6 May 2026 |
| 739 | acanthus.eu.com | - | 13 Aug 2004 | 13 Aug 2024 | 13 Aug 2025 |
| 740 | acanth-play.website | Porkbun, LLC | 5 Jul 2022 | 17 Jul 2023 | 5 Jul 2024 |
| 741 | acanth-play.space | Porkbun, LLC | 5 Jul 2022 | 17 Jul 2023 | 5 Jul 2024 |
| 742 | acanthusdevelopments.com | eNom, Inc. | 11 Jul 2022 | 11 Jul 2022 | 11 Jul 2023 |
| 743 | acanthuscw.com | CloudFlare, Inc. | 15 Jul 2022 | 27 Jun 2025 | 15 Jul 2026 |
| 744 | acanthustravels.com | GoDaddy.com, LLC | 20 Jul 2022 | 31 Aug 2023 | 20 Jul 2023 |
| 745 | acanthustour.com | GoDaddy.com, LLC | 20 Jul 2022 | 31 Aug 2023 | 20 Jul 2023 |
| 746 | acanthoid.info | NameCheap, Inc. | 1 Aug 2022 | 16 Aug 2023 | 1 Aug 2024 |
| 747 | acanthusus.com | GoDaddy.com, LLC | 5 Aug 2022 | 6 Aug 2025 | 5 Aug 2026 |
| 748 | acanthusdecorstyle.com | NameCheap, Inc. | 15 Mar 2021 | 18 Mar 2025 | 15 Mar 2026 |
| 749 | acanthis.tk | - | - | - | - |
| 750 | acantheia.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 16 Aug 2022 | 25 Jul 2025 | 16 Aug 2026 |
| 751 | acanthospro.com | FastDomain Inc. | 23 Aug 2022 | 5 Nov 2024 | 23 Aug 2024 |
| 752 | acanthrcdo.online | Hostinger, UAB | 13 Sep 2022 | 20 Oct 2023 | 13 Sep 2023 |
| 753 | acanthusvalley.com | BigRock Solutions Ltd. | 14 Sep 2022 | 15 Sep 2024 | 14 Sep 2025 |
| 754 | acanthusads.co.uk | - | 19 Sep 2022 | 13 Aug 2024 | 19 Sep 2025 |
| 755 | acanthus.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 756 | acanthusonline.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 757 | acanthusshop.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 758 | acanthuswork.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 759 | acanthusclub.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 760 | acanthusgroup.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 761 | acanthusguide.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 762 | acanthushomes.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 763 | acanthusservice.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 764 | acanthussite.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 765 | acanthususa.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 766 | acanthusworld.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 767 | acanthusdesign.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 768 | acanthusblog.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 769 | acanthushome.website | Namesilo, LLC | 4 Oct 2022 | 4 Oct 2022 | 4 Oct 2023 |
| 770 | acanthus-furniture.com | CloudFlare, Inc. | 31 Aug 2024 | 1 Sep 2024 | 31 Aug 2025 |
| 771 | acanthisllc.com | GoDaddy.com, LLC | 17 Oct 2022 | 17 Oct 2024 | 17 Oct 2025 |
| 772 | acantharea.com | Cronon AG | 19 Oct 2022 | 8 Dec 2024 | 19 Oct 2025 |
| 773 | acanthaclub.com | GoDaddy.com, LLC | 27 Oct 2022 | 4 Nov 2024 | 27 Oct 2025 |
| 774 | acanthoceras.net | OVH sas | 28 Oct 2022 | 25 Nov 2024 | 28 Oct 2024 |
| 775 | acanthopterygii.site | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Oct 2022 | 31 Oct 2023 | 30 Oct 2024 |
| 776 | acanthe-finance.com | Hostinger, UAB | 9 Nov 2022 | 20 Dec 2023 | 9 Nov 2023 |
| 777 | acanthe-roubaix.com | NameCheap, Inc. | 8 Nov 2022 | 20 Jan 2024 | 8 Nov 2023 |
| 778 | acantha.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 18 Mar 2025 | 18 Mar 2025 | 18 Mar 2026 |
| 779 | acanthusartefacts.com | Google, Inc. | 24 Nov 2022 | 5 Jan 2025 | 24 Nov 2024 |
| 780 | acanthe-ehpad.com | OVH sas | 28 Nov 2022 | 29 Nov 2024 | 28 Nov 2025 |
| 781 | acanthusclimate.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Dec 2022 | 1 Dec 2024 | 1 Dec 2025 |
| 782 | acanthus.ae | - | - | - | - |
| 783 | acanthusgallery.co.uk | - | 4 Dec 2022 | 6 Feb 2024 | 4 Dec 2023 |
| 784 | acanthus-santorini.com | Papaki Ltd. | 7 Dec 2022 | 6 Dec 2024 | 7 Dec 2025 |
| 785 | acanthus-band.net | Cronon AG | 10 Dec 2022 | 29 Jan 2025 | 10 Dec 2025 |
| 786 | acanthus-band.com | Cronon AG | 10 Dec 2022 | 29 Jan 2025 | 10 Dec 2025 |
| 787 | acanthus-yorozuyasan.com | Netowl, Inc. | 10 Dec 2022 | 11 Dec 2024 | 10 Dec 2024 |
| 788 | acanthaagency.com | GoDaddy.com, LLC | 10 Dec 2022 | 21 Feb 2024 | 10 Dec 2023 |
| 789 | acantharias.info | NameCheap, Inc. | 13 Dec 2022 | 24 Jan 2024 | 13 Dec 2023 |
| 790 | acanthopis.foundation | Domain.com, LLC | 13 Dec 2022 | 26 Jan 2024 | 13 Dec 2023 |
| 791 | acanthus-lp.website | Netowl, Inc. | 21 Dec 2022 | 3 Feb 2024 | 21 Dec 2023 |
| 792 | acanthasolutions.com | CloudFlare, Inc. | 30 Dec 2022 | 8 Feb 2024 | 30 Dec 2023 |
| 793 | acanthlpoy.website | NameCheap, Inc. | 4 Jan 2023 | 16 Mar 2024 | 4 Jan 2024 |
| 794 | acanthzric.info | NameCheap, Inc. | 13 Jan 2023 | 25 Feb 2024 | 13 Jan 2024 |
| 795 | acanthuskrokant.be | - | 19 Jun 2022 | - | - |
| 796 | acanthus-atelier-houtsnijden.be | - | 1 Dec 2019 | - | - |
| 797 | acanthusprive.be | One.com A/S | 29 Apr 2021 | - | - |
| 798 | acanthuswellness.be | - | 17 Nov 2020 | - | - |
| 799 | acanthuswebdesign.com | Realtime Register B.V. | 25 Jan 2023 | 26 Jan 2025 | 25 Jan 2026 |
| 800 | acanthuscontabilidade.com.br | - | 26 Jul 2018 | 27 May 2025 | 26 Jul 2026 |
| 801 | acanthurus71.buzz | Dynadot, LLC | 6 Jun 2022 | 7 Jun 2023 | 6 Jun 2023 |
| 802 | acanthusinteriors.ca | - | 16 Jul 2010 | 16 Jun 2025 | 16 Jul 2026 |
| 803 | acanthus.ca | - | 27 Sep 2005 | 27 Aug 2024 | 26 Sep 2025 |
| 804 | acanthusgroup.ca | - | 9 May 2012 | 10 May 2023 | 9 May 2028 |
| 805 | acanthusgardendesign.com | Tucows Domains Inc. | 31 Jan 2023 | 16 Jan 2025 | 31 Jan 2026 |
| 806 | acanthusconference.co.uk | - | 30 Jan 2023 | 10 Aug 2023 | 30 Jan 2024 |
| 807 | acanthus.capital | Tucows Domains Inc. | 21 Oct 2017 | 12 Oct 2024 | 21 Oct 2025 |
| 808 | acanthus.cl | - | 28 Jul 2021 | - | 28 Jul 2023 |
| 809 | acanthopterygianoutflewamphimacerphlegmatic.click | NameCheap, Inc. | 25 Jan 2022 | 25 Jan 2023 | 25 Jan 2024 |
| 810 | acantho.hr | - | 23 Sep 2008 | 2 Jan 2025 | 2 Jan 2026 |
| 811 | acanthusmedia.co.uk | - | 4 Nov 2024 | 4 Nov 2024 | 4 Nov 2025 |
| 812 | acanthastudio.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 9 Feb 2023 | 9 Jul 2025 | 9 Feb 2026 |
| 813 | acanthion.org | 1&1 Internet AG | 13 Feb 2023 | 30 Mar 2025 | 13 Feb 2026 |
| 814 | acantho-test.com | Tucows Domains Inc. | 16 Feb 2023 | 28 Apr 2024 | 16 Feb 2024 |
| 815 | acantho-test.net | Tucows Domains Inc. | 16 Feb 2023 | 28 Apr 2024 | 16 Feb 2024 |
| 816 | acanthus-sa.com | GoDaddy.com, LLC | 20 Feb 2023 | 2 Apr 2024 | 20 Feb 2024 |
| 817 | acanthes-4c.ovh | OVH sas | 18 Sep 2017 | 6 Sep 2024 | 18 Sep 2025 |
| 818 | acanthusappraisal.com | GoDaddy.com, LLC | 3 Mar 2023 | 14 Apr 2024 | 3 Mar 2024 |
| 819 | acanthushealthcare.co.uk | - | 4 Mar 2023 | 5 Mar 2025 | 4 Mar 2027 |
| 820 | acanthe-renovation.com | Realtime Register B.V. | 7 Mar 2023 | 12 Feb 2025 | 7 Mar 2026 |
| 821 | acanthdtig.buzz | Porkbun, LLC | 11 Mar 2023 | 22 Apr 2024 | 11 Mar 2024 |
| 822 | acanthuscustomconstruction.com | Tucows Domains Inc. | 24 May 2018 | 10 May 2025 | 24 May 2026 |
| 823 | acanthuscennetbarut.com | OnlineNIC, Inc. | 6 Aug 2018 | 3 Aug 2023 | 6 Aug 2028 |
| 824 | acanthuscennetbarutcollection.com | OnlineNIC, Inc. | 20 Oct 2018 | 11 Oct 2023 | 20 Oct 2025 |
| 825 | acanthushotelconsultancy.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Jan 2019 | 9 Jan 2025 | 8 Jan 2026 |
| 826 | acanthocephala123.com | Cosmotown, Inc. | 15 Mar 2023 | 25 Apr 2024 | 15 Mar 2024 |
| 827 | acanthvskitchens.co.uk | - | 14 Mar 2023 | 14 Mar 2023 | 14 Mar 2024 |
| 828 | acanthusproduccion.com | Wix.com Ltd. | 28 Feb 2020 | 21 Feb 2025 | 28 Feb 2026 |
| 829 | acantharia.com | Cronon AG | 17 Aug 2020 | 6 Oct 2024 | 17 Aug 2025 |
| 830 | acanthamanagement.com | GoDaddy.com, LLC | 15 Feb 2021 | 17 Feb 2025 | 15 Feb 2026 |
| 831 | acanthus-eu.com | Namesilo, LLC | 11 Mar 2021 | 12 Mar 2025 | 11 Mar 2026 |
| 832 | acanthus-group.com | GoDaddy.com, LLC | 12 Mar 2021 | 13 Mar 2025 | 12 Mar 2026 |
| 833 | acanthacrystals.com | Wix.com Ltd. | 14 Apr 2021 | 8 Mar 2023 | 14 Apr 2026 |
| 834 | acanthusantiquesscottsdale.com | Wix.com Ltd. | 25 May 2021 | 25 Apr 2025 | 25 May 2027 |
| 835 | acanthusconsultancy.com | Squarespace Domains LLC | 15 Jun 2021 | 31 May 2025 | 15 Jun 2026 |
| 836 | acanthus-sapporo.com | Wix.com Ltd. | 24 Aug 2021 | 30 Jul 2024 | 24 Aug 2026 |
| 837 | acanthaandsheriff.com | Wix.com Ltd. | 27 Sep 2021 | 7 Nov 2023 | 27 Sep 2023 |
| 838 | acanthium-group.com | Ligne Web Services SARL | 6 Oct 2021 | 2 Oct 2023 | 6 Oct 2025 |
| 839 | acanthium-motors.com | Ligne Web Services SARL | 6 Oct 2021 | 5 Dec 2024 | 6 Oct 2024 |
| 840 | acanthe-audit.com | OVH sas | 4 Nov 2021 | 5 Nov 2024 | 4 Nov 2025 |
| 841 | acanthis.io | NameCheap, Inc. | 1 Dec 2021 | 6 Nov 2024 | 1 Dec 2025 |
| 842 | acanthio.com | CloudFlare, Inc. | 4 Dec 2021 | 12 May 2025 | 4 Dec 2026 |
| 843 | acanthustrades.net | GoDaddy.com, LLC | 6 Apr 2023 | 6 Apr 2025 | 6 Apr 2026 |
| 844 | acanthusarms.com | GoDaddy.com, LLC | 13 Dec 2021 | 14 Dec 2023 | 13 Dec 2025 |
| 845 | acanthus.finance | NameCheap, Inc. | 7 Apr 2023 | 19 May 2025 | 7 Apr 2025 |
| 846 | acanthuscrafts.com | Wix.com Ltd. | 6 Apr 2022 | 17 May 2024 | 6 Apr 2024 |
| 847 | acanthiajewellery.co.uk | - | 12 Apr 2023 | 13 Mar 2025 | 12 Apr 2026 |
| 848 | acanthe-jardins.com | PlanetHoster Inc. | 19 Apr 2022 | 9 Apr 2025 | 19 Apr 2026 |
| 849 | acanthacollective.com | GoDaddy.com, LLC | 9 May 2022 | 29 Sep 2022 | 9 May 2027 |
| 850 | acanthaestates.com | GoDaddy.com, LLC | 9 May 2022 | 29 Sep 2022 | 9 May 2027 |
| 851 | acanthalondon.com | GoDaddy.com, LLC | 9 May 2022 | 29 Sep 2022 | 9 May 2027 |
| 852 | acanthanyc.com | GoDaddy.com, LLC | 9 May 2022 | 29 Sep 2022 | 9 May 2027 |
| 853 | acanthoid.store | NameCheap, Inc. | 13 Apr 2023 | 28 Apr 2024 | 13 Apr 2025 |
| 854 | acanthusilicifolius.com | GoDaddy.com, LLC | 10 Jul 2022 | 3 Sep 2022 | 10 Jul 2027 |
| 855 | acanthis.dev | NameCheap, Inc. | 15 Jun 2021 | 16 May 2024 | 15 Jun 2025 |
| 856 | acanthicuskaladewa.fun | NameKing.com Inc. | 7 Mar 2023 | 21 Apr 2024 | 7 Mar 2024 |
| 857 | acanthus.hr | - | 4 Dec 2014 | 5 May 2025 | 5 May 2026 |
| 858 | acanthus.ie | - | 5 Feb 2008 | 21 Mar 2024 | 5 Feb 2024 |
| 859 | acanthus.in | OnlineNIC, Inc. | 22 Feb 2018 | - | 22 Feb 2026 |
| 860 | acanthus-decorazioni.it | - | 8 Jul 2010 | 24 Jul 2025 | 8 Jul 2026 |
| 861 | acanthus.jp | - | 14 May 2015 | 1 Jun 2025 | 31 May 2026 |
| 862 | acanthuscori.it | - | 27 Jun 2023 | 12 Jul 2024 | 27 Jun 2024 |
| 863 | acanthusitalia.it | - | 7 Mar 2011 | 23 Mar 2025 | 7 Mar 2026 |
| 864 | acanthusism.jp | - | 12 May 2011 | 1 Jun 2025 | 31 May 2026 |
| 865 | acanthus-floral.com | GoDaddy.com, LLC | 20 Apr 2023 | 21 Apr 2025 | 20 Apr 2027 |
| 866 | acanthusfloraldesign.com | GoDaddy.com, LLC | 20 Apr 2023 | 21 Apr 2025 | 20 Apr 2026 |
| 867 | acanthuscennetbarut.net | OnlineNIC, Inc. | 6 Aug 2018 | 3 Aug 2023 | 6 Aug 2028 |
| 868 | acanthuscennetbarutcollection.net | OnlineNIC, Inc. | 20 Oct 2018 | 20 Oct 2018 | 20 Oct 2025 |
| 869 | acanthdfuf.com | NameCheap, Inc. | 21 Apr 2023 | 3 Jul 2024 | 21 Apr 2024 |
| 870 | acanthusadvies.nl | - | 22 Feb 2002 | 6 Jan 2025 | - |
| 871 | acanthushealing.nl | - | 5 Dec 2015 | 19 Jan 2023 | - |
| 872 | acantha.nl | - | 9 Oct 2006 | 4 Jan 2008 | - |
| 873 | acanthiscommunicatie.nl | - | 9 Sep 2022 | 31 May 2025 | - |
| 874 | acanthusfacilitair.nl | - | 9 Jan 2016 | 11 Sep 2024 | - |
| 875 | acanthis.nl | - | 7 Dec 1998 | 7 Mar 2024 | - |
| 876 | acanthus.nl | - | 19 May 1999 | 8 Dec 2024 | - |
| 877 | acanthusbloememotie.nl | - | 4 Feb 2013 | 6 Dec 2024 | - |
| 878 | acanthiszorg.nl | - | 14 Dec 2018 | 12 Jun 2025 | - |
| 879 | acanthusarts.org | Tucows Domains Inc. | 18 Dec 2018 | 8 Dec 2024 | 18 Dec 2025 |
| 880 | acanthosisassociation.org | GoDaddy.com, LLC | 6 Oct 2019 | 20 Nov 2024 | 6 Oct 2025 |
| 881 | acantheantique.com | NameCheap, Inc. | 27 Apr 2023 | 8 Jun 2025 | 27 Apr 2025 |
| 882 | acanthis.org | RegistryGate GmbH | 21 Jan 2022 | 7 Mar 2025 | 21 Jan 2026 |
| 883 | acanthus.shop | Domeneshop AS dba domainnameshop.com | 19 Mar 2020 | 8 Oct 2024 | 19 Mar 2025 |
| 884 | acanthusmarketing.co.uk | - | 24 Aug 2020 | 23 Aug 2024 | 24 Aug 2025 |
| 885 | acanthuslodge.org.uk | - | 24 Nov 2021 | 12 Dec 2023 | 24 Nov 2025 |
| 886 | acanthusconsultancy.co.uk | - | 15 Jun 2021 | 31 May 2025 | 15 Jun 2026 |
| 887 | acanthdrin.com | NameCheap, Inc. | 13 May 2023 | 25 Jul 2024 | 13 May 2024 |
| 888 | acanthacollective.co.uk | - | 9 May 2022 | 11 Aug 2024 | 9 May 2027 |
| 889 | acanthisaviation.com | GoDaddy.com, LLC | 17 May 2023 | 18 May 2025 | 17 May 2026 |
| 890 | acanthusarquitectos.com | GoDaddy.com, LLC | 17 May 2023 | 23 May 2025 | 17 May 2026 |
| 891 | acanthaestates.co.uk | - | 9 May 2022 | 11 Aug 2024 | 9 May 2027 |
| 892 | acanthxolu.space | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 May 2023 | 1 Jul 2024 | 25 May 2024 |
| 893 | acantheatelier.com | PSI-USA, Inc. dba Domain Robot | 26 May 2023 | 27 May 2025 | 26 May 2026 |
| 894 | acanthuis-pe.com | NameCheap, Inc. | 6 Jun 2023 | 7 Jun 2024 | 6 Jun 2025 |
| 895 | acanthusdesignco.com | Google, Inc. | 18 Jun 2023 | 18 Jun 2023 | 18 Jun 2024 |
| 896 | acanthodeanpreglobulin.mom | - | 19 Jun 2023 | 31 Jul 2024 | 19 Jun 2024 |
| 897 | acanthitepartners.com | Google, Inc. | 27 Jun 2023 | 12 Jun 2025 | 27 Jun 2026 |
| 898 | acanthite-partners.com | Google, Inc. | 27 Jun 2023 | 12 Jun 2025 | 27 Jun 2026 |
| 899 | acanthusfiresafety.co.uk | - | 17 Jan 2022 | 31 Mar 2024 | 17 Jan 2024 |
| 900 | acanthusarms.co.uk | - | 13 Dec 2021 | 7 Aug 2024 | 13 Dec 2025 |
| 901 | acanthium.co.uk | - | 30 Mar 2022 | 7 May 2025 | 30 Mar 2026 |
| 902 | acanthusonline.co.uk | - | 22 Jun 2022 | 3 Mar 2024 | 22 Jun 2024 |
| 903 | acanthuspaservices.co.uk | - | 2 Apr 2019 | 3 Apr 2025 | 2 Apr 2026 |
| 904 | acanthusconsulting.co.uk | - | 28 May 2010 | 28 Apr 2025 | 28 May 2026 |
| 905 | acanthite.partners | Google, Inc. | 11 Jul 2023 | 27 Jun 2025 | 11 Jul 2026 |
| 906 | acanthus.style | NameCheap, Inc. | 26 Jul 2023 | 1 Jul 2025 | 26 Jul 2026 |
| 907 | acanthusco.com | Wix.com Ltd. | 1 Aug 2023 | 11 Oct 2024 | 1 Aug 2024 |
| 908 | acanthnivyry.xyz | NameCheap, Inc. | 1 Aug 2023 | 12 Sep 2024 | 1 Aug 2024 |
| 909 | acanthias.com | Tucows Domains Inc. | 30 Aug 2023 | 10 Oct 2024 | 30 Aug 2024 |
| 910 | acanthus.uk | - | 29 Aug 2023 | 29 Aug 2023 | 29 Aug 2024 |
| 911 | acanthdttm.com | NameCheap, Inc. | 8 Sep 2023 | 20 Oct 2024 | 8 Sep 2024 |
| 912 | acanthispro.com | GoDaddy.com, LLC | 21 Sep 2023 | 22 Sep 2024 | 21 Sep 2025 |
| 913 | acanthtiro.com | NameCheap, Inc. | 21 Sep 2023 | 2 Nov 2024 | 21 Sep 2024 |
| 914 | acanthophorouscorp.best | NameKing.com Inc. | 25 Sep 2023 | 26 Sep 2024 | 25 Sep 2025 |
| 915 | acanthoid.cn | ???????????? | 18 Jun 2025 | - | 18 Jun 2026 |
| 916 | acanthosis.site | GoDaddy.com, LLC | 20 Oct 2023 | 1 Nov 2024 | 20 Oct 2025 |
| 917 | acanthus-perfume.com | 1API GmbH | 2 Nov 2023 | 21 Jan 2024 | 2 Nov 2026 |
| 918 | acanthusdesignllc.com | Google, Inc. | 6 Nov 2023 | 22 Oct 2024 | 6 Nov 2025 |
| 919 | acanthus.cn | - | 30 Dec 2024 | - | 30 Dec 2025 |
| 920 | acantha.dev | Tucows Domains Inc. | 13 Nov 2023 | 13 Nov 2024 | 13 Nov 2025 |
| 921 | acanthusstudios.store | Synergy Wholesale Pty Ltd | 15 Nov 2023 | 6 Nov 2024 | 15 Nov 2025 |
| 922 | acantha.uk | - | 13 Nov 2023 | 13 Nov 2024 | 13 Nov 2025 |
| 923 | acanthus.amsterdam | Realtime Register B.V. | 22 Nov 2023 | 19 Nov 2024 | 22 Nov 2025 |
| 924 | acantha-lifescience.online | Cronon AG | 28 Nov 2023 | 20 Jul 2025 | 28 Nov 2025 |
| 925 | acantha-lifescience.org | Cronon AG | 28 Nov 2023 | 20 Jul 2025 | 28 Nov 2025 |
| 926 | acantha-lifescience.com | Cronon AG | 28 Nov 2023 | 17 Jan 2025 | 28 Nov 2025 |
| 927 | acanthahealth.info | 1&1 Internet AG | 30 Nov 2023 | 14 Jan 2025 | 30 Nov 2025 |
| 928 | acanthahealth.org | 1&1 Internet AG | 30 Nov 2023 | 14 Jan 2025 | 30 Nov 2025 |
| 929 | acanthahealthservices.org | 1&1 Internet AG | 30 Nov 2023 | 14 Jan 2025 | 30 Nov 2025 |
| 930 | acanthahealth.com | 1&1 Internet AG | 30 Nov 2023 | 30 Nov 2023 | 30 Nov 2025 |
| 931 | acanthahealthservices.com | 1&1 Internet AG | 30 Nov 2023 | 30 Nov 2023 | 30 Nov 2025 |
| 932 | acanthahealth.net | 1&1 Internet AG | 30 Nov 2023 | 30 Nov 2023 | 30 Nov 2025 |
| 933 | acanthahealthservices.net | 1&1 Internet AG | 30 Nov 2023 | 30 Nov 2023 | 30 Nov 2025 |
| 934 | acanthscci.site | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Dec 2023 | 27 Jan 2025 | 21 Dec 2024 |
| 935 | acanthusseniorliving.com | GoDaddy.com, LLC | 8 Jan 2024 | 31 Mar 2025 | 8 Jan 2027 |
| 936 | acanthusmarble.com.au | - | - | 22 May 2025 | - |
| 937 | acanthysfilms.com | GoDaddy.com, LLC | 23 Jan 2024 | 23 Jan 2024 | 23 Jan 2027 |
| 938 | acanthustours.com | Papaki Ltd. | 24 Jan 2024 | 9 Apr 2024 | 24 Jan 2026 |
| 939 | acanthopomatous.sbs | Above.com Pty Ltd. | 25 May 2025 | 30 May 2025 | 25 May 2026 |
| 940 | acanthidivest.digital | URL Solutions, Inc. | 28 Jan 2024 | 29 May 2024 | 28 Jan 2025 |
| 941 | acanthusink.com | GoDaddy.com, LLC | 28 Jan 2024 | 28 Jan 2024 | 28 Jan 2027 |
| 942 | acanthus-id.jp | - | 7 Nov 2018 | 1 Dec 2024 | 30 Nov 2025 |
| 943 | acanthusfloralandgardendesign.com | GoDaddy.com, LLC | 11 Feb 2024 | 15 Oct 2024 | 11 Feb 2026 |
| 944 | acanthus-tiles.com | Wix.com Ltd. | 15 Feb 2024 | 27 Apr 2025 | 15 Feb 2025 |
| 945 | acanthus.store | - | 14 May 2025 | 20 May 2025 | 14 May 2026 |
| 946 | acanthodii.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 24 Feb 2024 | 25 Feb 2025 | 24 Feb 2026 |
| 947 | acanthodian.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 24 Feb 2024 | 24 Apr 2025 | 24 Feb 2026 |
| 948 | acanthuslorem.com | GoDaddy.com, LLC | 28 Feb 2024 | 12 Mar 2025 | 28 Feb 2026 |
| 949 | acanthocephalan.shop | NameCheap, Inc. | 2 Mar 2024 | 14 Apr 2025 | 2 Mar 2025 |
| 950 | acanthusfloralandgarden.com | GoDaddy.com, LLC | 4 Mar 2024 | 4 Mar 2024 | 4 Mar 2027 |
| 951 | acanthonus.info | One.com A/S | 10 Mar 2024 | 24 Apr 2025 | 10 Mar 2026 |
| 952 | acanthonus.com | One.com A/S | 10 Mar 2024 | 11 Mar 2025 | 10 Mar 2026 |
| 953 | acanthonus.online | One.com A/S | 10 Mar 2024 | 25 Apr 2025 | 10 Mar 2026 |
| 954 | acanthusgreen.com.au | - | - | 17 May 2025 | - |
| 955 | acanthus66-tapissier.com | OVH sas | 13 Mar 2024 | 13 Mar 2024 | 13 Mar 2025 |
| 956 | acanthaclub.store | NameCheap, Inc. | 13 Mar 2024 | 3 Mar 2025 | 13 Mar 2026 |
| 957 | acanthe-developpement.com | GoDaddy.com, LLC | 31 Mar 2024 | 31 Mar 2024 | 31 Mar 2025 |
| 958 | acantha.co.uk | - | 1 Nov 2018 | 1 Nov 2024 | 1 Nov 2025 |
| 959 | acantho.us | NameCheap, Inc. | 13 Mar 2023 | 13 Mar 2024 | 13 Mar 2024 |
| 960 | acanthe.nl | - | 20 Oct 2010 | 8 Nov 2023 | - |
| 961 | acanthus-antiek.nl | - | 8 Jun 2022 | 31 May 2025 | - |
| 962 | acanthus-byeva-bende.top | URL Solutions, Inc. | 22 Mar 2024 | 30 Apr 2025 | 22 Mar 2025 |
| 963 | acanthus.studio | Network Solutions, LLC | 23 Jul 2021 | 29 May 2025 | 23 Jul 2026 |
| 964 | acanthus.co | Dynadot, LLC | 12 Nov 2021 | 18 Jun 2025 | 12 Nov 2025 |
| 965 | acanthusbyeva-bende.top | URL Solutions, Inc. | 22 Mar 2024 | 30 Apr 2025 | 22 Mar 2025 |
| 966 | acanthusrha.co.uk | - | 12 Oct 2021 | 25 Jul 2024 | 12 Oct 2032 |
| 967 | acanthuspgb.nl | - | 29 May 2009 | 17 Sep 2020 | - |
| 968 | acanthustore.co.uk | - | 14 Oct 2019 | 14 Sep 2023 | 14 Oct 2025 |
| 969 | acanthusstudios.shop | DropExtra.com, Inc. | 15 Nov 2023 | 18 Nov 2023 | 15 Nov 2024 |
| 970 | acanthushoveniersbedrijf.nl | - | 28 Aug 2006 | 20 Mar 2024 | - |
| 971 | acanthuschange.co.uk | - | 30 Jul 2021 | 29 Jul 2025 | 30 Jul 2026 |
| 972 | acanthusconstructionfl.com | GoDaddy.com, LLC | 19 Apr 2024 | 19 Apr 2024 | 19 Apr 2027 |
| 973 | acanthaperagrine.com | GoDaddy.com, LLC | 20 Apr 2024 | 21 Apr 2025 | 20 Apr 2026 |
| 974 | acanthaperegrine.com | GoDaddy.com, LLC | 21 Apr 2024 | 22 Apr 2025 | 21 Apr 2026 |
| 975 | acanthisfunding.com | GoDaddy.com, LLC | 28 Apr 2024 | 20 Aug 2024 | 28 Apr 2027 |
| 976 | acanthagroup.co.uk | - | 1 Oct 2020 | 24 Sep 2024 | 1 Oct 2025 |
| 977 | acanthusandangelica.co.uk | - | 1 Jun 2020 | 2 May 2025 | 1 Jun 2026 |
| 978 | acanthion.co.uk | - | 20 Oct 2018 | 29 Sep 2024 | 20 Oct 2025 |
| 979 | acanthalondon.co.uk | - | 9 May 2022 | 11 Aug 2024 | 9 May 2027 |
| 980 | acanthocercus.de | - | - | 10 May 2009 | - |
| 981 | acanthus-band.de | - | - | 7 Jun 2021 | - |
| 982 | acanthus-ev.de | - | - | 7 Jun 2018 | - |
| 983 | acanthus-legal.de | - | - | 28 May 2025 | - |
| 984 | acanthus-viaregia.de | - | - | 25 Jul 2015 | - |
| 985 | acanthe-atelier.fr | OVH sas | 22 Feb 2018 | 31 Mar 2025 | 22 Feb 2026 |
| 986 | acanthe-design.fr | - | 13 Jul 2024 | 11 Jul 2025 | 13 Jul 2025 |
| 987 | acanthe-hexagone.fr | - | 25 Jan 2013 | 28 Feb 2025 | 25 Jan 2026 |
| 988 | acanthe-hotel-bordeaux.fr | - | 11 May 2012 | 31 May 2025 | 19 Apr 2026 |
| 989 | acanthe-immo.fr | OVH sas | 3 Oct 2007 | 30 Nov 2024 | 3 Oct 2025 |
| 990 | acanthe-imprimerie.fr | - | 15 Jun 2020 | 14 Jun 2025 | 15 Jun 2025 |
| 991 | acanthe-laval.fr | OVH sas | 22 Jan 2024 | 28 Feb 2025 | 22 Jan 2026 |
| 992 | acanthe-paysages-chateauneuf.fr | OVH sas | 13 Nov 2009 | 8 Jun 2025 | 13 Nov 2027 |
| 993 | acanthe-terrains.fr | OVH sas | 4 Oct 2006 | 31 Dec 2024 | 15 Nov 2025 |
| 994 | acanthe-uniforme.fr | OVH sas | 18 Dec 2015 | 31 Jan 2025 | 18 Dec 2025 |
| 995 | acanthe-uniformes.fr | OVH sas | 18 Dec 2015 | 31 Jan 2025 | 18 Dec 2025 |
| 996 | acantha-conseils.fr | - | 27 Aug 2012 | 20 Jul 2024 | 27 Aug 2026 |
| 997 | acanthe-conseil.fr | - | 7 Jan 2013 | 31 Oct 2024 | 22 Sep 2025 |
| 998 | acantheavocats.fr | OVH sas | 13 Jul 2006 | 30 Jun 2025 | 13 Jul 2027 |
| 999 | acanthehotel.fr | OVH sas | 6 Mar 2014 | 19 Mar 2025 | 6 Mar 2026 |
| 1000 | acanthique.fr | OVH sas | 1 Mar 2004 | 30 Apr 2025 | 1 Mar 2026 |
Displaying 1,000 out of 1,104 domains starting with the keyword "ACANTH". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=acanth
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |