Our database now contains whois records of 614 Million (614,049,929) domain names.
Login / Password / Signup

Domain: CRIMINALDEFENSELAWYERPHILADELPHIA.COM
Registrar: Porkbun LLC (4.25 million domains)
Query Time: 4 May 2025 - 10:48 AM UTC  [6 HRS BACK] [REFRESH]


Registered: 21st April 2024  [1 year, 13 days back]
Updated: 3rd May 2025  [Yesterday]
Expiry: 21st April 2026  [11 months, 16 days left]


DOMAIN STATUS

clientDeleteProhibited
clientTransferProhibited


NAME SERVERS

curitiba.ns.porkbun.com
fortaleza.ns.porkbun.com
maceio.ns.porkbun.com
salvador.ns.porkbun.com


SHARE THIS PAGE

Short URL: whoxy.com/criminaldefenselawyerphiladelphia.com
Permalink: https://www.whoxy.com/criminaldefenselawyerphiladelphia.com

Facebook Twitter Google+ LinkedIn Email

--------------------------------------------------
Generator: x2.autowhois.com
Registry WHOIS: whois.verisign-grs.com
Query Time: Sun, 04 May 2025 10:48:07 +0000
--------------------------------------------------

Domain Name: CRIMINALDEFENSELAWYERPHILADELPHIA.COM
Registry Domain ID: 2874287186_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.porkbun.com
Registrar URL: http://porkbun.com
Updated Date: 2025-05-03T13:19:17Z
Creation Date: 2024-04-21T16:27:28Z
Registry Expiry Date: 2026-04-21T16:27:28Z
Registrar: Porkbun LLC
Registrar IANA ID: 1861
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 5038508351
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: CURITIBA.NS.PORKBUN.COM
Name Server: FORTALEZA.NS.PORKBUN.COM
Name Server: MACEIO.NS.PORKBUN.COM
Name Server: SALVADOR.NS.PORKBUN.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2025-05-04T10:47:59Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar.  Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability.  VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
{
    "status": 1,
    "domain_name": "criminaldefenselawyerphiladelphia.com",
    "query_time": "2025-05-04 10:48:07",
    "whois_server": "whois.porkbun.com",
    "domain_registered": "yes",
    "create_date": "2024-04-21",
    "update_date": "2025-05-03",
    "expiry_date": "2026-04-21",
    "domain_registrar": {
        "iana_id": 1861,
        "registrar_name": "Porkbun LLC",
        "whois_server": "whois.porkbun.com",
        "website_url": "http://porkbun.com",
        "email_address": "[email protected]",
        "phone_number": "5038508351"
    },
    "name_servers": [
        "curitiba.ns.porkbun.com",
        "fortaleza.ns.porkbun.com",
        "maceio.ns.porkbun.com",
        "salvador.ns.porkbun.com"
    ],
    "domain_status": [
        "clientDeleteProhibited",
        "clientTransferProhibited"
    ],
    "raw_whois": "--------------------------------------------------\nGenerator: x2.autowhois.com\nRegistry WHOIS: whois.verisign-grs.com\nQuery Time: Sun, 04 May 2025 10:48:07 +0000\n--------------------------------------------------\n\nDomain Name: CRIMINALDEFENSELAWYERPHILADELPHIA.COM\r\nRegistry Domain ID: 2874287186_DOMAIN_COM-VRSN\r\nRegistrar WHOIS Server: whois.porkbun.com\r\nRegistrar URL: http://porkbun.com\r\nUpdated Date: 2025-05-03T13:19:17Z\r\nCreation Date: 2024-04-21T16:27:28Z\r\nRegistry Expiry Date: 2026-04-21T16:27:28Z\r\nRegistrar: Porkbun LLC\r\nRegistrar IANA ID: 1861\r\nRegistrar Abuse Contact Email: [email protected]\r\nRegistrar Abuse Contact Phone: 5038508351\r\nDomain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited\r\nDomain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited\r\nName Server: CURITIBA.NS.PORKBUN.COM\r\nName Server: FORTALEZA.NS.PORKBUN.COM\r\nName Server: MACEIO.NS.PORKBUN.COM\r\nName Server: SALVADOR.NS.PORKBUN.COM\r\nDNSSEC: unsigned\r\nURL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/\r\n>>> Last update of whois database: 2025-05-04T10:47:59Z <<<\r\n\r\nFor more information on Whois status codes, please visit https://icann.org/epp\r\n\r\nNOTICE: The expiration date displayed in this record is the date the\r\nregistrar's sponsorship of the domain name registration in the registry is\r\ncurrently set to expire. This date does not necessarily reflect the expiration\r\ndate of the domain name registrant's agreement with the sponsoring\r\nregistrar.  Users may consult the sponsoring registrar's Whois database to\r\nview the registrar's reported date of expiration for this registration.\r\n\r\nTERMS OF USE: You are not authorized to access or query our Whois\r\ndatabase through the use of electronic processes that are high-volume and\r\nautomated except as reasonably necessary to register domain names or\r\nmodify existing registrations; the Data in VeriSign Global Registry\r\nServices' (\"VeriSign\") Whois database is provided by VeriSign for\r\ninformation purposes only, and to assist persons in obtaining information\r\nabout or related to a domain name registration record. VeriSign does not\r\nguarantee its accuracy. By submitting a Whois query, you agree to abide\r\nby the following terms of use: You agree that you may use this Data only\r\nfor lawful purposes and that under no circumstances will you use this Data\r\nto: (1) allow, enable, or otherwise support the transmission of mass\r\nunsolicited, commercial advertising or solicitations via e-mail, telephone,\r\nor facsimile; or (2) enable high volume, automated, electronic processes\r\nthat apply to VeriSign (or its computer systems). The compilation,\r\nrepackaging, dissemination or other use of this Data is expressly\r\nprohibited without the prior written consent of VeriSign. You agree not to\r\nuse electronic processes that are automated and high-volume to access or\r\nquery the Whois database except as reasonably necessary to register\r\ndomain names or modify existing registrations. VeriSign reserves the right\r\nto restrict your access to the Whois database in its sole discretion to ensure\r\noperational stability.  VeriSign may restrict or terminate your access to the\r\nWhois database for failure to abide by these terms of use. VeriSign\r\nreserves the right to modify these terms at any time.\r\n\r\nThe Registry database contains ONLY .COM, .NET, .EDU domains and\r\nRegistrars."
}
<?xml version="1.0" encoding="UTF-8"?>
<root>
 <status>1</status>
 <domain_name>criminaldefenselawyerphiladelphia.com</domain_name>
 <query_time>2025-05-04 10:48:07</query_time>
 <whois_server>whois.porkbun.com</whois_server>
 <domain_registered>yes</domain_registered>
 <create_date>2024-04-21</create_date>
 <update_date>2025-05-03</update_date>
 <expiry_date>2026-04-21</expiry_date>
 <domain_registrar>
  <iana_id>1861</iana_id>
  <registrar_name>Porkbun LLC</registrar_name>
  <whois_server>whois.porkbun.com</whois_server>
  <website_url>http://porkbun.com</website_url>
  <email_address>[email protected]</email_address>
  <phone_number>5038508351</phone_number>
 </domain_registrar>
 <name_servers>
  <value>curitiba.ns.porkbun.com</value>
  <value>fortaleza.ns.porkbun.com</value>
  <value>maceio.ns.porkbun.com</value>
  <value>salvador.ns.porkbun.com</value>
 </name_servers>
 <domain_status>
  <value>clientDeleteProhibited</value>
  <value>clientTransferProhibited</value>
 </domain_status>
 <raw_whois>--------------------------------------------------
Generator: x2.autowhois.com
Registry WHOIS: whois.verisign-grs.com
Query Time: Sun, 04 May 2025 10:48:07 +0000
--------------------------------------------------

Domain Name: CRIMINALDEFENSELAWYERPHILADELPHIA.COM&#13;
Registry Domain ID: 2874287186_DOMAIN_COM-VRSN&#13;
Registrar WHOIS Server: whois.porkbun.com&#13;
Registrar URL: http://porkbun.com&#13;
Updated Date: 2025-05-03T13:19:17Z&#13;
Creation Date: 2024-04-21T16:27:28Z&#13;
Registry Expiry Date: 2026-04-21T16:27:28Z&#13;
Registrar: Porkbun LLC&#13;
Registrar IANA ID: 1861&#13;
Registrar Abuse Contact Email: [email protected]&#13;
Registrar Abuse Contact Phone: 5038508351&#13;
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited&#13;
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited&#13;
Name Server: CURITIBA.NS.PORKBUN.COM&#13;
Name Server: FORTALEZA.NS.PORKBUN.COM&#13;
Name Server: MACEIO.NS.PORKBUN.COM&#13;
Name Server: SALVADOR.NS.PORKBUN.COM&#13;
DNSSEC: unsigned&#13;
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/&#13;
&gt;&gt;&gt; Last update of whois database: 2025-05-04T10:47:59Z &lt;&lt;&lt;&#13;
&#13;
For more information on Whois status codes, please visit https://icann.org/epp&#13;
&#13;
NOTICE: The expiration date displayed in this record is the date the&#13;
registrar's sponsorship of the domain name registration in the registry is&#13;
currently set to expire. This date does not necessarily reflect the expiration&#13;
date of the domain name registrant's agreement with the sponsoring&#13;
registrar.  Users may consult the sponsoring registrar's Whois database to&#13;
view the registrar's reported date of expiration for this registration.&#13;
&#13;
TERMS OF USE: You are not authorized to access or query our Whois&#13;
database through the use of electronic processes that are high-volume and&#13;
automated except as reasonably necessary to register domain names or&#13;
modify existing registrations; the Data in VeriSign Global Registry&#13;
Services' (&quot;VeriSign&quot;) Whois database is provided by VeriSign for&#13;
information purposes only, and to assist persons in obtaining information&#13;
about or related to a domain name registration record. VeriSign does not&#13;
guarantee its accuracy. By submitting a Whois query, you agree to abide&#13;
by the following terms of use: You agree that you may use this Data only&#13;
for lawful purposes and that under no circumstances will you use this Data&#13;
to: (1) allow, enable, or otherwise support the transmission of mass&#13;
unsolicited, commercial advertising or solicitations via e-mail, telephone,&#13;
or facsimile; or (2) enable high volume, automated, electronic processes&#13;
that apply to VeriSign (or its computer systems). The compilation,&#13;
repackaging, dissemination or other use of this Data is expressly&#13;
prohibited without the prior written consent of VeriSign. You agree not to&#13;
use electronic processes that are automated and high-volume to access or&#13;
query the Whois database except as reasonably necessary to register&#13;
domain names or modify existing registrations. VeriSign reserves the right&#13;
to restrict your access to the Whois database in its sole discretion to ensure&#13;
operational stability.  VeriSign may restrict or terminate your access to the&#13;
Whois database for failure to abide by these terms of use. VeriSign&#13;
reserves the right to modify these terms at any time.&#13;
&#13;
The Registry database contains ONLY .COM, .NET, .EDU domains and&#13;
Registrars.</raw_whois>
</root>

Whois API Demo

Whois Lookup API

You can fetch the above results using our Whois Lookup API.

https://api.whoxy.com/?key=xxxxx&whois=criminaldefenselawyerphiladelphia.com

Whois API digs into WHOIS registry referral chains until the correct WHOIS servers are found, for the most complete WHOIS data.
Our WHOIS parser converts WHOIS data into well-structured fields (XML & JSON), which can easily be read by your application.
Whois API supports a total of 2026 Domain Extensions (gTLDs, ccTLDs & new gTLDs), ensuring all domains are supported.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Whois Lookup Pricing Total API Calls Price CPM Purchase
1,000 Whois Lookup API Queries 1,000 $2 $2.00 Order Now
10,000 Whois Lookup API Queries 10,000 $20 $2.00 Order Now
50,000 Whois Lookup API Queries 50,000 $75 $1.50 Order Now
250,000 Whois Lookup API Queries 250,000 $300 $1.20 Order Now
1 Million Whois Lookup API Queries 1,000,000 $1,000 $1.00 Order Now
10 Million Whois Lookup API Queries 10,000,000 $5,000 $0.50 Order Now
25 Million Whois Lookup API Queries 25,000,000 $10,000 $0.40 Order Now

Who owned criminaldefenselawyerphiladelphia.com in the past? (10 records)

22 DEC 2014

Name: Domain Administrator (32.3 million domains)
Email: [email protected] (6,769 domains)
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns1.linode.com, ns2.linode.com
Status: clientDeleteProhibited, clientRenewProhibited, clientTransferProhibited, clientUpdateProhibited

5 JUL 2015

Name: Kevin Stouwie (6,514 domains)  UPDATED
Company: Law Office of Kevin Stouwie (6,376 domains)
Email: [email protected] (4,535 domains)  UPDATED
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns33.domaincontrol.com, ns34.domaincontrol.com  UPDATED
Status: clientDeleteProhibited, clientRenewProhibited, clientTransferProhibited, clientUpdateProhibited

12 MAR 2016

Name: Dmitry Pogrebetsky (26,346 domains)  UPDATED
Company: Primepage Inc. (25,078 domains)  UPDATED
Email: [email protected] (21,127 domains)  UPDATED
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns1.dsredirection.com, ns2.dsredirection.com  UPDATED
Status: clientDeleteProhibited, clientRenewProhibited, clientTransferProhibited, clientUpdateProhibited

1 AUG 2017

Name: Dmitry Pogrebetsky (26,346 domains)
Company: Primepage Inc. (25,078 domains)
Email: [email protected] (21,127 domains)
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns1.smartname.com, ns2.smartname.com  UPDATED
Status: clientTransferProhibited clientUpdateProhibited clientRenewProhibited clientDeleteProhibited  UPDATED

5 APR 2019

Name: Primepage Inc. (4,668 domains)  UPDATED
Company: Primepage Inc. (25,078 domains)
Email: [email protected] (2,231 domains)  UPDATED
Country: United Kingdom (27 million domains from United Kingdom for $1,000)
Nameservers: ns25.domaincontrol.com, ns26.domaincontrol.com  UPDATED
Status: clientDeleteProhibited, clientRenewProhibited, clientTransferProhibited, clientUpdateProhibited  UPDATED

1 OCT 2020

Name: CriminalDefenseLawyerPhiladelphia.com  UPDATED
Company: CriminalDefenseLawyerPhiladelphia.com  UPDATED
Country: India (10.6 million domains from India for $750)
Nameservers: ns1.daaz.org, ns2.daaz.org  UPDATED
Status: clientDeleteProhibited, clientRenewProhibited, clientTransferProhibited, clientUpdateProhibited

13 JUL 2021

Name: vkdomains (159 domains)  UPDATED
Company: vkdomains (209 domains)  UPDATED
Country: India (10.6 million domains from India for $750)
Nameservers: ns1.undeveloped.com, ns2.undeveloped.com  UPDATED
Status: clientDeleteProhibited, clientRenewProhibited, clientTransferProhibited, clientUpdateProhibited

24 DEC 2023

Name: Whois Privacy (9.97 million domains)  UPDATED
Company: Private by Design, LLC (13.8 million domains)  UPDATED
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns1.dan.com, ns2.dan.com  UPDATED
Status: clientDeleteProhibited, clientTransferProhibited  UPDATED

2 MAR 2024

Name: Whois Privacy (9.97 million domains)
Company: Private by Design, LLC (13.8 million domains)
Country: United States (231 million domains from United States for $6,250)
Nameservers: curitiba.ns.porkbun.com, fortaleza.ns.porkbun.com, maceio.ns.porkbun.com, salvador.ns.porkbun.com  UPDATED
Status: clientDeleteProhibited, clientTransferProhibited

5 JAN 2025

Name: Whois Privacy (9.97 million domains)
Company: Private by Design, LLC (13.8 million domains)
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns1.afternic.com, ns2.afternic.com  UPDATED
Status: clientDeleteProhibited, clientTransferProhibited

Whois History API returns all the historical WHOIS records of a domain name. For more details, please visit https://www.whoxy.com/whois-history/