Our database now contains whois records of 716 Million (716,952,099) domain names.
Login / Password / Signup

Domain: CHIMINEYCRICKETCHIMNEYSWEEP.NET (2 similar domains)
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com (21.9 million domains)
Query Time: 26 Aug 2026 - 6:07 AM UTC  [2 HRS BACK] [REFRESH]


Registered: 16th February 2016  [10 years, 6 months, 10 days back]
Updated: 7th April 2026  [4 months, 19 days back]
Expiry: 16th February 2027  [5 months, 20 days left]


DOMAIN STATUS

clientTransferProhibited


NAME SERVERS

ns1.mysecurecloudhost.com
ns2.mysecurecloudhost.com
ns3.mysecurecloudhost.com
ns4.mysecurecloudhost.com


REGISTRANT CONTACT

Name: Sootmaster Team (112 domains)
Company: REDACTED FOR PRIVACY (591 million domains)
Address: 5223 Black Road
City: Milton
State: FL
ZIP Code: 32583
Country: United States (231 million domains from United States for $6,250)
Email: [email protected] (120 domains)
Phone: +1.8503086516


ADMINISTRATIVE CONTACT

Name: Sootmaster Team (112 domains)
Company: Sootmaster LLC (51 domains)
Address: 5223 Black Road
City: Milton
State: FL
ZIP Code: 32583
Country: United States (231 million domains from United States for $6,250)
Email: [email protected] (120 domains)
Phone: +1.8503086516


TECHNICAL CONTACT

Name: Sootmaster Team (112 domains)
Company: Sootmaster LLC (51 domains)
Address: 5223 Black Road
City: Milton
State: FL
ZIP Code: 32583
Country: United States (231 million domains from United States for $6,250)
Email: [email protected] (120 domains)
Phone: +1.8503086516


SHARE THIS PAGE

Short URL: whoxy.com/chimineycricketchimneysweep.net
Permalink: https://www.whoxy.com/chimineycricketchimneysweep.net

Facebook Twitter Google+ LinkedIn Email

--------------------------------------------------
Generator: x3.autowhois.com
Registry WHOIS: whois.verisign-grs.com
Query Time: Wed, 26 Aug 2026 06:07:42 +0000
--------------------------------------------------

Domain Name: CHIMINEYCRICKETCHIMNEYSWEEP.NET
Registry Domain ID: 2003242998_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.PublicDomainRegistry.com
Registrar URL: http://www.publicdomainregistry.com
Updated Date: 2026-04-07T21:05:11Z
Creation Date: 2016-02-16T10:38:11Z
Registry Expiry Date: 2027-02-16T10:38:11Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.MYSECURECLOUDHOST.COM
Name Server: NS2.MYSECURECLOUDHOST.COM
Name Server: NS3.MYSECURECLOUDHOST.COM
Name Server: NS4.MYSECURECLOUDHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2026-08-26T06:07:33Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar.  Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability.  VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

--------------------------------------------------
Registrar WHOIS: whois.publicdomainregistry.com
Query Time: Wed, 26 Aug 2026 06:07:43 +0000
--------------------------------------------------

Domain Name: CHIMINEYCRICKETCHIMNEYSWEEP.NET
Registry Domain ID: 2003242998_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2026-04-07T21:05:12Z
Creation Date: 2016-02-16T10:38:11Z
Registrar Registration Expiration Date: 2027-02-16T10:38:11Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Sootmaster Team
Registrant Organization: REDACTED FOR PRIVACY
Registrant Street: 5223 Black Road   
Registrant City: Milton
Registrant State/Province: FL
Registrant Postal Code: 32583
Registrant Country: US
Registrant Phone: +1.8503086516
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: [email protected]
Registry Admin ID: Not Available From Registry
Admin Name: Sootmaster Team
Admin Organization: Sootmaster LLC
Admin Street: 5223 Black Road  
Admin City: Milton
Admin State/Province: FL
Admin Postal Code: 32583
Admin Country: US
Admin Phone: +1.8503086516
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: [email protected]
Registry Tech ID: Not Available From Registry
Tech Name: Sootmaster Team
Tech Organization: Sootmaster LLC
Tech Street: 5223 Black Road  
Tech City: Milton
Tech State/Province: FL
Tech Postal Code: 32583
Tech Country: US
Tech Phone: +1.8503086516
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: [email protected]
Name Server: ns1.mysecurecloudhost.com
Name Server: ns2.mysecurecloudhost.com
Name Server: ns3.mysecurecloudhost.com
Name Server: ns4.mysecurecloudhost.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2026-08-26T06:07:43Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: FASTCOMET

The data in this whois database is provided to you for information purposes 
only, that is, to assist you in obtaining information about or related to a 
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree 
that you will use this data only for lawful purposes and that, under no 
circumstances will you use this data to: 
(1) enable high volume, automated, electronic processes that stress or load 
this whois database system providing you this information; or 
(2) allow, enable, or otherwise support the transmission of mass unsolicited, 
commercial advertising or solicitations via direct mail, electronic mail, or 
by telephone. 
The compilation, repackaging, dissemination or other use of this data is 
expressly prohibited without prior written consent from us. The Registrar of 
record is PDR Ltd. d/b/a PublicDomainRegistry.com. 
We reserve the right to modify these terms at any time. 
By submitting this query, you agree to abide by these terms.
{
    "status": 1,
    "domain_name": "chimineycricketchimneysweep.net",
    "query_time": "2026-08-26 06:07:42",
    "whois_server": "whois.publicdomainregistry.com",
    "domain_registered": "yes",
    "create_date": "2016-02-16",
    "update_date": "2026-04-07",
    "expiry_date": "2027-02-16",
    "domain_registrar": {
        "iana_id": 303,
        "registrar_name": "PDR Ltd. d/b/a PublicDomainRegistry.com",
        "whois_server": "whois.publicdomainregistry.com",
        "website_url": "www.publicdomainregistry.com",
        "email_address": "[email protected]",
        "phone_number": "+1.2013775952"
    },
    "registrant_contact": {
        "full_name": "Sootmaster Team",
        "company_name": "REDACTED FOR PRIVACY",
        "mailing_address": "5223 Black Road",
        "city_name": "Milton",
        "state_name": "FL",
        "zip_code": "32583",
        "country_name": "United States",
        "country_code": "US",
        "email_address": "[email protected]",
        "phone_number": "+1.8503086516"
    },
    "administrative_contact": {
        "full_name": "Sootmaster Team",
        "company_name": "Sootmaster LLC",
        "mailing_address": "5223 Black Road",
        "city_name": "Milton",
        "state_name": "FL",
        "zip_code": "32583",
        "country_name": "United States",
        "country_code": "US",
        "email_address": "[email protected]",
        "phone_number": "+1.8503086516"
    },
    "technical_contact": {
        "full_name": "Sootmaster Team",
        "company_name": "Sootmaster LLC",
        "mailing_address": "5223 Black Road",
        "city_name": "Milton",
        "state_name": "FL",
        "zip_code": "32583",
        "country_name": "United States",
        "country_code": "US",
        "email_address": "[email protected]",
        "phone_number": "+1.8503086516"
    },
    "name_servers": [
        "ns1.mysecurecloudhost.com",
        "ns2.mysecurecloudhost.com",
        "ns3.mysecurecloudhost.com",
        "ns4.mysecurecloudhost.com"
    ],
    "domain_status": [
        "clientTransferProhibited"
    ],
    "raw_whois": "--------------------------------------------------\nGenerator: x3.autowhois.com\nRegistry WHOIS: whois.verisign-grs.com\nQuery Time: Wed, 26 Aug 2026 06:07:42 +0000\n--------------------------------------------------\n\nDomain Name: CHIMINEYCRICKETCHIMNEYSWEEP.NET\r\nRegistry Domain ID: 2003242998_DOMAIN_NET-VRSN\r\nRegistrar WHOIS Server: whois.PublicDomainRegistry.com\r\nRegistrar URL: http://www.publicdomainregistry.com\r\nUpdated Date: 2026-04-07T21:05:11Z\r\nCreation Date: 2016-02-16T10:38:11Z\r\nRegistry Expiry Date: 2027-02-16T10:38:11Z\r\nRegistrar: PDR Ltd. d/b/a PublicDomainRegistry.com\r\nRegistrar IANA ID: 303\r\nRegistrar Abuse Contact Email: [email protected]\r\nRegistrar Abuse Contact Phone: +1.2013775952\r\nDomain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited\r\nName Server: NS1.MYSECURECLOUDHOST.COM\r\nName Server: NS2.MYSECURECLOUDHOST.COM\r\nName Server: NS3.MYSECURECLOUDHOST.COM\r\nName Server: NS4.MYSECURECLOUDHOST.COM\r\nDNSSEC: unsigned\r\nURL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/\r\n>>> Last update of whois database: 2026-08-26T06:07:33Z <<<\r\n\r\nFor more information on Whois status codes, please visit https://icann.org/epp\r\n\r\nNOTICE: The expiration date displayed in this record is the date the\r\nregistrar's sponsorship of the domain name registration in the registry is\r\ncurrently set to expire. This date does not necessarily reflect the expiration\r\ndate of the domain name registrant's agreement with the sponsoring\r\nregistrar.  Users may consult the sponsoring registrar's Whois database to\r\nview the registrar's reported date of expiration for this registration.\r\n\r\nTERMS OF USE: You are not authorized to access or query our Whois\r\ndatabase through the use of electronic processes that are high-volume and\r\nautomated except as reasonably necessary to register domain names or\r\nmodify existing registrations; the Data in VeriSign Global Registry\r\nServices' (\"VeriSign\") Whois database is provided by VeriSign for\r\ninformation purposes only, and to assist persons in obtaining information\r\nabout or related to a domain name registration record. VeriSign does not\r\nguarantee its accuracy. By submitting a Whois query, you agree to abide\r\nby the following terms of use: You agree that you may use this Data only\r\nfor lawful purposes and that under no circumstances will you use this Data\r\nto: (1) allow, enable, or otherwise support the transmission of mass\r\nunsolicited, commercial advertising or solicitations via e-mail, telephone,\r\nor facsimile; or (2) enable high volume, automated, electronic processes\r\nthat apply to VeriSign (or its computer systems). The compilation,\r\nrepackaging, dissemination or other use of this Data is expressly\r\nprohibited without the prior written consent of VeriSign. You agree not to\r\nuse electronic processes that are automated and high-volume to access or\r\nquery the Whois database except as reasonably necessary to register\r\ndomain names or modify existing registrations. VeriSign reserves the right\r\nto restrict your access to the Whois database in its sole discretion to ensure\r\noperational stability.  VeriSign may restrict or terminate your access to the\r\nWhois database for failure to abide by these terms of use. VeriSign\r\nreserves the right to modify these terms at any time.\r\n\r\nThe Registry database contains ONLY .COM, .NET, .EDU domains and\r\nRegistrars.\n\n--------------------------------------------------\nRegistrar WHOIS: whois.publicdomainregistry.com\nQuery Time: Wed, 26 Aug 2026 06:07:43 +0000\n--------------------------------------------------\n\nDomain Name: CHIMINEYCRICKETCHIMNEYSWEEP.NET\nRegistry Domain ID: 2003242998_DOMAIN_NET-VRSN\nRegistrar WHOIS Server: whois.publicdomainregistry.com\nRegistrar URL: www.publicdomainregistry.com\nUpdated Date: 2026-04-07T21:05:12Z\nCreation Date: 2016-02-16T10:38:11Z\nRegistrar Registration Expiration Date: 2027-02-16T10:38:11Z\nRegistrar: PDR Ltd. d/b/a PublicDomainRegistry.com\nRegistrar IANA ID: 303\nDomain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited\nRegistry Registrant ID: Not Available From Registry\nRegistrant Name: Sootmaster Team\nRegistrant Organization: REDACTED FOR PRIVACY\nRegistrant Street: 5223 Black Road   \nRegistrant City: Milton\nRegistrant State/Province: FL\nRegistrant Postal Code: 32583\nRegistrant Country: US\nRegistrant Phone: +1.8503086516\nRegistrant Phone Ext: \nRegistrant Fax: \nRegistrant Fax Ext: \nRegistrant Email: [email protected]\nRegistry Admin ID: Not Available From Registry\nAdmin Name: Sootmaster Team\nAdmin Organization: Sootmaster LLC\nAdmin Street: 5223 Black Road  \nAdmin City: Milton\nAdmin State/Province: FL\nAdmin Postal Code: 32583\nAdmin Country: US\nAdmin Phone: +1.8503086516\nAdmin Phone Ext: \nAdmin Fax: \nAdmin Fax Ext: \nAdmin Email: [email protected]\nRegistry Tech ID: Not Available From Registry\nTech Name: Sootmaster Team\nTech Organization: Sootmaster LLC\nTech Street: 5223 Black Road  \nTech City: Milton\nTech State/Province: FL\nTech Postal Code: 32583\nTech Country: US\nTech Phone: +1.8503086516\nTech Phone Ext: \nTech Fax: \nTech Fax Ext: \nTech Email: [email protected]\nName Server: ns1.mysecurecloudhost.com\nName Server: ns2.mysecurecloudhost.com\nName Server: ns3.mysecurecloudhost.com\nName Server: ns4.mysecurecloudhost.com\nDNSSEC: Unsigned\nRegistrar Abuse Contact Email: [email protected]\nRegistrar Abuse Contact Phone: +1.2013775952\nURL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/\n>>> Last update of WHOIS database: 2026-08-26T06:07:43Z <<<\n\nFor more information on Whois status codes, please visit https://icann.org/epp\n\nRegistration Service Provided By: FASTCOMET\n\nThe data in this whois database is provided to you for information purposes \nonly, that is, to assist you in obtaining information about or related to a \ndomain name registration record. We make this information available \"as is\",\nand do not guarantee its accuracy. By submitting a whois query, you agree \nthat you will use this data only for lawful purposes and that, under no \ncircumstances will you use this data to: \n(1) enable high volume, automated, electronic processes that stress or load \nthis whois database system providing you this information; or \n(2) allow, enable, or otherwise support the transmission of mass unsolicited, \ncommercial advertising or solicitations via direct mail, electronic mail, or \nby telephone. \nThe compilation, repackaging, dissemination or other use of this data is \nexpressly prohibited without prior written consent from us. The Registrar of \nrecord is PDR Ltd. d/b/a PublicDomainRegistry.com. \nWe reserve the right to modify these terms at any time. \nBy submitting this query, you agree to abide by these terms."
}
<?xml version="1.0" encoding="UTF-8"?>
<root>
 <status>1</status>
 <domain_name>chimineycricketchimneysweep.net</domain_name>
 <query_time>2026-08-26 06:07:42</query_time>
 <whois_server>whois.publicdomainregistry.com</whois_server>
 <domain_registered>yes</domain_registered>
 <create_date>2016-02-16</create_date>
 <update_date>2026-04-07</update_date>
 <expiry_date>2027-02-16</expiry_date>
 <domain_registrar>
  <iana_id>303</iana_id>
  <registrar_name>PDR Ltd. d/b/a PublicDomainRegistry.com</registrar_name>
  <whois_server>whois.publicdomainregistry.com</whois_server>
  <website_url>www.publicdomainregistry.com</website_url>
  <email_address>[email protected]</email_address>
  <phone_number>+1.2013775952</phone_number>
 </domain_registrar>
 <registrant_contact>
  <full_name>Sootmaster Team</full_name>
  <company_name>REDACTED FOR PRIVACY</company_name>
  <mailing_address>5223 Black Road</mailing_address>
  <city_name>Milton</city_name>
  <state_name>FL</state_name>
  <zip_code>32583</zip_code>
  <country_name>United States</country_name>
  <country_code>US</country_code>
  <email_address>[email protected]</email_address>
  <phone_number>+1.8503086516</phone_number>
 </registrant_contact>
 <administrative_contact>
  <full_name>Sootmaster Team</full_name>
  <company_name>Sootmaster LLC</company_name>
  <mailing_address>5223 Black Road</mailing_address>
  <city_name>Milton</city_name>
  <state_name>FL</state_name>
  <zip_code>32583</zip_code>
  <country_name>United States</country_name>
  <country_code>US</country_code>
  <email_address>[email protected]</email_address>
  <phone_number>+1.8503086516</phone_number>
 </administrative_contact>
 <technical_contact>
  <full_name>Sootmaster Team</full_name>
  <company_name>Sootmaster LLC</company_name>
  <mailing_address>5223 Black Road</mailing_address>
  <city_name>Milton</city_name>
  <state_name>FL</state_name>
  <zip_code>32583</zip_code>
  <country_name>United States</country_name>
  <country_code>US</country_code>
  <email_address>[email protected]</email_address>
  <phone_number>+1.8503086516</phone_number>
 </technical_contact>
 <name_servers>
  <value>ns1.mysecurecloudhost.com</value>
  <value>ns2.mysecurecloudhost.com</value>
  <value>ns3.mysecurecloudhost.com</value>
  <value>ns4.mysecurecloudhost.com</value>
 </name_servers>
 <domain_status>
  <value>clientTransferProhibited</value>
 </domain_status>
 <raw_whois>--------------------------------------------------
Generator: x3.autowhois.com
Registry WHOIS: whois.verisign-grs.com
Query Time: Wed, 26 Aug 2026 06:07:42 +0000
--------------------------------------------------

Domain Name: CHIMINEYCRICKETCHIMNEYSWEEP.NET&#13;
Registry Domain ID: 2003242998_DOMAIN_NET-VRSN&#13;
Registrar WHOIS Server: whois.PublicDomainRegistry.com&#13;
Registrar URL: http://www.publicdomainregistry.com&#13;
Updated Date: 2026-04-07T21:05:11Z&#13;
Creation Date: 2016-02-16T10:38:11Z&#13;
Registry Expiry Date: 2027-02-16T10:38:11Z&#13;
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com&#13;
Registrar IANA ID: 303&#13;
Registrar Abuse Contact Email: [email protected]&#13;
Registrar Abuse Contact Phone: +1.2013775952&#13;
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited&#13;
Name Server: NS1.MYSECURECLOUDHOST.COM&#13;
Name Server: NS2.MYSECURECLOUDHOST.COM&#13;
Name Server: NS3.MYSECURECLOUDHOST.COM&#13;
Name Server: NS4.MYSECURECLOUDHOST.COM&#13;
DNSSEC: unsigned&#13;
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/&#13;
&gt;&gt;&gt; Last update of whois database: 2026-08-26T06:07:33Z &lt;&lt;&lt;&#13;
&#13;
For more information on Whois status codes, please visit https://icann.org/epp&#13;
&#13;
NOTICE: The expiration date displayed in this record is the date the&#13;
registrar's sponsorship of the domain name registration in the registry is&#13;
currently set to expire. This date does not necessarily reflect the expiration&#13;
date of the domain name registrant's agreement with the sponsoring&#13;
registrar.  Users may consult the sponsoring registrar's Whois database to&#13;
view the registrar's reported date of expiration for this registration.&#13;
&#13;
TERMS OF USE: You are not authorized to access or query our Whois&#13;
database through the use of electronic processes that are high-volume and&#13;
automated except as reasonably necessary to register domain names or&#13;
modify existing registrations; the Data in VeriSign Global Registry&#13;
Services' (&quot;VeriSign&quot;) Whois database is provided by VeriSign for&#13;
information purposes only, and to assist persons in obtaining information&#13;
about or related to a domain name registration record. VeriSign does not&#13;
guarantee its accuracy. By submitting a Whois query, you agree to abide&#13;
by the following terms of use: You agree that you may use this Data only&#13;
for lawful purposes and that under no circumstances will you use this Data&#13;
to: (1) allow, enable, or otherwise support the transmission of mass&#13;
unsolicited, commercial advertising or solicitations via e-mail, telephone,&#13;
or facsimile; or (2) enable high volume, automated, electronic processes&#13;
that apply to VeriSign (or its computer systems). The compilation,&#13;
repackaging, dissemination or other use of this Data is expressly&#13;
prohibited without the prior written consent of VeriSign. You agree not to&#13;
use electronic processes that are automated and high-volume to access or&#13;
query the Whois database except as reasonably necessary to register&#13;
domain names or modify existing registrations. VeriSign reserves the right&#13;
to restrict your access to the Whois database in its sole discretion to ensure&#13;
operational stability.  VeriSign may restrict or terminate your access to the&#13;
Whois database for failure to abide by these terms of use. VeriSign&#13;
reserves the right to modify these terms at any time.&#13;
&#13;
The Registry database contains ONLY .COM, .NET, .EDU domains and&#13;
Registrars.

--------------------------------------------------
Registrar WHOIS: whois.publicdomainregistry.com
Query Time: Wed, 26 Aug 2026 06:07:43 +0000
--------------------------------------------------

Domain Name: CHIMINEYCRICKETCHIMNEYSWEEP.NET
Registry Domain ID: 2003242998_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2026-04-07T21:05:12Z
Creation Date: 2016-02-16T10:38:11Z
Registrar Registration Expiration Date: 2027-02-16T10:38:11Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Sootmaster Team
Registrant Organization: REDACTED FOR PRIVACY
Registrant Street: 5223 Black Road   
Registrant City: Milton
Registrant State/Province: FL
Registrant Postal Code: 32583
Registrant Country: US
Registrant Phone: +1.8503086516
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: [email protected]
Registry Admin ID: Not Available From Registry
Admin Name: Sootmaster Team
Admin Organization: Sootmaster LLC
Admin Street: 5223 Black Road  
Admin City: Milton
Admin State/Province: FL
Admin Postal Code: 32583
Admin Country: US
Admin Phone: +1.8503086516
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: [email protected]
Registry Tech ID: Not Available From Registry
Tech Name: Sootmaster Team
Tech Organization: Sootmaster LLC
Tech Street: 5223 Black Road  
Tech City: Milton
Tech State/Province: FL
Tech Postal Code: 32583
Tech Country: US
Tech Phone: +1.8503086516
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: [email protected]
Name Server: ns1.mysecurecloudhost.com
Name Server: ns2.mysecurecloudhost.com
Name Server: ns3.mysecurecloudhost.com
Name Server: ns4.mysecurecloudhost.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
&gt;&gt;&gt; Last update of WHOIS database: 2026-08-26T06:07:43Z &lt;&lt;&lt;

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: FASTCOMET

The data in this whois database is provided to you for information purposes 
only, that is, to assist you in obtaining information about or related to a 
domain name registration record. We make this information available &quot;as is&quot;,
and do not guarantee its accuracy. By submitting a whois query, you agree 
that you will use this data only for lawful purposes and that, under no 
circumstances will you use this data to: 
(1) enable high volume, automated, electronic processes that stress or load 
this whois database system providing you this information; or 
(2) allow, enable, or otherwise support the transmission of mass unsolicited, 
commercial advertising or solicitations via direct mail, electronic mail, or 
by telephone. 
The compilation, repackaging, dissemination or other use of this data is 
expressly prohibited without prior written consent from us. The Registrar of 
record is PDR Ltd. d/b/a PublicDomainRegistry.com. 
We reserve the right to modify these terms at any time. 
By submitting this query, you agree to abide by these terms.</raw_whois>
</root>

Whois API Demo

Whois Lookup API

You can fetch the above results using our Whois Lookup API.

https://api.whoxy.com/?key=xxxxx&whois=chimineycricketchimneysweep.net

Whois API digs into WHOIS registry referral chains until the correct WHOIS servers are found, for the most complete WHOIS data.
Our WHOIS parser converts WHOIS data into well-structured fields (XML & JSON), which can easily be read by your application.
Whois API supports a total of 2026 Domain Extensions (gTLDs, ccTLDs & new gTLDs), ensuring all domains are supported.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Whois Lookup Pricing Total API Calls Price CPM Purchase
1,000 Whois Lookup API Queries 1,000 $2 $2.00 Order Now
10,000 Whois Lookup API Queries 10,000 $20 $2.00 Order Now
50,000 Whois Lookup API Queries 50,000 $75 $1.50 Order Now
250,000 Whois Lookup API Queries 250,000 $300 $1.20 Order Now
1 Million Whois Lookup API Queries 1,000,000 $1,000 $1.00 Order Now
10 Million Whois Lookup API Queries 10,000,000 $5,000 $0.50 Order Now
25 Million Whois Lookup API Queries 25,000,000 $10,000 $0.40 Order Now

Who owned chimineycricketchimneysweep.net in the past? (4 records)

18 FEB 2016

Name: Oneandone Private Registration (2.55 million domains)
Company: 1&1 Internet Inc. - www.1and1.com (205,983 domains)
Email: [email protected]
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns-us.1and1-dns.com, ns-us.1and1-dns.de, ns-us.1and1-dns.org, ns-us.1and1-dns.us
Status: clientTransferProhibited

26 AUG 2017

Name: Oneandone Private Registration (2.55 million domains)
Company: 1&1 Internet Inc (8.5 million domains)  UPDATED
Email: [email protected] (2.28 million domains)  UPDATED
Country: United States (231 million domains from United States for $6,250)
Nameservers: us.1and1  UPDATED
Status: autoRenewPeriod, clientTransferProhibited  UPDATED

26 DEC 2024

Name: Sootmaster Team (112 domains)  UPDATED
Company: Sootmaster LLC (51 domains)  UPDATED
Email: [email protected] (120 domains)  UPDATED
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns1023.ui-dns.biz, ns1069.ui-dns.org, ns1079.ui-dns.com, ns1124.ui-dns.de  UPDATED
Status: clientTransferProhibited  UPDATED

26 AUG 2026

Name: Sootmaster Team (112 domains)
Company: REDACTED FOR PRIVACY (591 million domains)  UPDATED
Email: [email protected] (120 domains)
Country: United States (231 million domains from United States for $6,250)
Nameservers: ns1.mysecurecloudhost.com, ns2.mysecurecloudhost.com, ns3.mysecurecloudhost.com, ns4.mysecurecloudhost.com  UPDATED
Status: clientTransferProhibited

Whois History API returns all the historical WHOIS records of a domain name. For more details, please visit https://www.whoxy.com/whois-history/