Whois API – WHOIS Lookup API for Domain Names
WHOIS API is a hosted web service that returns well-parsed WHOIS fields to your application in popular XML & JSON formats per HTTP request. Leave all the hard work to us, as you need not worry about the query limit and restrictions imposed by various domain registrars. Signup for a free account and start accessing the WHOIS API today.
Lowest Price Guarantee | Whoxy | DomainTools | Hexillion | WhoisXmlApi | JsonWhois |
---|---|---|---|---|---|
1,000 Domain WHOIS API Queries | $2 | $30 | $20 | $15 | $6 |
10,000 Domain WHOIS API Queries | $20 | $250 | $90 | $80 | $67 |
50,000 Domain WHOIS API Queries | $75 | $1,100 | $350 | $300 | $262 |
250,000 Domain WHOIS API Queries | $300 | $3,500 | $1,500 | $1,200 | $647 |
1 Million Domain WHOIS API Queries | $1000 | $10,000 | $2,000 | $1,800 | $1,297 |
whoxy.com | domaintools.com | hexillion.com | whoisxmlapi.com | jsonwhois.io |
Domain WHOIS Lookup
Simply enter a domain name below to check it's current WHOIS data and ownership information.
Domain Name | Registrar | Created | Updated | Expiry |
---|---|---|---|---|
plateformevoyance.com | Arsys Internet, S.L. dba NICLINE.COM | 19 Jan 2010 | 12 Sep 2023 | 19 Jan 2025 |
redlineresources.com | GoDaddy.com, LLC | 19 Sep 2012 | 20 Sep 2023 | 19 Sep 2024 |
philadelphiacriminaldefenselawyer.com | Epik Inc. | 18 Mar 2005 | 18 Apr 2024 | 18 Mar 2024 |
environmentgeoai.com | GoDaddy.com, LLC | 30 Dec 2023 | 30 Dec 2023 | 30 Dec 2024 |
environmentalgeoai.com | GoDaddy.com, LLC | 30 Dec 2023 | 30 Dec 2023 | 30 Dec 2024 |
WHOIS Lookup API
You can fetch WHOIS record of any domain name through:
https://api.whoxy.com/?key=xxxxx&whois=example.com
WHOIS API digs into WHOIS registry referral chains until the correct WHOIS servers are found, for the most complete WHOIS data.
Our WHOIS parser converts WHOIS data into well-structured fields (XML & JSON), which can easily be read by your application.
WHOIS API supports a total of 2026 Domain Extensions (gTLDs, ccTLDs & new gTLDs), ensuring all domains are supported.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
Retrieving Data in XML Format
Simple add "&format=xml" to any of your API calls and get results in XML Format.
https://api.whoxy.com/?key=xxxxx&whois=example.com&format=xml
Kindly use XML format only if your application strictly requires XML data. Compared to lightweight JSON format, XML carries a lot of extra baggage. This results in slower data transmission, and affects the overall performance of your application interacting with our API. We highly recommend you use JSON format whenever possible.
Account Balance Check
Check your account's API query balance:
https://api.whoxy.com/?key=xxxxx&account=balance
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
API Status Codes
Every API call will return a Status of either: 0 (ERROR) or 1 (SUCCESS)
In case of Status 0, the reason behind the failure of the API call will also be returned.
Sample Output: Invalid API Key (JSON) • Invalid API Key (XML)
Pricing & Packages
WHOIS Lookup | Total API Calls | Price | CPM | Purchase |
---|---|---|---|---|
1,000 WHOIS Lookup API Queries | 1,000 | $2 | $2.00 | Order Now |
10,000 WHOIS Lookup API Queries | 10,000 | $20 | $2.00 | Order Now |
50,000 WHOIS Lookup API Queries | 50,000 | $75 | $1.50 | Order Now |
250,000 WHOIS Lookup API Queries | 250,000 | $300 | $1.20 | Order Now |
1 Million WHOIS Lookup API Queries | 1,000,000 | $1,000 | $1.00 | Order Now |
10 Million WHOIS Lookup API Queries | 10,000,000 | $5,000 | $0.50 | Order Now |
25 Million WHOIS Lookup API Queries | 25,000,000 | $10,000 | $0.40 | Order Now |
Frequently Asked Questions
- API Key is available through: Account Manager » API Settings
- Yes, you are free to call the WHOIS API from any HTTP / HTTPS website, APP, or through your software.
- Please check the complete list of TLDs (gTLD & ccTLD) supported by our WHOIS API.
- No! Every time you make an API call, we fetch live data from the respective whois servers.
- Yes, you are charged a single API credit even when the domain's WHOIS record is empty. This normally happens when you try to fetch the WHOIS record of a domain name which is not yet registered. However you won't be charged any API credits if our system is not able to connect to the WHOIS server or when there are some errors in the WHOIS data received. In this case, you will receive an error message "Whois Server Connection Failed" or "Invalid Whois Data Received" respectively.
- Yes! Raw WHOIS text will be included along with the parsed WHOIS fields.
- Yes, this can be activated through: Account Manager » Account Settings
If you have any questions, please contact us at