Our database now contains whois records of 650 Million (650,912,563) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1594 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [650 Million Domains] $10,000 Details

Keyword: JEFFREYE

Reverse Whois » KEYWORD [jeffreye ]  { 577 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1jeffreye.comDropCatch.com 1509 LLC23 Feb 202312 Aug 202423 Feb 2026
2jeffreye.clubDNSPod, Inc.25 Oct 202225 Oct 202225 Oct 2023
3jeffreye.buzzNamesilo, LLC12 Jan 202217 Jan 202212 Jan 2023
4jeffreye.usCommuniGal Communication Ltd.6 Jul 20226 May 20236 Jul 2023
5jeffreyeller.comGoDaddy.com, LLC28 May 200828 May 201528 May 2016
6jeffreyearnhardt.infoGoDaddy.com, LLC29 May 201429 May 201529 May 2016
7jeffreyellis.comeNom, Inc.20 Oct 201014 Oct 202520 Oct 2026
8jeffreyelkin.comCloudFlare, Inc.22 May 200622 Apr 202522 May 2026
9jeffreyeastmusic.comGoDaddy.com, LLC5 Jul 20166 Jul 20255 Jul 2026
10jeffreyepstein.orgNameCheap, Inc.16 Jun 201631 Jul 202516 Jun 2026
11jeffreyepsteinfoundation.comRegister.it SPA4 Aug 20254 Aug 20254 Aug 2026
12jeffreyeisenbergmd.comGoDaddy.com, LLC4 Nov 20145 Nov 20164 Nov 2017
13jeffreyeastman.comregister.com, Inc.16 Apr 202516 Apr 202516 Apr 2026
14jeffreyerxleben.comNetwork Solutions, LLC19 Feb 201820 Feb 201819 Feb 2019
15jeffreyengelson.comGoDaddy.com, LLC30 Aug 201431 Aug 202530 Aug 2026
16jeffreyelvis.comGoDaddy.com, LLC26 Oct 201627 Oct 202426 Oct 2026
17jeffreyestrella.comTucows Domains Inc.10 Oct 201414 Oct 201710 Oct 2017
18jeffreyelectric.comTucows Domains Inc.8 Oct 200812 Oct 20148 Oct 2015
19jeffreyeversmann.comGoDaddy.com, LLC28 Nov 201429 Nov 201628 Nov 2017
20jeffreyeverettstudio.comNetwork Solutions, LLC1 Dec 20142 Oct 20251 Dec 2026
21jeffreyevanier.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…24 Jul 202331 Aug 202424 Jul 2024
22jeffreyelarsonlaw.comTucows Domains Inc.10 Aug 201114 Aug 201510 Aug 2016
23jeffreyeturner.orgGoDaddy.com, LLC27 Jun 201427 Jun 202527 Jun 2026
24jeffreyentertainment.comTucows Domains Inc.17 Jan 201521 Jan 201617 Jan 2017
25jeffreyeast.usGoDaddy.com, LLC5 Mar 20155 Mar 20154 Mar 2016
26jeffreyepsteininternational.comGoDaddy.com, LLC3 Mar 20237 Mar 20253 Mar 2026
27jeffreyepsteinnewyork.comNameCheap, Inc.24 Dec 202324 Nov 202424 Dec 2025
28jeffreyepsteineducation.comGoDaddy.com, LLC3 Mar 20237 Mar 20253 Mar 2026
29jeffreyepsteinscience.comNameCheap, Inc.9 Nov 202010 Oct 20259 Nov 2026
30jeffreyearthworx.comregister.com, Inc.6 Apr 20156 Apr 20156 Apr 2016
31jeffreyenethwedding.comTucows Domains Inc.3 Apr 20147 Apr 20153 Apr 2016
32jeffreyedwinmartin.comAscio Technologies, Inc. Danmark - Filial af Ascio…18 Apr 201518 Apr 201518 Apr 2016
33jeffreyequalitybrooks.comTucows Domains Inc.10 Sep 201526 Aug 202510 Sep 2026
34jeffreyengelstad.comGoDaddy.com, LLC29 May 201530 May 202429 May 2026
35jeffreyekaiser.comNetwork Solutions, LLC6 Jun 20154 Jun 20176 Jun 2018
36jeffreyeisner.comGoDaddy.com, LLC18 Sep 201519 Sep 202518 Sep 2026
37jeffreyenglish.comAmazon Registrar, Inc.9 Aug 202324 Jul 20259 Aug 2025
38jeffreyetess.comGoDaddy.com, LLC15 Nov 20161 Nov 202215 Nov 2029
39jeffreyetess.netWild West Domains, LLC30 Nov 201630 Nov 201630 Nov 2017
40jeffreyefoster.comregister.com, Inc.6 Oct 20157 Oct 20256 Oct 2026
41jeffreyethriedge.comGoDaddy.com, LLC23 Oct 201523 Oct 201523 Oct 2016
42jeffreyerp.comGoDaddy.com, LLC5 Nov 20156 Nov 20235 Nov 2025
43jeffreyevansdesign.com1&1 Internet AG26 Jun 202327 Jun 202526 Jun 2026
44jeffreyengel.infoNetwork Solutions, LLC6 Nov 20156 Nov 20156 Nov 2016
45jeffreyevansdesign.netFastDomain Inc.12 Nov 201512 Nov 201512 Nov 2016
46jeffreyenglish.spaceTucows Domains Inc.27 Nov 201516 Dec 201627 Nov 2017
47jeffreyepoyreyes.comeNom, Inc.26 Nov 201526 Nov 201526 Nov 2016
48jeffreyevansauctions.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Dec 20151 Dec 20151 Dec 2016
49jeffreyedwardslive.comGoDaddy.com, LLC10 Dec 201521 Feb 202510 Dec 2024
50jeffreyelewis.comGoDaddy.com, LLC11 Dec 201511 Dec 201511 Dec 2017
51jeffreyentercrawley.xyzNameCheap, Inc.15 Dec 201515 Dec 201515 Dec 2016
52jeffreyelder.comGoogle, Inc.7 Mar 201720 Feb 20257 Mar 2026
53jeffreyepstein.mobiNameCheap, Inc.24 Dec 202324 Nov 2024-
54jeffreyedwardsshow.comGoDaddy.com, LLC23 Dec 201523 Dec 202323 Dec 2027
55jeffreyedwardsmith.comGoDaddy.com, LLC30 Dec 201525 Dec 202430 Dec 2025
56jeffreyelkins.comCNOBIN INFORMATION TECHNOLOGY LIMITED7 Dec 20217 Dec 20217 Dec 2022
57jeffreyemrich.comDropCatch.com 1423 LLC30 Mar 201830 Mar 201830 Mar 2019
58jeffreyeichert.comCloudFlare, Inc.28 Mar 202026 Feb 202528 Mar 2026
59jeffreyemanuel.comGoDaddy.com, LLC29 May 202430 May 202529 May 2026
60jeffreyevansmortgage.comGoDaddy.com, LLC21 Jan 201622 Jan 202521 Jan 2026
61jeffreyenterpriseservices.comGoDaddy.com, LLC11 Feb 201611 Feb 201611 Feb 2017
62jeffreyelmore.comGoDaddy.com, LLC11 Feb 201626 Mar 202511 Feb 2026
63jeffreyeisenphotography.comGoDaddy.com, LLC12 Feb 201616 Mar 202515 Mar 2028
64jeffreyeng.comTucows Domains Inc.10 Feb 200314 Jan 202510 Feb 2026
65jeffreyemerick.comGoDaddy.com, LLC18 Feb 201618 Feb 201618 Feb 2017
66jeffreyebelth.comGoDaddy.com, LLC25 Feb 201626 Feb 202525 Feb 2026
67jeffreyeharding.comWild West Domains, LLC18 Mar 201618 Mar 201618 Mar 2019
68jeffreyedwards.infoNetwork Solutions, LLC11 Apr 201611 Apr 201611 Apr 2017
69jeffreyeckhaus.com-10 Oct 202210 Oct 202310 Oct 2024
70jeffreyeakin.comName.com, Inc.22 Jun 20215 Aug 202422 Jun 2024
71jeffreyepstein.netTurnCommerce, Inc. DBA NameBright.com26 May 201620 May 202126 May 2026
72jeffreyeporter.comTucows Domains Inc.28 May 201613 May 202528 May 2026
73jeffreyehrlich.comDropCatch.com 864 LLC10 Nov 20229 Dec 202410 Nov 2025
74jeffreyedwards.xyzTLD Registrar Solutions Ltd.2 Jun 201613 Jul 20162 Jun 2017
75jeffreyerbe.comTucows Domains Inc.13 Jun 201629 May 202513 Jun 2026
76jeffreyearnhardtincorporated.comGoDaddy.com, LLC11 May 201023 Jul 202511 May 2025
77jeffreyevanstucker.comGoDaddy.com, LLC18 Aug 201229 Apr 201518 Aug 2016
78jeffreyefulmer.com1&1 Internet AG20 Jun 201621 May 202520 Jun 2026
79jeffreyeugenides.comNameCheap, Inc.2 Jun 202214 Jul 20252 Jun 2025
80jeffreyeisenberg.comGoogle, Inc.8 Sep 200925 Aug 20258 Sep 2026
81jeffreyerb.comTucows Domains Inc.9 May 200910 Apr 20259 May 2026
82jeffreyearnhardt.comGoDaddy.com, LLC21 Jun 200522 Jun 202521 Jun 2026
83jeffreyechristian.comDropCatch.com 669 LLC2 Jul 20163 Jul 20172 Jul 2018
84jeffreyewing.comDomain Stopover LLC24 Sep 201924 Sep 201924 Sep 2020
85jeffreyelymusic.com1&1 Internet AG26 Sep 201826 Sep 201826 Sep 2019
86jeffreyelahor.comGoDaddy.com, LLC12 Jul 201612 Jul 201612 Jul 2018
87jeffreyeade.photographyMesh Digital Limited20 Feb 201418 Feb 201720 Feb 2018
88jeffreyevans.bizGoDaddy.com, LLC18 Mar 201323 Oct 202517 Mar 2026
89jeffreyellinger.com-20 Jul 201620 Jul 201620 Jul 2017
90jeffreyeckart.comTucows Domains Inc.25 Jul 201610 Jul 202525 Jul 2026
91jeffreyematthews.comTucows Domains Inc.28 Jul 20161 Aug 201828 Jul 2018
92jeffreyekarachman.comWeb Commerce Communications Limited dba WebNic.cc6 Nov 201916 Jan 20256 Nov 2024
93jeffreyeldredge.comGoogle, Inc.16 Aug 20161 Aug 202516 Aug 2026
94jeffreyenmiriamgaantrouwen.comTucows Domains Inc.17 Aug 201621 Aug 201717 Aug 2017
95jeffreyeverhart.comFastDomain Inc.18 Apr 201215 Apr 202518 Apr 2026
96jeffreyesampson.comGoDaddy.com, LLC26 Oct 20116 Jan 202526 Oct 2024
97jeffreyehirsch.comGoDaddy.com, LLC3 Dec 20123 Dec 20243 Dec 2025
98jeffreyerwindentist.comregister.com, Inc.5 Mar 20146 Mar 20255 Mar 2026
99jeffreyeagle.comGoDaddy.com, LLC22 Nov 200015 Nov 202422 Nov 2025
100jeffreyevitts.comNetwork Solutions, LLC13 Jan 200913 Nov 202413 Jan 2030
101jeffreyeholt.comGoDaddy.com, LLC25 Jun 201326 Jun 202525 Jun 2026
102jeffreyepsteinblog.com-2 Oct 202426 Sep 20252 Oct 2026
103jeffreyenterprises.comGoDaddy.com, LLC28 Feb 20065 Sep 202328 Feb 2026
104jeffreyernst.comeNom, Inc.24 Sep 200927 Sep 201724 Sep 2017
105jeffreyethomas.comDynadot, LLC8 Feb 20247 Feb 20258 Feb 2026
106jeffreyeasthope.comGoDaddy.com, LLC13 May 200813 May 202413 May 2026
107jeffreyevanslive.comGoDaddy.com, LLC28 Nov 20134 May 201528 Nov 2016
108jeffreyelshof.comKey-Systems GmbH26 Sep 201224 Sep 202426 Sep 2024
109jeffreyertl.comWild West Domains, LLC1 Feb 20081 Feb 20161 Feb 2017
110jeffreyengelmd.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Jan 201216 Feb 20185 Jan 2018
111jeffreyeaton.comDROPCATCH.COM 802 LLC30 Sep 202111 Dec 202330 Sep 2023
112jeffreyepstein.comGoDaddy.com, LLC16 May 200026 Sep 202416 May 2026
113jeffreyellison.comGoDaddy.com, LLC4 Aug 20095 Aug 20254 Aug 2026
114jeffreyevangold.comNetwork Solutions, LLC21 Oct 201117 Jul 202121 Oct 2026
115jeffreyedward.comGoDaddy.com, LLC1 Jan 200628 Feb 20251 Jan 2026
116jeffreyeducator.comGoDaddy.com, LLC2 Oct 20112 Oct 20152 Oct 2016
117jeffreyeblumrj.comMarkMonitor Inc.17 Aug 200917 Jul 202517 Aug 2026
118jeffreyericsiegel.comNetwork Solutions, LLC1 Oct 201329 Sep 20151 Oct 2016
119jeffreyethanberger.comNameSecure L.L.C.24 May 200624 Apr 202524 May 2026
120jeffreyengels.comTucows Domains Inc.14 Nov 200616 Oct 202514 Nov 2026
121jeffreyeberger.comNameSecure L.L.C.24 May 200624 Apr 202524 May 2026
122jeffreyevans.comGoDaddy.com, LLC20 Aug 200127 Aug 202420 Aug 2026
123jeffreyellislaw.comregister.com, Inc.7 Apr 200611 Oct 20167 Apr 2018
124jeffreyelliscarl.comGoDaddy.com, LLC12 Jan 201017 Oct 202413 Nov 2027
125jeffreyecatrambone.comDeluxe Small Business Sales, Inc. d/b/a Aplus.net30 Jul 200430 Jul 202530 Jul 2026
126jeffreyethell.comGoDaddy.com, LLC5 Oct 20205 Oct 20205 Oct 2021
127jeffreyeason.comNetwork Solutions, LLC26 Sep 201028 Sep 201726 Sep 2017
128jeffreyericjenkins.comGoDaddy.com, LLC12 Jan 201113 Jan 202512 Jan 2026
129jeffreyemiller.comGoDaddy.com, LLC6 Jun 20207 Jun 20236 Jun 2026
130jeffreyehimlerdds.comregister.com, Inc.1 Nov 201211 Jan 20161 Nov 2016
131jeffreyellington.comGoDaddy.com, LLC20 Mar 201116 Mar 201520 Mar 2017
132jeffreyeldridge.comGoDaddy.com, LLC14 Jun 200115 Jun 202514 Jun 2026
133jeffreyetaylor.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Sep 201312 Sep 202411 Sep 2025
134jeffreyebrownrealty.comBeijing Lanhai Jiye Technology Co., Ltd25 Oct 202326 Oct 202525 Oct 2026
135jeffreyeverett.comNameCheap, Inc.7 Jul 20037 Jun 20257 Jul 2026
136jeffreyebabine.comGMO Internet Inc.19 Dec 20134 Dec 201619 Dec 2017
137jeffreyeberle.comGoDaddy.com, LLC17 Jan 201118 Jan 201617 Jan 2017
138jeffreyeckman.comNameCheap, Inc.19 Apr 200220 Mar 202519 Apr 2026
139jeffreyestes.comregister.com, Inc.29 Sep 200330 Aug 202529 Sep 2028
140jeffreyearl.comGoDaddy.com, LLC24 Apr 20034 Sep 202224 Apr 2027
141jeffreyentel.com1&1 Internet AG17 Aug 201213 Mar 201817 Aug 2026
142jeffreyevers.com1&1 Internet AG4 Aug 20065 Aug 20254 Aug 2026
143jeffreyengineering.comTurnCommerce, Inc. DBA NameBright.com13 Feb 202226 Apr 202413 Feb 2024
144jeffreyeasterling.comNamesilo, LLC10 Aug 20118 Oct 202510 Aug 2026
145jeffreyelevator.comTierraNet Inc. d/b/a DomainDiscover8 Jun 200516 Apr 20248 Jun 2026
146jeffreyengbergtranslations.comRealtime Register B.V.4 Mar 20115 Feb 20254 Mar 2026
147jeffreyebrown.comeNom, Inc.11 Jul 201316 Jun 202311 Jul 2026
148jeffreyestern.comeNom, Inc.20 Dec 20098 Jan 202420 Dec 2026
149jeffreyengle.comWild West Domains, LLC26 Mar 200731 Mar 202426 Mar 2025
150jeffreyejenkins.comGoDaddy.com, LLC12 Jan 201113 Jan 202512 Jan 2026
151jeffreyeckstein.comGoDaddy.com, LLC1 Oct 20108 Sep 20221 Oct 2026
152jeffreyesakson.comGoDaddy.com, LLC9 Mar 201428 Feb 20159 Mar 2018
153jeffreyedwardsillustration.comGoDaddy.com, LLC9 May 201310 May 20259 May 2027
154jeffreyenterprise.comGoDaddy.com, LLC26 May 201427 May 201626 May 2018
155jeffreyemile.comNameCheap, Inc.8 Jul 20148 Jun 20258 Jul 2026
156jeffreyemmette.comGoDaddy.com, LLC4 Sep 20215 Sep 20254 Sep 2027
157jeffreyeyster.comDomain.com, LLC4 Jul 200624 Jun 20254 Jul 2026
158jeffreyemily.comGoDaddy.com, LLC29 Jun 20091 Jun 202529 Jun 2028
159jeffreyelliot.comMoniker Online Services LLC2 Oct 20182 Oct 20182 Oct 2019
160jeffreyengler.comGoDaddy.com, LLC12 Sep 200713 Sep 202412 Sep 2029
161jeffreyesser.comregister.com, Inc.22 Jun 200023 May 202522 Jun 2026
162jeffreyeast.comGoDaddy.com, LLC3 Jul 20134 Jul 20253 Jul 2026
163jeffreyejohnsonlaw.comTucows Domains Inc.31 Dec 20084 Jan 201731 Dec 2016
164jeffreyelliott.comWebnames.ca Inc.15 Jan 200318 Oct 202515 Jan 2027
165jeffreyegercatalogs.comFastDomain Inc.17 Feb 20121 Feb 202517 Feb 2026
166jeffreyedwards.comDot Holding Inc.14 Oct 200621 Aug 202414 Oct 2026
167jeffreyengel.comGold Domain Names LLC24 Mar 202128 Apr 202524 Mar 2026
168jeffreyegan.comTucows Domains Inc.7 Aug 20076 Aug 20257 Aug 2026
169jeffreyeverage.comGoDaddy.com, LLC19 Nov 20108 Sep 202219 Nov 2026
170jeffreyeinhorn.comGoDaddy.com, LLC22 Dec 200917 Dec 202322 Dec 2026
171jeffreyelofson.comDNC Holdings, Inc.23 Nov 20074 Feb 202523 Nov 2024
172jeffreyelevine.comWild West Domains, LLC10 Sep 201111 Aug 202510 Sep 2026
173jeffreyevenmo.comNameCheap, Inc.10 Mar 200721 Apr 202410 Mar 2030
174jeffreyeric.comNameCheap, Inc.21 Jul 201221 Jun 202521 Jul 2026
175jeffreyepsteinusvi.comGoDaddy.com, LLC3 Mar 20237 Mar 20253 Mar 2026
176jeffreyer.comGoDaddy.com, LLC11 May 200012 May 202411 May 2029
177jeffreyerrico.comGoDaddy.com, LLC12 May 201423 Jul 202412 May 2024
178jeffreyearle.comeNom, Inc.16 Jul 20081 Jul 202416 Jul 2026
179jeffreyearly.comGoDaddy.com, LLC28 Feb 20061 Mar 202528 Feb 2026
180jeffreyesofficial.comeNom, Inc.8 Jul 20143 Aug 20168 Jul 2017
181jeffreyevansbooks.comNameCheap, Inc.3 Oct 20113 Sep 20253 Oct 2026
182jeffreyescoffier.comGoDaddy.com, LLC21 Oct 200722 Oct 201521 Oct 2016
183jeffreyeugeneblackman.com1&1 Internet AG25 Dec 200526 Dec 201625 Dec 2017
184jeffreyeisen.comGoDaddy.com, LLC15 Mar 20073 May 202515 Mar 2027
185jeffreyemersongaiser.comregister.com, Inc.26 Jul 201225 Jun 202526 Jul 2026
186jeffreyengcpa.comregister.com, Inc.25 Oct 201325 Oct 201325 Oct 2018
187jeffreyeschbach.com1&1 Internet AG18 Mar 201119 Mar 201718 Mar 2026
188jeffreyelbert.comGoDaddy.com, LLC24 Oct 201017 Oct 201524 Oct 2016
189jeffreyeagan.comGoDaddy.com, LLC16 Jan 201217 Jan 202416 Jan 2026
190jeffreyerwin.comWild West Domains, LLC6 May 20216 May 20216 May 2022
191jeffreyelmont.comNamesilo, LLC6 Sep 20197 Sep 20196 Sep 2020
192jeffreyericson.comGoDaddy.com, LLC29 Sep 200528 Sep 201529 Sep 2016
193jeffreyeggleston.comWild West Domains, LLC6 Aug 201010 Jun 20166 Aug 2017
194jeffreyechols.comGoDaddy.com, LLC29 Apr 201430 Apr 201629 Apr 2018
195jeffreyepaul.comTierraNet Inc. d/b/a DomainDiscover12 Mar 200012 Feb 202412 Mar 2026
196jeffreyesker.comCSC Corporate Domains, Inc.10 May 20126 May 202510 May 2026
197jeffreyerber.comGoDaddy.com, LLC2 Dec 201024 Sep 20152 Dec 2017
198jeffreyeckhardt.comDomainPeople, Inc.22 Nov 201124 Oct 201722 Nov 2017
199jeffreyedmiston.comGoDaddy.com, LLC8 Apr 201110 Apr 20148 Apr 2017
200jeffreyedwardsllc.com-6 Dec 20249 Dec 20246 Dec 2025
201jeffreyemclean.comGoDaddy.com, LLC14 Dec 201315 Dec 201414 Dec 2016
202jeffreyerbig.comregister.com, Inc.28 Oct 201315 Oct 202528 Oct 2027
203jeffreyerickson.comGoDaddy.com, LLC21 May 20213 Jun 202521 May 2026
204jeffreyelectrical.comGoDaddy.com, LLC4 Dec 20124 Dec 20244 Dec 2025
205jeffreyedelson.comGoDaddy.com, LLC11 May 200512 May 202511 May 2026
206jeffreyearlstone.comPSI-USA, Inc. dba Domain Robot16 May 20145 Jul 201716 May 2018
207jeffreyeger.comTucows Domains Inc.8 Jan 200224 Dec 20248 Jan 2026
208jeffreyello.comPorkbun, LLC21 Feb 200819 Feb 202521 Feb 2026
209jeffreyevanbrooks.comFastDomain Inc.14 Nov 201229 Oct 201614 Nov 2017
210jeffreyevanscarpentry.comGoDaddy.com, LLC23 May 200619 Jun 201330 May 2018
211jeffreyesteslaw.comGoDaddy.com, LLC24 Mar 200825 Mar 202524 Mar 2027
212jeffreyepperson.comGoDaddy.com, LLC26 Aug 200927 Aug 202526 Aug 2026
213jeffreyellse.comDreamHost, LLC3 Mar 20075 Mar 20253 Mar 2026
214jeffreyehrenkrantz.comGoDaddy.com, LLC25 Feb 201125 Feb 202525 Feb 2026
215jeffreyes.comDynadot, LLC29 Feb 200431 Aug 202525 Dec 2026
216jeffreyeaster.comeNom, Inc.22 Aug 200724 Jul 201722 Aug 2018
217jeffreyengleesq.comTucows Domains Inc.11 May 201212 Apr 202511 May 2026
218jeffreyevergreen.comHostinger, UAB7 Oct 200921 Jul 20237 Oct 2026
219jeffreyestep.comWild West Domains, LLC1 Oct 20141 Oct 20251 Oct 2026
220jeffreyeaston.comTucows Domains Inc.11 Oct 201010 Oct 202511 Oct 2026
221jeffreyely.comGoDaddy.com, LLC5 Jul 20076 Jul 20165 Jul 2017
222jeffreyeschaefermasterbuilderinc.comGoDaddy.com, LLC20 May 201421 May 202420 May 2029
223jeffreyequineappraisal.comNetwork Solutions, LLC22 Feb 20095 Mar 201722 Feb 2019
224jeffreyelden.comGoDaddy.com, LLC3 Jan 20143 Jan 20143 Jan 2017
225jeffreyeggert.comGoDaddy.com, LLC1 May 20181 May 20251 May 2026
226jeffreyentin.comGoDaddy.com, LLC1 Dec 20112 Dec 20241 Dec 2025
227jeffreyemcgrath.com1&1 Internet AG20 Dec 200613 Mar 201820 Dec 2025
228jeffreyemeryphotography.comGoDaddy.com, LLC28 May 20141 Apr 201628 May 2017
229jeffreyejacobson.comGoDaddy.com, LLC17 Jun 201029 Apr 202417 Jun 2027
230jeffreyearnhardtracing.comGoDaddy.com, LLC11 May 201023 Jul 202511 May 2025
231jeffreyeppinger.comGoDaddy.com, LLC19 Mar 200720 Mar 202519 Mar 2026
232jeffreyephillips.comGoDaddy.com, LLC22 Jun 201422 Jun 202522 Jun 2026
233jeffreyeturner.comGoDaddy.com, LLC2 Oct 200720 Sep 20152 Oct 2017
234jeffreyenvironmental.comGoDaddy.com, LLC30 Jan 20098 Dec 20247 Dec 2025
235jeffreyeblum.comMarkMonitor Inc.13 Oct 201111 Sep 202513 Oct 2026
236jeffreyeroberts.comGoDaddy.com, LLC6 Feb 202318 Mar 20246 Feb 2024
237jeffreyeelliott.comFastDomain Inc.2 Jun 20123 Jun 20162 Jun 2018
238jeffreyelrick.comTierraNet Inc. d/b/a DomainDiscover21 Sep 20137 Sep 202521 Sep 2026
239jeffreyemmerling.comGoDaddy.com, LLC4 Jun 201216 Jul 20254 Jun 2025
240jeffreyelimiller.comDROPCATCH.COM 795 LLC12 Sep 201613 Sep 201712 Sep 2018
241jeffreyeberwein.com-12 Sep 201612 Sep 201612 Sep 2017
242jeffreyevandavis.comGoDaddy.com, LLC3 Oct 20164 Oct 20253 Oct 2027
243jeffreyengel.spaceNetwork Solutions, LLC4 Oct 201616 Nov 20174 Oct 2017
244jeffreyerler.comNetwork Solutions, LLC9 Oct 201619 Oct 20179 Oct 2018
245jeffreyefirth.infoGoDaddy.com, LLC4 Mar 20144 May 20144 Mar 2017
246jeffreyelimiller.infoGoDaddy.com, LLC1 Jul 20142 Jul 20161 Jul 2017
247jeffreyegan.netKey-Systems GmbH16 Jun 20085 Aug 202516 Jun 2026
248jeffreyevangold.netNetwork Solutions, LLC21 Oct 201117 Jul 202121 Oct 2026
249jeffreyelliott.netGoDaddy.com, LLC8 Nov 20139 Nov 20248 Nov 2025
250jeffreyefirth.netGoDaddy.com, LLC4 Mar 20144 Mar 20144 Mar 2017
251jeffreyericjenkins.netGoDaddy.com, LLC12 Jan 201113 Jan 202512 Jan 2026
252jeffreyemcgrath.net1&1 Internet AG20 Dec 200629 Nov 201720 Dec 2025
253jeffreyellis.neteNom, Inc.20 Mar 201419 Feb 202520 Mar 2026
254jeffreyedwardtaylor.netGoDaddy.com, LLC21 Oct 201221 Oct 201521 Oct 2016
255jeffreyeric.netDomainPeople, Inc.21 Jul 201222 Jun 201721 Jul 2018
256jeffreyengel.netNetwork Solutions, LLC27 Feb 201219 Feb 202527 Feb 2028
257jeffreyephillips.netGoDaddy.com, LLC22 Jun 201422 Jun 202522 Jun 2026
258jeffreyedwards.netNetwork Solutions, LLC24 Sep 200426 Jul 201624 Sep 2017
259jeffreyevans.netGoDaddy.com, LLC17 Dec 200917 Dec 202417 Dec 2025
260jeffreyearnhardt.netGoDaddy.com, LLC18 Jul 200722 Jun 202522 Jun 2026
261jeffreyelkin.netCloudFlare, Inc.22 May 200622 Apr 202522 May 2026
262jeffreyelimiller.netGoDaddy.com, LLC1 Jul 20142 Jul 20161 Jul 2017
263jeffreyevitts.netNetwork Solutions, LLC13 Jan 200913 Nov 202413 Jan 2030
264jeffreyemoore.orgNetwork Solutions, LLC8 Nov 20136 Nov 20178 Nov 2018
265jeffreyeric.orgDomainPeople, Inc.21 Jul 20126 Jul 201721 Jul 2018
266jeffreyemiller.orgDNC Holdings, Inc.15 Mar 202520 Mar 202515 Mar 2030
267jeffreyefirth.orgGoDaddy.com, LLC4 Mar 20144 May 20144 Mar 2017
268jeffreyellis.orgDNC Holdings, Inc.28 Jul 200718 Jun 202528 Jul 2026
269jeffreyelimiller.orgGoDaddy.com, LLC1 Jul 20142 Jul 20161 Jul 2017
270jeffreyevans.orgTucows Domains Inc.15 Dec 20116 Dec 202415 Dec 2025
271jeffreyephillips.orgGoDaddy.com, LLC22 Jun 20146 Aug 202522 Jun 2026
272jeffreyes.xyzGoDaddy.com, LLC12 May 201626 Jul 201712 May 2018
273jeffreyeisenach.comGoogle, Inc.11 Nov 201611 Dec 201711 Nov 2017
274jeffreyen.winAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…11 Nov 201611 Nov 201610 Nov 2017
275jeffreyen.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…11 Nov 201612 Dec 201711 Nov 2017
276jeffreyebetancourt.com1&1 Internet AG25 Nov 201626 Nov 201625 Nov 2017
277jeffreyelefante.comAutomattic Inc.5 Dec 201615 Nov 20245 Dec 2025
278jeffreyembree.comGoDaddy.com, LLC17 Jan 201718 Jan 202317 Jan 2026
279jeffreyenglishmua.comTucows Domains Inc.19 Jan 201730 Apr 202519 Jan 2026
280jeffreyepstein.websiteNameCheap, Inc.23 Jan 201723 Jan 201723 Jan 2018
281jeffreyenriquez.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…6 Oct 202213 Nov 20236 Oct 2023
282jeffreyenriquez.netTucows Domains Inc.31 Jan 20174 Feb 202031 Jan 2020
283jeffreyenriquez.orgTucows Domains Inc.31 Jan 20172 Apr 201731 Jan 2018
284jeffreyebooth.comLaunchpad, Inc.17 Mar 201717 May 201717 Mar 2018
285jeffreyeschylle.comHostinger, UAB27 Mar 201726 May 201727 Mar 2018
286jeffreyestrada.comSquarespace Domains LLC18 Mar 20243 Mar 202518 Mar 2026
287jeffreyestiverne4real.comeNom, Inc.14 Sep 201626 Apr 201714 Sep 2017
288jeffreyegoldberg.comMesh Digital Limited1 May 20171 May 20171 May 2018
289jeffreyesl.comGoDaddy.com, LLC6 May 20176 May 20176 May 2018
290jeffreyearlwarren.comGoDaddy.com, LLC12 May 201713 May 202512 May 2027
291jeffreyewalker.comMesh Digital Limited17 May 201717 May 201717 May 2018
292jeffreyelite.comNameCheap, Inc.21 May 201721 May 201721 May 2018
293jeffreyelsonseo.designPorkbun, LLC31 May 201731 May 201731 May 2018
294jeffreyericsmith.comGoDaddy.com, LLC10 Jun 201710 Jun 201710 Jun 2018
295jeffreyefird.comGoDaddy.com, LLC15 Jun 201716 Jun 202515 Jun 2026
296jeffreyecheverry.comGoDaddy.com, LLC19 Jun 201720 Jun 202519 Jun 2026
297jeffreyeckman.netNetwork Solutions, LLC28 Jun 201720 Jan 201828 Jun 2018
298jeffreyellenbogen.comNameCheap, Inc.2 Jul 201725 Jun 20212 Jul 2026
299jeffreyelshoff.orgGoDaddy.com, LLC28 Jul 201711 Sep 202428 Jul 2026
300jeffreyelshoff.infoGoDaddy.com, LLC28 Jul 201728 Jul 201728 Jul 2019
301jeffreyespinoza.comWix.com Ltd.11 Jun 202012 May 202511 Jun 2026
302jeffreyegg.comLaunchpad, Inc.21 Sep 201722 Sep 201721 Sep 2018
303jeffreyegg.netLaunchpad, Inc.21 Sep 201722 Sep 201721 Sep 2018
304jeffreyegg.orgLaunchpad, Inc.21 Sep 201722 Sep 201721 Sep 2018
305jeffreyegg.infoLaunchpad, Inc.22 Sep 201722 Sep 201722 Sep 2018
306jeffreyegg.sitePDR Ltd. d/b/a PublicDomainRegistry.com21 Sep 201721 Sep 201721 Sep 2018
307jeffreyeryandco.comGoogle, Inc.4 Oct 201719 Sep 20254 Oct 2026
308jeffreyedgmonsantitrumpblog.comGoogle, Inc.13 Nov 201713 Nov 201713 Nov 2018
309jeffreyenglin.comGoogle, Inc.30 Nov 201715 Nov 202430 Nov 2025
310jeffreyengineering.co.uk-24 Nov 201122 Nov 201724 Nov 2019
311jeffreyengineering.uk-27 Jul 201727 Jul 201727 Jul 2019
312jeffreyequestrian.uk-16 Mar 201816 Mar 201816 Mar 2019
313jeffreyeugenerunning.comAutomattic Inc.20 Mar 201820 Mar 201820 Mar 2019
314jeffreyengel.onlineNetwork Solutions, LLC25 May 202227 May 202325 May 2024
315jeffreyessel.co.ukHello Internet Corp.13 Apr 201813 Apr 201813 Apr 2019
316jeffreyerbert.comDreamHost, LLC21 Apr 201821 Mar 202521 Apr 2026
317jeffreyemitchell.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Apr 201830 Apr 201830 Apr 2019
318jeffreyenos.faithNameCheap, Inc.8 May 20189 May 20188 May 2019
319jeffreyewing.netName.com, Inc.21 Jun 201821 Jun 201821 Jun 2019
320jeffreyeg.comNameCheap, Inc.9 Aug 20189 Aug 20189 Aug 2019
321jeffreyewers.comGandi SAS18 Aug 201819 Aug 202518 Aug 2027
322jeffreyewilliams.comeNom, Inc.23 Aug 201825 Jul 202523 Aug 2026
323jeffreyeugenetucker.comGoogle, Inc.1 Sep 20181 Sep 20181 Sep 2019
324jeffreyevansaz.comNetwork Solutions, LLC7 Sep 20187 Sep 20247 Sep 2034
325jeffreyedelman.comAmazon Registrar, Inc.29 Oct 201824 Sep 202529 Oct 2026
326jeffreyeelliottesq.comregister.com, Inc.19 Dec 201819 Dec 201819 Dec 2019
327jeffreyebudd.comTucows Domains Inc.29 Jan 201928 Jan 202529 Jan 2026
328jeffreyeberthomeremodeling.comLaunchpad, Inc.2 Feb 20192 Feb 20192 Feb 2020
329jeffreyeubanks.comDomain.com, LLC25 Feb 201925 Feb 201925 Feb 2021
330jeffreyepsteindershowitztrumpacosta.comGoDaddy.com, LLC26 Feb 201926 Feb 201926 Feb 2020
331jeffreyevan.comSquarespace Domains LLC27 Feb 201912 Feb 202527 Feb 2026
332jeffreyerlacher.comregister.com, Inc.4 Mar 201916 Apr 20254 Mar 2025
333jeffreyecopeland.comLaunchpad, Inc.11 Apr 201927 Mar 202511 Apr 2026
334jeffreyelderformayor.comWix.com Ltd.1 May 20191 May 20191 May 2020
335jeffreyehikioya.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…29 May 20238 Aug 202429 May 2024
336jeffreyel-hajj.comGoogle, Inc.10 Jun 201926 May 202510 Jun 2026
337jeffreyess.comOVH sas30 Jun 201930 Jun 201930 Jun 2020
338jeffreyess.netOVH sas30 Jun 201930 Jun 201930 Jun 2020
339jeffreyess.bizOVH sas30 Jun 201930 Jun 201930 Jun 2020
340jeffreyelkins72.comAscio Technologies, Inc. Danmark - Filial af Ascio…5 Jul 20195 Jul 20195 Jul 2020
341jeffreyepsteinsucks.comGoDaddy.com, LLC8 Jul 20198 Jul 20258 Jul 2026
342jeffreyepsteinscandal.comGoDaddy.com, LLC9 Jul 201910 Jul 20259 Jul 2026
343jeffreyepsteinsexscandal.comGoDaddy.com, LLC10 Jul 201911 Jul 202510 Jul 2026
344jeffreyepsteinlawsuit.comGoDaddy.com, LLC12 Jul 201912 Jul 201912 Jul 2020
345jeffreyepsteinvictims.comGoDaddy.com, LLC22 Jul 201922 Jul 201922 Jul 2020
346jeffreyepsteinnews.comGoDaddy.com, LLC24 Jul 20195 Oct 202424 Jul 2024
347jeffreyepsteinforum.comGoDaddy.com, LLC3 Mar 20237 Mar 20253 Mar 2026
348jeffreyestiverne.comGoDaddy.com, LLC7 Aug 201912 Aug 20257 Aug 2026
349jeffreyepsteincase.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
350jeffreyepsteindeath.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
351jeffreyepsteinsuicide.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
352jeffreyepsteinexposed.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
353jeffreyepsteinfounddead.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2021
354jeffreyepsteinssuicide.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
355jeffreyepsteindead.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
356jeffreyepsteindied.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
357jeffreyepsteinconspiracy.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
358jeffreyepsteincommittedsuicide.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
359jeffreyepsteinobituary.comNameCheap, Inc.10 Aug 2019-10 Aug 2020
360jeffreyepsteinthemovie.comHiChina Zhicheng Technology Limited11 Aug 201911 Aug 201911 Aug 2020
361jeffreyepsteinisdead.comTucows Domains Inc.10 Aug 20197 Aug 202510 Aug 2026
362jeffreyepsteinmovie.comGoogle, Inc.13 Aug 201912 Sep 202413 Aug 2024
363jeffreyepsteinblackbook.comGoDaddy.com, LLC15 Aug 201915 Aug 201915 Aug 2020
364jeffreyepsteinmurder.comGoDaddy.com, LLC17 Aug 201928 Sep 202417 Aug 2024
365jeffreyepsteinwasmurdered.comGoDaddy.com, LLC17 Aug 201917 Aug 201917 Aug 2020
366jeffreyettinger.comGoDaddy.com, LLC19 Aug 201929 Oct 202219 Aug 2029
367jeffreyepsteinclaims.comGoDaddy.com, LLC23 Aug 201923 Aug 201923 Aug 2020
368jeffreyengbooks.comTucows Domains Inc.17 Sep 20192 Sep 202517 Sep 2026
369jeffreyeolson.comGoogle, Inc.24 Sep 201924 Oct 202424 Sep 2024
370jeffreyeisenberglaw.comGoDaddy.com, LLC4 Oct 20194 Oct 20194 Oct 2021
371jeffreyeberger.bizGoDaddy.com, LLC3 Oct 201923 Oct 20253 Oct 2027
372jeffreyexcavating.comGoDaddy.com, LLC7 Oct 20197 Oct 20197 Oct 2020
373jeffreyewig.comWild West Domains, LLC19 Oct 201920 Oct 202519 Oct 2028
374jeffreyepsteindidntkillhimself.comNameCheap, Inc.30 Oct 201930 Sep 202530 Oct 2026
375jeffreyelectronics.comWild West Domains, LLC30 Oct 201930 Oct 201930 Oct 2020
376jeffreyepsteindidntkillhimself.fyiNameCheap, Inc.4 Nov 20194 Nov 20194 Nov 2020
377jeffreyepsteindidntcommitsuicide.comGoDaddy.com, LLC4 Nov 20194 Nov 20194 Nov 2020
378jeffreyepsteindidnotkillhimself.comFastDomain Inc.9 Nov 20199 Nov 20199 Nov 2020
379jeffreyepsteindidntkillhimself.netCrazy Domains FZ-LLC11 Jul 20229 Jul 202411 Jul 2026
380jeffreyepsteindidnthanghimself.comFastDomain Inc.18 Nov 201918 Nov 201918 Nov 2020
381jeffreyenglishdesign.comNameCheap, Inc.5 Dec 201925 Nov 20245 Dec 2025
382jeffreyepsteindidnothanghimself.comGoDaddy.com, LLC8 Dec 20198 Dec 20198 Dec 2020
383jeffreyelton.comGoDaddy.com, LLC16 Dec 201917 Dec 202416 Dec 2029
384jeffreyepsteinmobile.comGoDaddy.com, LLC7 Jan 20207 Jan 20207 Jan 2021
385jeffreyepsteinbook.comTucows Domains Inc.15 Jan 20201 Jan 202515 Jan 2026
386jeffreyenriquez.photographyTucows Domains Inc.31 Jan 20174 Feb 202031 Jan 2021
387jeffreyenglishnyc.comNameCheap, Inc.11 Feb 202027 Jan 202511 Feb 2026
388jeffreyepsteinpodcast.comGoDaddy.com, LLC14 Mar 202013 May 202514 Mar 2026
389jeffreyepsteindidntkillhimself.inforegister.com, Inc.13 Dec 201911 Feb 202013 Dec 2020
390jeffreyepstein.infoGoDaddy.com, LLC29 Jul 20253 Aug 202529 Jul 2026
391jeffreyepstein.sucksRebel.com Corp.18 Mar 20201 Jul 202018 Mar 2021
392jeffreyeastphotography.comeNom, Inc.29 May 202030 May 202529 May 2026
393jeffreyepsteinslittleblackbook.comKey-Systems GmbH1 Jun 20201 Jun 20201 Jun 2021
394jeffreyestrin.comGoDaddy.com, LLC2 Jun 20202 Jun 20202 Jun 2022
395jeffreyepsteingop.comGoDaddy.com, LLC12 Jul 202012 Jul 202012 Jul 2021
396jeffreyepsteinclaim.comGoDaddy.com, LLC14 Aug 202015 Aug 202314 Aug 2026
397jeffreyepsteinsettlements.comGoDaddy.com, LLC14 Aug 202015 Aug 202314 Aug 2026
398jeffreyepsteinsettlement.comGoDaddy.com, LLC14 Aug 202015 Aug 202314 Aug 2026
399jeffreyepstein.storeTucows Domains Inc.12 Aug 201916 Aug 202012 Aug 2021
400jeffreyepstein.onlineCrazy Domains FZ-LLC7 Jul 20222 Jul 20237 Jul 2023
401jeffreyenmerelzeggenja.comeNom, Inc.8 Sep 20208 Sep 20208 Sep 2021
402jeffreyepsteinismybestfriend.comGoDaddy.com, LLC16 Sep 202016 Sep 202016 Sep 2021
403jeffreyeff.comGoDaddy.com, LLC12 Oct 202012 Oct 202012 Oct 2021
404jeffreyechao.comNameCheap, Inc.14 Oct 202030 Sep 202514 Oct 2026
405jeffreyevansauction.comGoDaddy.com, LLC19 Oct 202019 Oct 202019 Oct 2021
406jeffreyekenbarger.comGoDaddy.com, LLC29 Oct 202029 Oct 202529 Oct 2026
407jeffreyepsteinlives.comGoDaddy.com, LLC22 Nov 202022 Nov 202022 Nov 2021
408jeffreyerinshea.comregister.com, Inc.29 Nov 202029 Nov 202429 Nov 2025
409jeffreyedwinhughes.comSquarespace Domains LLC6 Apr 20256 Apr 20256 Apr 2028
410jeffreyetzin.comGoDaddy.com, LLC9 Jan 202110 Jan 20259 Jan 2026
411jeffreyellwood.com1&1 Internet AG5 Feb 20215 Feb 20215 Feb 2026
412jeffreyelderforlegis.com1&1 Internet AG6 Mar 20216 Mar 20216 Mar 2022
413jeffreyexact.comNamesilo, LLC17 Apr 202121 May 202317 Apr 2023
414jeffreyeflooring.comGoDaddy.com, LLC26 Apr 202126 Apr 202126 Apr 2022
415jeffreyeaststuff.comTucows Domains Inc.12 May 202123 Jul 202312 May 2023
416jeffreyeugley.comGoogle, Inc.1 Jun 202117 May 20251 Jun 2026
417jeffreyehunt.comCosmotown, Inc.20 Jan 202321 Jan 202420 Jan 2025
418jeffreyedmunds.comGoogle, Inc.11 Jul 202126 Jun 202511 Jul 2026
419jeffreyeholland.storeBeget LLC21 Jul 202122 Jul 202121 Jul 2022
420jeffreyesqassociate.comGoDaddy.com, LLC23 Jul 202123 Jul 202123 Jul 2022
421jeffreyepsteinsfriends.comGoDaddy.com, LLC5 Aug 20218 Aug 20255 Aug 2026
422jeffreyepsteindidntkillhimselfcoin.comInternet Domain Services BS Corp10 Aug 202110 Aug 202110 Aug 2022
423jeffreyexcelmans.comRegister NV dba Register.eu24 Aug 202123 Aug 202524 Aug 2026
424jeffreyexpress.comOVH sas7 Sep 20218 Sep 20217 Sep 2022
425jeffreyedwardsdesign.comIn2net Network, Inc.9 Sep 20219 Sep 20219 Sep 2022
426jeffreyepstein.wtfNameCheap, Inc.15 Sep 202127 Oct 202315 Sep 2023
427jeffreyellenberger.comGoDaddy.com, LLC30 Apr 20181 May 202130 Apr 2022
428jeffreyemery.comGoDaddy.com, LLC6 Oct 202124 Apr 20246 Oct 2024
429jeffreyepsteinisntdead.loveGoDaddy.com, LLC9 Oct 20219 Oct 20219 Oct 2022
430jeffreyepsteinlinens.comGoDaddy.com, LLC15 Oct 202126 Nov 202415 Oct 2024
431jeffreyevansphotography.comGoDaddy.com, LLC18 Oct 202130 Dec 202418 Oct 2024
432jeffreyescuadrafreewebinar.comGoDaddy.com, LLC19 Oct 202119 Oct 202119 Oct 2022
433jeffreyeichen.comNameCheap, Inc.21 Nov 2021-21 Nov 2022
434jeffreyeanrhardt.comNameCheap, Inc.2 Dec 2021-2 Dec 2022
435jeffreyeholmes.comNameCheap, Inc.13 Dec 20212 Jan 202513 Dec 2025
436jeffreyepsteinfanclub.comGoDaddy.com, LLC4 Jan 202217 Mar 20244 Jan 2024
437jeffreyegoldbergprivacypolicy.comGoDaddy.com, LLC10 Jan 202210 Jan 202210 Jan 2023
438jeffreyesoteric.comNameCheap, Inc.12 Jan 202226 Dec 202412 Jan 2026
439jeffreyeverywhere.comGoogle, Inc.3 Mar 202216 Feb 20253 Mar 2026
440jeffreyelastic.comNamesilo, LLC20 Mar 202224 May 202320 Mar 2023
441jeffreyericksonracing.comGoDaddy.com, LLC21 Mar 202222 Mar 202521 Mar 2026
442jeffreyexptransport.comAmazon Registrar, Inc.4 May 202230 Mar 20254 May 2026
443jeffreyelderforlegis.usGoDaddy.com, LLC1 Nov 202213 Dec 20231 Nov 2023
444jeffreyeminer.xyzNameCheap, Inc.2 Jun 202227 Jun 20222 Jun 2024
445jeffreyexpositolaw.comGoDaddy.com, LLC2 Aug 201715 Jul 20252 Aug 2030
446jeffreyesun.comNameCheap, Inc.14 Jun 202215 May 202514 Jun 2026
447jeffreyepsteindidntkillhimself.onlineCrazy Domains FZ-LLC7 Jul 20227 Jul 20237 Jul 2024
448jeffreyepsteindidntkillhimself.orgCrazy Domains FZ-LLC7 Jul 202221 Aug 20247 Jul 2026
449jeffreyepstienblacklist.comEpik Inc.12 Jul 202223 Aug 202312 Jul 2023
450jeffreyepsteinsblacklist.comEpik Inc.12 Jul 202223 Aug 202312 Jul 2023
451jeffreyeckes.comGoDaddy.com, LLC26 Aug 202227 Aug 202426 Aug 2026
452jeffreyepstein.co.uk-15 Sep 202216 Sep 202515 Sep 2026
453jeffreyelsen.orgCloudFlare, Inc.7 Oct 202212 Sep 20257 Oct 2026
454jeffreyelsen.netCloudFlare, Inc.7 Oct 20227 Sep 20257 Oct 2026
455jeffreyelsen.comCloudFlare, Inc.7 Oct 20227 Sep 20257 Oct 2026
456jeffreyempire.comGoogle, Inc.19 Oct 202218 Dec 202419 Oct 2024
457jeffreyedleymemorial.comWix.com Ltd.16 Oct 202020 Oct 202216 Oct 2022
458jeffreyelliott.orgGoDaddy.com, LLC10 Dec 202224 Jan 202510 Dec 2025
459jeffreyebynum.icuNameCheap, Inc.1 Jan 202312 Feb 20241 Jan 2024
460jeffreyethompson.icuNameCheap, Inc.4 Jan 202316 Mar 20244 Jan 2024
461jeffreyedwardskd.beautyNameCheap, Inc.27 Jan 20239 Mar 202427 Jan 2024
462jeffreyellis.ca-5 Apr 20174 Apr 20255 Apr 2026
463jeffreyethel.comWix.com Ltd.30 Jan 202311 Mar 202430 Jan 2024
464jeffreyeigenbrode.comDreamHost, LLC1 Feb 20231 Jan 20251 Feb 2026
465jeffreyeutsey.comSquarespace Domains LLC2 Feb 202316 Apr 20252 Feb 2025
466jeffreyesslingermd.comGoDaddy.com, LLC17 Jul 201728 Sep 202317 Jul 2023
467jeffreyemerson.comGoDaddy.com, LLC9 Aug 201710 Aug 20249 Aug 2026
468jeffreyextracts.comGoDaddy.com, LLC16 Feb 202328 Apr 202416 Feb 2024
469jeffreyelshoff.comGoDaddy.com, LLC28 Jul 201719 Jun 202428 Jul 2026
470jeffreyelbarberomaster.comNameCheap, Inc.23 Feb 20235 Apr 202423 Feb 2024
471jeffreyecourt.comAutomattic Inc.9 Apr 201714 Apr 20239 Apr 2024
472jeffreyebrown.icuNameCheap, Inc.1 Mar 202312 May 20241 Mar 2024
473jeffreyebel.comGoDaddy.com, LLC14 Nov 201727 Feb 202414 Nov 2026
474jeffreyearlyoung.comeNom, Inc.5 Mar 20235 Mar 20255 Mar 2026
475jeffreyemeterio.comGransy s.r.o. d/b/a subreg.cz7 Mar 20238 Mar 20247 Mar 2025
476jeffreyeinboden.comWix.com Ltd.18 May 202028 Jul 202318 May 2023
477jeffreyelam.comTucows Domains Inc.16 Jul 20201 Jul 202516 Jul 2026
478jeffreyeverettdesigner.comWix.com Ltd.2 Sep 202013 Oct 20242 Sep 2024
479jeffreyerikmack.comWix.com Ltd.29 Jan 202130 Dec 202429 Jan 2026
480jeffreyevy.comWix.com Ltd.12 Feb 202125 Mar 202312 Feb 2023
481jeffreyevansdds.comGoDaddy.com, LLC26 Jul 202110 Aug 202526 Jul 2026
482jeffreyeisenmesser.comWix.com Ltd.25 Aug 20215 Oct 202325 Aug 2023
483jeffreyedwardtaylor.comWix.com Ltd.26 Aug 202127 Jul 202426 Aug 2027
484jeffreyejeanye.comNameCheap, Inc.20 Sep 20212 Dec 202420 Sep 2024
485jeffreyestersllc.comGoDaddy.com, LLC8 Mar 202220 May 20248 Mar 2024
486jeffreyegonzalez.comSquarespace Domains LLC14 Mar 202213 Apr 202314 Mar 2023
487jeffreyenroxannegaantrouwen.comAutomattic Inc.13 Apr 202324 Mar 202513 Apr 2026
488jeffreyelliottagency.comGoDaddy.com, LLC24 Jun 20225 Sep 202424 Jun 2024
489jeffreyehmann.comSquarespace Domains LLC28 Jun 202228 Aug 202428 Jun 2024
490jeffreyepsteinhotel.comGoDaddy.com, LLC8 Jul 202219 Sep 20238 Jul 2023
491jeffreyepsteinblacklist.comNameKing.com Inc.14 Jul 202227 Aug 202314 Jul 2023
492jeffreyepstein.liveGoogle, Inc.9 Mar 20218 May 20249 Mar 2024
493jeffreyelmont.meNetwork Solutions, LLC3 Feb 20179 Jan 20253 Feb 2026
494jeffreyelshoff.netGoDaddy.com, LLC28 Jul 201728 Jul 202428 Jul 2026
495jeffreyentrevor.nl-13 Jun 20193 Jul 2025-
496jeffreyebooks.comWeb Commerce Communications Limited dba WebNic.cc13 May 202323 Jul 202413 May 2024
497jeffreyeisnercookbook.comAbove.com Pty Ltd.15 Jun 202326 Aug 202415 Jun 2024
498jeffreyexe.onlinePDR Ltd. d/b/a PublicDomainRegistry.com9 Jul 202314 Sep 20249 Jul 2024
499jeffreyef.com1&1 Internet AG12 Jul 202324 Aug 202412 Jul 2024
500jeffreyegbejule.comGoogle, Inc.27 Jul 20237 Sep 202527 Jul 2025
501jeffreyepstein.newsGoDaddy.com, LLC15 Aug 202326 Sep 202415 Aug 2024
502jeffreyebanthestoneminstrel.comAutomattic Inc.30 Aug 202310 Aug 202530 Aug 2026
503jeffreyemakpor.comNameCheap, Inc.30 Sep 202311 Nov 202430 Sep 2024
504jeffreyede.comSquarespace Domains LLC27 Oct 202312 Oct 202527 Oct 2026
505jeffreyensophie.onlineKey-Systems, LLC31 Oct 202313 Jan 202531 Oct 2024
506jeffreyechenim.comNameCheap, Inc.5 Nov 202323 Oct 20245 Nov 2025
507jeffreyenlow.comWild West Domains, LLC13 Dec 202327 Mar 202513 Dec 2025
508jeffreyepsteinlist.comSquarespace Domains LLC23 Dec 20238 Dec 202423 Dec 2025
509jeffreyepsteinslist.comSquarespace Domains LLC23 Dec 20238 Dec 202423 Dec 2025
510jeffreyepsteincommunication.comNameCheap, Inc.24 Dec 202324 Nov 202424 Dec 2025
511jeffreyepstein.bioName.com, Inc.1 Jan 202413 Feb 20251 Jan 2025
512jeffreyepsteinceleblist.com-1 Jan 20241 Jan 20241 Jan 2025
513jeffreyepsteinceleblist.online-5 Jan 202416 Feb 20255 Jan 2025
514jeffreyepsteinclientlist.online-5 Jan 202416 Feb 20255 Jan 2025
515jeffreyepsteindocuments.online-5 Jan 202416 Feb 20255 Jan 2025
516jeffreyepsteinjimmykimmel.comDynadot, LLC10 Jan 202422 Mar 202510 Jan 2025
517jeffreyepstore.comNetwork Solutions, LLC10 Jan 20249 Aug 202510 Jan 2027
518jeffreyepstein.rocksName.com, Inc.22 Jan 20245 Apr 202522 Jan 2025
519jeffreyelfenbeindo.comGoDaddy.com, LLC25 Jan 202426 Jan 202525 Jan 2026
520jeffreyeschwarz.clickNameCheap, Inc.2 Feb 202416 Apr 20252 Feb 2025
521jeffreyebsteinlaw.comGoDaddy.com, LLC26 Feb 202426 Feb 202426 Feb 2026
522jeffreyeinhornlaw.comSquarespace Domains LLC28 Feb 202413 Feb 202528 Feb 2026
523jeffreyeelliotesq.comNetwork Solutions, LLC15 Mar 202428 May 202515 Mar 2025
524jeffreyevansmodels.comMoniker Online Services LLC19 Mar 20241 Jun 202519 Mar 2025
525jeffreyepstein.appCloudFlare, Inc.26 Mar 20245 May 202526 Mar 2025
526jeffreyelfenbein.comGoDaddy.com, LLC26 Mar 202426 Mar 202526 Mar 2027
527jeffreyeranista.comGMO Internet Inc.5 Apr 202417 Jun 20255 Apr 2025
528jeffreyepsteinsisland.comNetwork Solutions, LLC21 Apr 20243 Jun 202521 Apr 2025
529jeffreyearthworx.com.au--24 Sep 2025-
530jeffreyedwardspa.comGoDaddy.com, LLC25 Apr 202425 Apr 202425 Apr 2027
531jeffreyedelheit.comGMO Internet Inc.20 May 20241 Aug 202520 May 2025
532jeffreyepstoon.comNameCheap, Inc.24 May 20245 Jul 202524 May 2025
533jeffreyeugenecrow.comGoDaddy.com, LLC4 Jun 202427 Feb 20254 Jun 2025
534jeffreyeres.techNameCheap, Inc.13 Jun 20241 Jul 202513 Jun 2026
535jeffreyetter.orgGoDaddy.com, LLC20 Jun 20244 Aug 202520 Jun 2026
536jeffreyetter.comGoDaddy.com, LLC20 Jun 202421 Jun 202520 Jun 2026
537jeffreyetter.netGoDaddy.com, LLC20 Jun 202421 Jun 202520 Jun 2026
538jeffreyescobar.comGoDaddy.com, LLC12 Jul 20245 Jun 202512 Jul 2026
539jeffreyedwardepstein.comGoDaddy.com, LLC31 Aug 20241 Sep 202531 Aug 2026
540jeffreyepsteinyearbook.comGoDaddy.com, LLC31 Aug 20241 Sep 202531 Aug 2026
541jeffreyepstein.coDynadot, LLC24 Sep 202421 Jul 202524 Sep 2025
542jeffreyegonzales.comNameCheap, Inc.19 Sep 202420 Sep 202519 Sep 2025
543jeffreyearlgullett.comGoDaddy.com, LLC23 Sep 202423 Sep 202423 Sep 2027
544jeffreyearnhardtracingexperience.comNetwork Solutions, LLC19 Nov 202427 Dec 202419 Nov 2025
545jeffreyepstein.funNameCheap, Inc.7 Dec 202416 Dec 20247 Dec 2025
546jeffreyehillrealtor.comGoDaddy.com, LLC28 Jan 202528 Jan 202528 Jan 2028
547jeffreyedrivon.comHostinger, UAB21 Feb 202521 Feb 202521 Feb 2026
548jeffreyepsteinflightlogs.com-28 Feb 202520 Oct 202528 Feb 2026
549jeffreyepsteinguestbook.com-28 Feb 202520 Oct 202528 Feb 2026
550jeffreyepsteingpt.comNameCheap, Inc.28 Feb 202528 Feb 202528 Feb 2026
551jeffreyescobido.bioAutomattic Inc.5 Mar 202510 Mar 20255 Mar 2026
552jeffreyestolano.comGoDaddy.com, LLC18 Mar 202518 Mar 202518 Mar 2026
553jeffreyethomas.exposedDynadot, LLC28 Mar 20252 Apr 202528 Mar 2026
554jeffreyedwardreynolds.comCloudFlare, Inc.1 Apr 20258 Apr 20251 Apr 2026
555jeffreyedawson.comGoDaddy.com, LLC5 May 20255 May 20255 May 2026
556jeffreyebert.linkAutomattic Inc.12 May 202517 May 202512 May 2026
557jeffreyelectronics.storeDOTSERVE INC.1 Jun 20251 Jul 20251 Jun 2026
558jeffreyedgell.storeGoDaddy.com, LLC28 Jun 202527 Aug 202528 Jun 2026
559jeffreyepsteinsclientlist.comGoDaddy.com, LLC7 Jul 20257 Jul 20257 Jul 2026
560jeffreyepsteintruth.comHostinger, UAB10 Jul 202510 Jul 202510 Jul 2026
561jeffreyepsteinfiles.comGoDaddy.com, LLC14 Jul 202514 Jul 202514 Jul 2026
562jeffreyepsteinsaga.comGoDaddy.com, LLC14 Jul 202514 Jul 202514 Jul 2026
563jeffreyepstein.monsterNameCheap, Inc.16 Jul 20251 Aug 202516 Jul 2026
564jeffreyepsteinclientlist.comWild West Domains, LLC16 Jul 202516 Jul 202516 Jul 2026
565jeffreyepsteinhoax.comDynadot, LLC16 Jul 202514 Sep 202516 Jul 2026
566jeffreyepsteinisinnocent.comGoDaddy.com, LLC17 Jul 202517 Jul 202517 Jul 2026
567jeffreyericfrank.comHostinger, UAB18 Jul 202518 Jul 202518 Jul 2027
568jeffreyearthworx.onlineCrazy Domains FZ-LLC22 Jul 202527 Jul 202522 Jul 2026
569jeffreyepsteinscam.comPorkbun, LLC25 Jul 202525 Jul 202525 Jul 2026
570jeffreyearljacobus.comGoDaddy.com, LLC9 Sep 20259 Sep 20259 Sep 2026
571jeffreyepsteindisciples42.com1&1 Internet AG13 Sep 202513 Sep 202513 Sep 2026
572jeffreyepsteintimeline.comPorkbun, LLC6 Oct 20256 Oct 20256 Oct 2026
573jeffreyepste.inNameCheap, Inc.10 Oct 2025-10 Oct 2026
574jeffreyepsteinballroom.orgGoDaddy.com, LLC24 Oct 202529 Oct 202524 Oct 2027
575jeffreyepsteinballroom.netGoDaddy.com, LLC24 Oct 202524 Oct 202524 Oct 2028
576jeffreyepsteinballroom.comGoDaddy.com, LLC24 Oct 202524 Oct 202524 Oct 2026
577jeffreyepsteinmemorialballroom.comGoDaddy.com, LLC29 Oct 202529 Oct 202529 Oct 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=jeffreye

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now